F452964

General Info

Members Datasets Scaffolds Average Seq Length
484 254 463 432

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0005034|Ga0373926_0005034_715_2259
Length 514
Sequence MDADQPHTPAGRAAGTGRPDGDDGSWIAPGVTGPVSALVRLPGSKSMTNRALVLAALAEGPTQITGPLAARDTALMVAALRALGCGIQTGRDLAGPWLAEPGAAPGGLAGWPPAGSSGHDGELAGREGAARSVVVNVGNAGTVLRFVPAIAALTSADVRFIGDERVAERPLLPMLSALRELGAQIEGGGNGTVPFVVRGGGGLPGGAVTLDASSSSQLISGLLLAAPRYGKGVEVRHQGPPVPSAPHIEMTVAMLRARGVDVTAGTQQAGATPANDAGLTAGPDAMSRPPAAAAITGDTGGERAVCDTWAVLPGAIAAGTIDVEPDLSNAVPFLAAALAIGGEVTIAGWPTASLQPVARVLGLLAAMGATVSQTAAGLRVSGDGRIRGITADLSEVGELTPVLTALAALASSPSRFVGVGHLRRHECDRLAALAGEIGGLGGDVTELPDGLSIRPRPLRSDGVVFDSHDDHRLVMAAAVLGLATGGLRIGNAATAGKTFPGFARFWTQTLAPAG

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
4 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
5 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
6 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
7 2773857933 Frankia sp. BMG5.30 Isolate Nodule
8 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
9 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
10 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
11 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
12 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
13 2919069694 Microbacterium sp. 1154 Isolate Unclassified
14 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
15 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
16 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
17 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
18 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
19 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
20 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.66
Metatranscriptomes 0
Isolates 4.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 5.37
Nodule 0.41
Rhizoplane 5.79
Rhizosphere 83.26
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10005641 3300001990 Bacteria 4310
2 Ga0070683_100017361 3300005329 Bacteria 6362
3 Ga0070683_100171097 3300005329 Bacteria 2062
4 Ga0070682_100032302 3300005337 Bacteria 3172
5 Ga0070660_100039490 3300005339 Bacteria 3588
6 Ga0070659_100021705 3300005366 Bacteria 4896
7 Ga0070709_10011177 3300005434 Bacteria 4994
8 Ga0070709_10014866 3300005434 Bacteria 4414
9 Ga0070714_100000526 3300005435 Bacteria 27664
10 Ga0070714_100010642 3300005435 Bacteria 7278
11 Ga0070714_100029576 3300005435 Bacteria 4555
12 Ga0070714_100038110 3300005435 Bacteria 4042
13 Ga0070714_100048639 3300005435 Bacteria 3607
14 Ga0070713_100003751 3300005436 Bacteria 10057
15 Ga0070713_100036583 3300005436 Bacteria 3962
16 Ga0070710_10002321 3300005437 Bacteria 9000
17 Ga0070710_10006274 3300005437 Bacteria 5697
18 Ga0070710_10051417 3300005437 Bacteria 2313
19 Ga0070711_100008206 3300005439 Bacteria 6386
20 Ga0070711_100035546 3300005439 Bacteria 3332
21 Ga0070711_100091400 3300005439 Bacteria 2194
22 Ga0070708_100026434 3300005445 Bacteria 4968
23 Ga0070708_100047121 3300005445 Bacteria 3806
24 Ga0070708_100063495 3300005445 Bacteria 3306
25 Ga0070706_100005959 3300005467 Bacteria 11530
26 Ga0070706_100013802 3300005467 Bacteria 7468
27 Ga0070706_100015699 3300005467 Bacteria 6995
28 Ga0070706_100028692 3300005467 Bacteria 5124
29 Ga0070706_100090675 3300005467 Bacteria 2835
30 Ga0070706_100206311 3300005467 Bacteria 1835
31 Ga0070707_100000127 3300005468 Bacteria 71273
32 Ga0070707_100001180 3300005468 Bacteria 25707
33 Ga0070707_100025784 3300005468 Bacteria 5580
34 Ga0070707_100249192 3300005468 Bacteria 1728
35 Ga0070698_100002462 3300005471 Bacteria 20439
36 Ga0070698_100002810 3300005471 Bacteria 19152
37 Ga0070698_100014078 3300005471 Bacteria 8457
38 Ga0070698_100072330 3300005471 Bacteria 3456
39 Ga0070684_100062003 3300005535 Bacteria 3274
40 Ga0070684_100131825 3300005535 Bacteria 2255
41 Ga0070696_100065838 3300005546 Bacteria 2540
42 Ga0070665_100001745 3300005548 Bacteria 24881
43 Ga0070665_100196512 3300005548 Bacteria 2018
44 Ga0068855_100003196 3300005563 Bacteria 20063
45 Ga0070664_100105099 3300005564 Bacteria 2459
46 Ga0068857_100004898 3300005577 Bacteria 11361
47 Ga0068857_100078875 3300005577 Bacteria 2939
48 Ga0068856_100008876 3300005614 Bacteria 9780
49 Ga0068856_100047753 3300005614 Bacteria 4218
50 Ga0068856_100089196 3300005614 Bacteria 3066
51 Ga0070702_100044624 3300005615 Bacteria 2504
52 Ga0068864_100014834 3300005618 Bacteria 6474
53 Ga0068863_100048749 3300005841 Bacteria 4016
54 Ga0068858_100123044 3300005842 Bacteria 2428
55 Ga0068860_100118980 3300005843 Bacteria 2529
56 Ga0068860_100200421 3300005843 Bacteria 1934
57 Ga0081455_10020473 3300005937 Bacteria 6225
58 Ga0081540_1002330 3300005983 Bacteria 15548
59 Ga0081540_1016528 3300005983 Bacteria 4611
60 Ga0081539_10002008 3300005985 Bacteria 30810
61 Ga0070717_10111550 3300006028 Bacteria 2334
62 Ga0075365_10000189 3300006038 Bacteria 20092
63 Ga0075365_10002346 3300006038 Bacteria 9224
64 Ga0075365_10012029 3300006038 Bacteria 5118
65 Ga0075363_100000630 3300006048 Bacteria 11660
66 Ga0075363_100038494 3300006048 Bacteria 2515
67 Ga0075363_100061583 3300006048 Bacteria 2023
68 Ga0075363_100067962 3300006048 Bacteria 1932
69 Ga0075364_10001416 3300006051 Bacteria 13006
70 Ga0075364_10024742 3300006051 Bacteria 3815
71 Ga0075364_10036265 3300006051 Bacteria 3187
72 Ga0075364_10042605 3300006051 Bacteria 2950
73 Ga0075364_10074153 3300006051 Bacteria 2243
74 Ga0070715_10002562 3300006163 Bacteria 5606
75 Ga0070716_100001777 3300006173 Bacteria 9759
76 Ga0070716_100011764 3300006173 Bacteria 4413
77 Ga0070716_100040485 3300006173 Bacteria 2592
78 Ga0070712_100023717 3300006175 Bacteria 4057
79 Ga0070712_100049787 3300006175 Bacteria 2911
80 Ga0075367_10002790 3300006178 Bacteria 8096
81 Ga0075369_10003346 3300006186 Bacteria 5826
82 Ga0075370_10007955 3300006353 Bacteria 5432
83 Ga0075370_10045595 3300006353 Bacteria 2480
84 Ga0075428_100034318 3300006844 Bacteria 5597
85 Ga0075428_100084581 3300006844 Bacteria 3461
86 Ga0075431_100014188 3300006847 Bacteria 8058
87 Ga0075431_100158252 3300006847 Bacteria 2330
88 Ga0075433_10028383 3300006852 Bacteria 4757
89 Ga0075434_100028737 3300006871 Bacteria 5467
90 Ga0068865_100024740 3300006881 Bacteria 3943
91 Ga0075436_100008756 3300006914 Bacteria 6921
92 Ga0075436_100057634 3300006914 Bacteria 2683
93 Ga0075435_100005309 3300007076 Bacteria 8975
94 Ga0075435_100025516 3300007076 Bacteria 4601
95 Ga0105245_10001875 3300009098 Bacteria 19079
96 Ga0114129_10001931 3300009147 Bacteria 28347
97 Ga0114129_10004583 3300009147 Bacteria 19500
98 Ga0105248_10003471 3300009177 Bacteria 17511
99 Ga0105237_10012012 3300009545 Bacteria 9148
100 Ga0105238_10222463 3300009551 Bacteria 1864
101 Ga0105249_10018486 3300009553 Bacteria 6204
102 Ga0105249_10325182 3300009553 Bacteria 1550
103 Ga0105239_10084008 3300010375 Bacteria 3507
104 Ga0157369_10046817 3300013105 Bacteria 4700
105 Ga0163162_10258505 3300013306 Bacteria 1873
106 Ga0157375_10003685 3300013308 Bacteria 13302
107 Ga0157375_10369156 3300013308 Bacteria 1601
108 Ga0163163_10098501 3300014325 Bacteria 2945
109 Ga0157379_10002556 3300014968 Bacteria 15266
110 Ga0213876_10019693 3300021384 Bacteria 3564
111 Ga0213875_10030333 3300021388 Bacteria 2560
112 Ga0207692_10007834 3300025898 Bacteria 4396
113 Ga0207692_10009411 3300025898 Bacteria 4081
114 Ga0207699_10000723 3300025906 Bacteria 15748
115 Ga0207699_10003044 3300025906 Bacteria 7957
116 Ga0207699_10004441 3300025906 Bacteria 6708
117 Ga0207643_10034610 3300025908 Bacteria 2831
118 Ga0207684_10001782 3300025910 Bacteria 22690
119 Ga0207684_10011796 3300025910 Bacteria 7620
120 Ga0207671_10007956 3300025914 Bacteria 9083
121 Ga0207693_10036188 3300025915 Bacteria 3891
122 Ga0207693_10058949 3300025915 Bacteria 3007
123 Ga0207693_10111753 3300025915 Bacteria 2143
124 Ga0207663_10011430 3300025916 Bacteria 4767
125 Ga0207663_10027859 3300025916 Bacteria 3299
126 Ga0207662_10031620 3300025918 Bacteria 3075
127 Ga0207657_10084327 3300025919 Bacteria 2664
128 Ga0207646_10000264 3300025922 Bacteria 71299
129 Ga0207646_10001334 3300025922 Bacteria 30684
130 Ga0207646_10003773 3300025922 Bacteria 16878
131 Ga0207646_10026051 3300025922 Bacteria 5344
132 Ga0207646_10157834 3300025922 Bacteria 2046
133 Ga0207687_10012627 3300025927 Bacteria 5518
134 Ga0207700_10003000 3300025928 Bacteria 9730
135 Ga0207700_10005604 3300025928 Bacteria 7536
136 Ga0207700_10013984 3300025928 Bacteria 5246
137 Ga0207700_10031952 3300025928 Bacteria 3747
138 Ga0207700_10080405 3300025928 Bacteria 2541
139 Ga0207664_10002040 3300025929 Bacteria 13312
140 Ga0207664_10007914 3300025929 Bacteria 7385
141 Ga0207664_10019554 3300025929 Bacteria 5007
142 Ga0207664_10035807 3300025929 Bacteria 3832
143 Ga0207690_10033498 3300025932 Bacteria 3304
144 Ga0207665_10004765 3300025939 Bacteria 9021
145 Ga0207665_10014219 3300025939 Bacteria 5238
146 Ga0207665_10146804 3300025939 Bacteria 1686
147 Ga0207711_10002035 3300025941 Bacteria 18284
148 Ga0207689_10043314 3300025942 Bacteria 3721
149 Ga0207661_10103551 3300025944 Bacteria 2395
150 Ga0207679_10097452 3300025945 Bacteria 2291
151 Ga0207667_10003875 3300025949 Bacteria 18400
152 Ga0207677_10236145 3300026023 Bacteria 1476
153 Ga0207703_10075010 3300026035 Bacteria 2802
154 Ga0207641_10096044 3300026088 Bacteria 2603
155 Ga0207674_10002647 3300026116 Bacteria 22374
156 Ga0207674_10004074 3300026116 Bacteria 17710
157 Ga0207674_10042289 3300026116 Bacteria 4708
158 Ga0207428_10015813 3300027907 Bacteria 6513
159 Ga0268266_10011077 3300028379 Bacteria 7852
160 Ga0268264_10040270 3300028381 Bacteria 3861
161 Ga0265337_1000047 3300028556 Bacteria 53962
162 Ga0265326_10004458 3300028558 Bacteria 4484
163 Ga0265319_1010152 3300028563 Bacteria 3947
164 Ga0265334_10000196 3300028573 Bacteria 34888
165 Ga0265338_10000315 3300028800 Bacteria 87685
166 Ga0265338_10004007 3300028800 Bacteria 20224
167 Ga0265338_10013005 3300028800 Bacteria 9440
168 Ga0265324_10003734 3300029957 Bacteria 7134
169 Ga0265332_10000555 3300031238 Bacteria 25185
170 Ga0265320_10001951 3300031240 Bacteria 14562
171 Ga0265325_10012168 3300031241 Bacteria 4925
172 Ga0265340_10005298 3300031247 Bacteria 7163
173 Ga0265339_10033366 3300031249 Bacteria 2899
174 Ga0265314_10007466 3300031711 Bacteria 9481
175 Ga0265342_10011381 3300031712 Bacteria 6096
176 Ga0316576_10013494 3300031727 Bacteria 5433
177 Ga0316578_10009742 3300031728 Bacteria 4954
178 Ga0307410_10009623 3300031852 Bacteria 5434
179 Ga0307407_10003878 3300031903 Bacteria 6234
180 Ga0307409_100000649 3300031995 Bacteria 15381
181 Ga0307416_100045327 3300032002 Bacteria 3462
182 Ga0307415_100000600 3300032126 Bacteria 15760
183 Ga0373948_0002505 3300034817 Bacteria 2728
184 Ga0373926_0004231 3300035083 Bacteria 4690
185 Ga0373926_0005034 3300035083 Bacteria 4343
186 Ga0373934_0000561 3300035086 Bacteria 13097
187 Ga0373934_0004892 3300035086 Bacteria 4959
188 Ga0373934_0009784 3300035086 Bacteria 3597
189 Ga0373940_0006868 3300035088 Bacteria 2547
190 Ga0373944_0004380 3300035089 Bacteria 3674
191 Ga0373923_0002025 3300035111 Bacteria 6101
192 Ga0373923_0006485 3300035111 Bacteria 4050
193 Ga0373936_0000347 3300035113 Bacteria 15677
194 Ga0373936_0026672 3300035113 Bacteria 2263
195 Ga0373939_0014392 3300035114 Bacteria 2052
196 Ga0373953_0000233 3300035117 Bacteria 15083
197 Ga0373953_0013097 3300035117 Bacteria 2953
198 Ga0373953_0070663 3300035117 Bacteria 1440
199 Ga0373954_0000481 3300035118 Bacteria 14980
200 Ga0373954_0012350 3300035118 Bacteria 3796
201 Ga0373954_0028913 3300035118 Bacteria 2550
202 Ga0373954_0036834 3300035118 Bacteria 2272
203 Ga0373956_0001048 3300035119 Bacteria 11380
204 Ga0373956_0003076 3300035119 Bacteria 6751
205 Ga0373956_0023416 3300035119 Bacteria 2650
206 Ga0373957_0000738 3300035120 Bacteria 8491
207 Ga0373957_0004674 3300035120 Bacteria 4187
208 Ga0373957_0015517 3300035120 Bacteria 2623
209 Ga0373943_0000269 3300035170 Bacteria 21448
210 Ga0373946_0002656 3300035171 Bacteria 6311
211 Ga0373946_0045579 3300035171 Bacteria 1815
212 Ga0373955_0001112 3300035172 Bacteria 11425
213 Ga0373955_0005070 3300035172 Bacteria 5890
214 Ga0316574_0047149 3300035398 Bacteria 2674
215 Ga0316574_0080754 3300035398 Bacteria 2064
216 Ga0373924_0004987 3300035410 Bacteria 4670
217 Ga0373924_0031240 3300035410 Bacteria 2140
218 Ga0373924_0035749 3300035410 Bacteria 2015
219 Ga0373935_0000373 3300035692 Bacteria 22971
220 Ga0373935_0006429 3300035692 Bacteria 7015
221 Ga0373935_0044280 3300035692 Bacteria 2804
222 Ga0373927_0003404 3300035695 Bacteria 11440
223 Ga0373933_0000079 3300035724 Bacteria 60394
224 Ga0373933_0001758 3300035724 Bacteria 12570
225 Ga0373933_0004437 3300035724 Bacteria 7701
226 Ga0373933_0014534 3300035724 Bacteria 4380
227 Ga0373933_0044033 3300035724 Bacteria 2642
228 Ga0373933_0096785 3300035724 Bacteria 1827
229 Ga0373947_0000007 3300035725 Bacteria 192259
230 Ga0373947_0005634 3300035725 Bacteria 7303
231 Ga0373937_0000189 3300036401 Bacteria 60393
232 Ga0373937_0022234 3300036401 Bacteria 5699
233 Ga0373937_0032811 3300036401 Bacteria 4711
234 Ga0373937_0083590 3300036401 Bacteria 2953
235 Ga0373937_0206248 3300036401 Bacteria 1848
236 Ga0316584_0001229 3300036712 Bacteria 15141
237 Ga0373925_0001710 3300037068 Bacteria 18498
238 Ga0373925_0049696 3300037068 Bacteria 3126
239 Ga0373925_0081340 3300037068 Bacteria 2463
240 Ga0373925_0135597 3300037068 Bacteria 1923
241 Ga0373925_0184714 3300037068 Bacteria 1652
242 Ga0436364_0106856 3300037853 Bacteria 2572
243 Ga0436364_0209569 3300037853 Bacteria 4325
244 Ga0436364_0986170 3300037853 Bacteria 2268
245 Ga0436365_0393187 3300039437 Bacteria 11582
246 Ga0436365_1691907 3300039437 Bacteria 1646
247 Ga0439465_0001921 3300041413 Bacteria 6816
248 Ga0466965_0013948 3300044683 Bacteria 3799
249 Ga0466966_0014087 3300044684 Bacteria 5294
250 Ga0466961_0010863 3300044693 Bacteria 5815
251 Ga0466961_0096181 3300044693 Bacteria 1867
252 Ga0466964_0008073 3300044706 Bacteria 3947
253 Ga0466970_0016154 3300044765 Bacteria 3845
254 Ga0466957_0017570 3300044842 Bacteria 4192
255 Ga0466957_0033702 3300044842 Bacteria 3073
256 Ga0466960_0007045 3300044901 Bacteria 4544
257 Ga0466960_0031858 3300044901 Bacteria 2435
258 Ga0466959_0004319 3300045049 Bacteria 9490
259 Ga0466959_0032689 3300045049 Bacteria 3851
260 Ga0466958_0011794 3300045836 Bacteria 4934
261 Ga0466958_0018646 3300045836 Bacteria 4031
262 Ga0466958_0137602 3300045836 Bacteria 1536
263 Ga0466967_0043217 3300045976 Bacteria 3900
264 Ga0466967_0047308 3300045976 Bacteria 3749
265 Ga0466967_0224724 3300045976 Bacteria 1785
266 Ga0466967_0226818 3300045976 Bacteria 1777
267 Ga0495592_0000154 3300046454 Bacteria 59985
268 Ga0495592_0076931 3300046454 Bacteria 2420
269 Ga0495592_0101656 3300046454 Bacteria 2048
270 Ga0495629_0003669 3300046459 Bacteria 11601
271 Ga0495629_0009680 3300046459 Bacteria 7039
272 Ga0495641_0003291 3300046461 Bacteria 12200
273 Ga0495641_0011293 3300046461 Bacteria 5103
274 Ga0495651_0001468 3300046462 Bacteria 18227
275 Ga0495651_0065663 3300046462 Bacteria 2770
276 Ga0495651_0095120 3300046462 Bacteria 2228
277 Ga0495651_0176822 3300046462 Bacteria 1514
278 Ga0495651_0197307 3300046462 Bacteria 1411
279 Ga0495653_0005775 3300046463 Bacteria 10130
280 Ga0495653_0034000 3300046463 Bacteria 4035
281 Ga0495653_0117350 3300046463 Bacteria 1901
282 Ga0495582_0006221 3300046473 Bacteria 6648
283 Ga0495582_0086486 3300046473 Bacteria 1744
284 Ga0495582_0158307 3300046473 Bacteria 1287
285 Ga0495639_0026077 3300046475 Bacteria 2581
286 Ga0495662_0010098 3300046476 Bacteria 4630
287 Ga0495662_0091118 3300046476 Bacteria 1486
288 Ga0495664_0000535 3300046477 Bacteria 19109
289 Ga0495664_0007516 3300046477 Bacteria 6059
290 Ga0495664_0011653 3300046477 Bacteria 4962
291 Ga0495664_0017428 3300046477 Bacteria 4105
292 Ga0495608_0000123 3300046511 Bacteria 55519
293 Ga0495608_0020301 3300046511 Bacteria 4567
294 Ga0495608_0032142 3300046511 Bacteria 3547
295 Ga0495608_0061103 3300046511 Bacteria 2478
296 Ga0495618_0013261 3300046514 Bacteria 5015
297 Ga0495618_0016971 3300046514 Bacteria 4462
298 Ga0495618_0026855 3300046514 Bacteria 3581
299 Ga0495628_0002772 3300046516 Bacteria 15701
300 Ga0495628_0082037 3300046516 Bacteria 2504
301 Ga0495630_0011233 3300046517 Bacteria 6478
302 Ga0495666_0082163 3300046526 Bacteria 1523
303 Ga0495652_0000278 3300046529 Bacteria 60389
304 Ga0495652_0041137 3300046529 Bacteria 3991
305 Ga0495652_0088949 3300046529 Bacteria 2530
306 Ga0495652_0090494 3300046529 Bacteria 2503
307 Ga0495652_0140879 3300046529 Bacteria 1896
308 Ga0495665_0002309 3300046531 Bacteria 10305
309 Ga0495665_0022190 3300046531 Bacteria 3413
310 Ga0495640_0009144 3300046533 Bacteria 7734
311 Ga0495640_0030704 3300046533 Bacteria 3844
312 Ga0495640_0162236 3300046533 Bacteria 1431
313 Ga0495587_0000126 3300046536 Bacteria 57849
314 Ga0495587_0016503 3300046536 Bacteria 4593
315 Ga0495587_0018672 3300046536 Bacteria 4298
316 Ga0495587_0034811 3300046536 Bacteria 3035
317 Ga0495645_0018616 3300046543 Bacteria 4990
318 Ga0495645_0040139 3300046543 Bacteria 3414
319 Ga0495645_0049044 3300046543 Bacteria 3075
320 Ga0495667_0000123 3300046559 Bacteria 55776
321 Ga0495667_0005676 3300046559 Bacteria 8444
322 Ga0495667_0024018 3300046559 Bacteria 4105
323 Ga0495667_0047062 3300046559 Bacteria 2850
324 Ga0495667_0047416 3300046559 Bacteria 2839
325 Ga0495667_0096151 3300046559 Bacteria 1917
326 Ga0495634_0013575 3300046642 Bacteria 5883
327 Ga0495634_0025430 3300046642 Bacteria 4142
328 Ga0495634_0031351 3300046642 Bacteria 3662
329 Ga0495634_0046472 3300046642 Bacteria 2929
330 Ga0495635_0003979 3300046663 Bacteria 10274
331 Ga0495635_0006344 3300046663 Bacteria 8245
332 Ga0495635_0036900 3300046663 Bacteria 3384
333 Ga0495635_0074739 3300046663 Bacteria 2321
334 Ga0495588_0013820 3300046674 Bacteria 3852
335 Ga0495657_0000164 3300046675 Bacteria 59903
336 Ga0495657_0048146 3300046675 Bacteria 2877
337 Ga0495657_0059118 3300046675 Bacteria 2543
338 Ga0495657_0095350 3300046675 Bacteria 1901
339 Ga0495657_0113653 3300046675 Bacteria 1712
340 Ga0495599_0000096 3300046678 Bacteria 61855
341 Ga0495599_0016286 3300046678 Bacteria 4616
342 Ga0495599_0026632 3300046678 Bacteria 3624
343 Ga0495623_0000243 3300046679 Bacteria 35316
344 Ga0495623_0017848 3300046679 Bacteria 4583
345 Ga0495623_0063717 3300046679 Bacteria 2307
346 Ga0495646_0027232 3300046680 Bacteria 3586
347 Ga0495646_0040201 3300046680 Bacteria 2881
348 Ga0495646_0045947 3300046680 Bacteria 2665
349 Ga0495647_0051760 3300046681 Bacteria 1597
350 Ga0495658_0076385 3300046683 Bacteria 1958
351 Ga0495613_0023513 3300046689 Bacteria 4591
352 Ga0495613_0075878 3300046689 Bacteria 2447
353 Ga0495624_0020085 3300046690 Bacteria 4450
354 Ga0495600_0003363 3300046809 Bacteria 9407
355 Ga0495600_0011396 3300046809 Bacteria 5537
356 Ga0495600_0068109 3300046809 Bacteria 2326
357 Ga0495581_0005534 3300047315 Bacteria 7317
358 Ga0495581_0019829 3300047315 Bacteria 3904
359 Ga0495581_0028749 3300047315 Bacteria 3223
360 Ga0495604_0000141 3300047317 Bacteria 61811
361 Ga0495604_0015711 3300047317 Bacteria 6041
362 Ga0495604_0033529 3300047317 Bacteria 4064
363 Ga0495604_0133836 3300047317 Bacteria 1779
364 Ga0495674_0000921 3300047319 Bacteria 28109
365 Ga0495674_0021122 3300047319 Bacteria 6023
366 Ga0495674_0056564 3300047319 Bacteria 3434
367 Ga0495674_0063732 3300047319 Bacteria 3205
368 Ga0495676_0013276 3300047321 Bacteria 7406
369 Ga0495676_0187842 3300047321 Bacteria 1443
370 Ga0495680_0000874 3300047322 Bacteria 33467
371 Ga0495680_0017113 3300047322 Bacteria 6203
372 Ga0495680_0033433 3300047322 Bacteria 4163
373 Ga0495680_0059386 3300047322 Bacteria 2952
374 Ga0495675_0016882 3300047444 Bacteria 4618
375 Ga0495675_0103782 3300047444 Bacteria 1777
376 Ga0495675_0166073 3300047444 Bacteria 1357
377 Ga0495684_0001898 3300047471 Bacteria 16753
378 Ga0495684_0009060 3300047471 Bacteria 7684
379 Ga0495684_0015156 3300047471 Bacteria 5935
380 Ga0495684_0086460 3300047471 Bacteria 2376
381 Ga0495684_0127420 3300047471 Bacteria 1914
382 Ga0495593_0004138 3300047673 Bacteria 8634
383 Ga0495602_0000189 3300048088 Bacteria 58271
384 Ga0495602_0032490 3300048088 Bacteria 4912
385 Ga0495602_0046174 3300048088 Bacteria 3936
386 Ga0495602_0078347 3300048088 Bacteria 2791
387 Ga0495602_0088621 3300048088 Bacteria 2575
388 Ga0496100_0057178 3300048903 Bacteria 2554
389 Ga0496101_0066767 3300048904 Bacteria 2625
390 Ga0496101_0115516 3300048904 Bacteria 2024
391 Ga0496102_0103674 3300048905 Bacteria 2645
392 Ga0496102_0201281 3300048905 Bacteria 1877
393 Ga0496104_0001843 3300048907 Bacteria 18340
394 Ga0496104_0174257 3300048907 Bacteria 2061
395 Ga0496105_0024968 3300048908 Bacteria 4858
396 Ga0496105_0140857 3300048908 Bacteria 1985
397 Ga0496106_0116961 3300048909 Bacteria 2080
398 Ga0496107_0089003 3300048910 Bacteria 2254
399 Ga0496107_0091765 3300048910 Bacteria 2220
400 Ga0496108_0215702 3300048911 Bacteria 1666
401 Ga0496109_0031639 3300048912 Bacteria 4751
402 Ga0496109_0054464 3300048912 Bacteria 3649
403 Ga0496109_0178142 3300048912 Bacteria 1996
404 Ga0496110_0001726 3300048913 Bacteria 16096
405 Ga0496110_0007706 3300048913 Bacteria 8617
406 Ga0496110_0021583 3300048913 Bacteria 5456
407 Ga0496110_0254212 3300048913 Bacteria 1599
408 Ga0496110_0262219 3300048913 Bacteria 1573
409 Ga0496111_0043079 3300048914 Bacteria 3243
410 Ga0496112_0002530 3300048915 Bacteria 14770
411 Ga0496114_0051359 3300048917 Bacteria 3433
412 Ga0496114_0113226 3300048917 Bacteria 2326
413 Ga0496115_0032672 3300048918 Bacteria 4106
414 Ga0496115_0081306 3300048918 Bacteria 2639
415 Ga0496115_0120003 3300048918 Unclassified 2163
416 Ga0496126_0041020 3300048929 Bacteria 4288
417 Ga0501033_0005697 3300049570 Bacteria 9820
418 Ga0501034_0226101 3300049571 Bacteria 1822
419 Ga0501040_0195599 3300049576 Bacteria 1435
420 Ga0501042_0117988 3300049578 Bacteria 1910
421 Ga0501043_0106178 3300049579 Bacteria 2206
422 Ga0501043_0163726 3300049579 Bacteria 1737
423 Ga0501048_0260878 3300049582 Bacteria 1231
424 Ga0501067_0000186 3300049583 Bacteria 35281
425 Ga0501067_0007567 3300049583 Bacteria 6039
426 Ga0501069_0014860 3300049585 Bacteria 4169
427 Ga0501070_0001163 3300049586 Bacteria 23531
428 Ga0501070_0085824 3300049586 Bacteria 2606
429 Ga0501070_0089525 3300049586 Bacteria 2547
430 Ga0501073_0066282 3300049589 Bacteria 2517
431 Ga0501074_0006228 3300049590 Bacteria 8610
432 Ga0501079_0000971 3300049741 Bacteria 19779
433 Ga0501079_0018741 3300049741 Bacteria 5288
434 Ga0501080_0000278 3300049742 Bacteria 38585
435 Ga0501083_0052819 3300049744 Bacteria 2729
436 Ga0501044_0042122 3300049823 Bacteria 4752
437 nmdc:mga03n38_3638_c1 3300050490 Bacteria 4981
438 nmdc:mga03n38_68866_c1 3300050490 Bacteria 1632
439 nmdc:mga00v17_1839_c1 3300050491 Bacteria 10962
440 nmdc:mga00v17_87633_c1 3300050491 Bacteria 1951
441 nmdc:mga0yw44_85097_c1 3300050492 Bacteria 1989
442 nmdc:mga06z11_28987_c1 3300050494 Bacteria 2662
443 nmdc:mga06z11_99107_c1 3300050494 Bacteria 1596
444 nmdc:mga05p37_174352_c1 3300050507 Bacteria 2621
445 nmdc:mga05p37_5027_c1 3300050507 Bacteria 15495
446 nmdc:mga0qj67_148927_c1 3300050509 Bacteria 1898
447 nmdc:mga08y16_126114_c1 3300050511 Bacteria 2663
448 nmdc:mga0rr50_22725_c1 3300050513 Bacteria 4310
449 nmdc:mga08x19_12800_c1 3300050514 Bacteria 5060
450 nmdc:mga0a205_93339_c1 3300050515 Bacteria 2908
451 nmdc:mga0sz30_17583_c1 3300050516 Bacteria 2853
452 nmdc:mga0sz30_62629_c1 3300050516 Bacteria 1591
453 Ga0495601_0017946 3300053077 Bacteria 4302
454 Ga0495601_0103477 3300053077 Bacteria 1840
455 Ga0495612_0006530 3300053078 Bacteria 4792
456 Ga0495612_0035759 3300053078 Bacteria 2014
457 Ga0500635_0018017 3300053080 Bacteria 2125
458 Ga0495595_0001222 3300053084 Bacteria 9995
459 Ga0495595_0004215 3300053084 Bacteria 5781
460 Ga0495595_0026902 3300053084 Bacteria 2559
461 Ga0495619_0016278 3300053085 Bacteria 4706
462 Ga0466962_0084543 3300061719 Bacteria 1518
463 Ga0530510_0047460 3300061734 Bacteria 3103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0187842 Ga0495676_0187842_342_1424 331
2 3300046473 Ga0495582_0158307 Ga0495582_0158307_118_1266 350
3 3300046526 Ga0495666_0082163 Ga0495666_0082163_10_1158 350
4 3300046642 Ga0495634_0046472 Ga0495634_0046472_1769_2917 350
5 3300046462 Ga0495651_0197307 Ga0495651_0197307_268_1401 353
6 3300035398 Ga0316574_0080754 Ga0316574_0080754_948_2051 359
7 3300050494 nmdc:mga06z11_99107_c1 nmdc:mga06z11_99107_c1_394_1566 365
8 3300048912 Ga0496109_0178142 Ga0496109_0178142_21_1154 366
9 3300049582 Ga0501048_0260878 Ga0501048_0260878_65_1165 366
10 3300048903 Ga0496100_0057178 Ga0496100_0057178_1352_2515 367
11 3300035114 Ga0373939_0014392 Ga0373939_0014392_19_1290 379
12 3300046476 Ga0495662_0091118 Ga0495662_0091118_233_1468 379
13 3300005435 Ga0070714_100048639 Ga0070714_1000486394 381
14 3300025928 Ga0207700_10013984 Ga0207700_100139846 381
15 3300049579 Ga0501043_0106178 Ga0501043_0106178_267_1496 384
16 3300046473 Ga0495582_0086486 Ga0495582_0086486_330_1667 387
17 3300025906 Ga0207699_10004441 Ga0207699_100044416 388
18 3300025916 Ga0207663_10027859 Ga0207663_100278592 388
19 3300034817 Ga0373948_0002505 Ga0373948_0002505_1035_2372 388
20 3300050516 nmdc:mga0sz30_62629_c1 nmdc:mga0sz30_62629_c1_264_1565 388
21 3300005471 Ga0070698_100014078 Ga0070698_1000140782 389
22 3300045976 Ga0466967_0047308 Ga0466967_0047308_1083_2387 389
23 3300048908 Ga0496105_0024968 Ga0496105_0024968_2331_3668 389
24 3300035086 Ga0373934_0000561 Ga0373934_0000561_9008_10339 390
25 3300035117 Ga0373953_0000233 Ga0373953_0000233_9043_10374 390
26 3300035118 Ga0373954_0000481 Ga0373954_0000481_2992_4323 390
27 3300035119 Ga0373956_0001048 Ga0373956_0001048_9013_10344 390
28 3300035172 Ga0373955_0001112 Ga0373955_0001112_9144_10475 390
29 3300035724 Ga0373933_0000079 Ga0373933_0000079_49545_50876 390
30 3300036401 Ga0373937_0000189 Ga0373937_0000189_49545_50876 390
31 3300046454 Ga0495592_0000154 Ga0495592_0000154_49545_50876 390
32 3300046462 Ga0495651_0001468 Ga0495651_0001468_9528_10859 390
33 3300046463 Ga0495653_0005775 Ga0495653_0005775_5635_6966 390
34 3300046511 Ga0495608_0000123 Ga0495608_0000123_9065_10396 390
35 3300046516 Ga0495628_0002772 Ga0495628_0002772_5263_6594 390
36 3300046529 Ga0495652_0000278 Ga0495652_0000278_9519_10850 390
37 3300046536 Ga0495587_0000126 Ga0495587_0000126_6974_8305 390
38 3300046559 Ga0495667_0000123 Ga0495667_0000123_44927_46258 390
39 3300046675 Ga0495657_0000164 Ga0495657_0000164_49544_50875 390
40 3300046678 Ga0495599_0000096 Ga0495599_0000096_9358_10689 390
41 3300046679 Ga0495623_0000243 Ga0495623_0000243_9026_10357 390
42 3300047317 Ga0495604_0000141 Ga0495604_0000141_49823_51154 390
43 3300047322 Ga0495680_0000874 Ga0495680_0000874_9143_10474 390
44 3300048088 Ga0495602_0000189 Ga0495602_0000189_7396_8727 390
45 3300053084 Ga0495595_0001222 Ga0495595_0001222_5924_7255 390
46 3300009147 Ga0114129_10004583 Ga0114129_1000458318 391
47 3300025939 Ga0207665_10146804 Ga0207665_101468042 391
48 3300048929 Ga0496126_0041020 Ga0496126_0041020_328_1626 391
49 3300050507 nmdc:mga05p37_174352_c1 nmdc:mga05p37_174352_c1_771_2015 391
50 3300005439 Ga0070711_100035546 Ga0070711_1000355464 393
51 3300006914 Ga0075436_100057634 Ga0075436_1000576342 393
52 3300044683 Ga0466965_0013948 Ga0466965_0013948_1907_3199 394
53 3300044684 Ga0466966_0014087 Ga0466966_0014087_3056_4348 394
54 3300044693 Ga0466961_0010863 Ga0466961_0010863_2258_3550 394
55 3300044706 Ga0466964_0008073 Ga0466964_0008073_1862_3154 394
56 3300044765 Ga0466970_0016154 Ga0466970_0016154_833_2125 394
57 3300044842 Ga0466957_0017570 Ga0466957_0017570_1704_2996 394
58 3300044842 Ga0466957_0033702 Ga0466957_0033702_340_1626 394
59 3300044901 Ga0466960_0031858 Ga0466960_0031858_656_1942 394
60 3300045049 Ga0466959_0032689 Ga0466959_0032689_1067_2359 394
61 3300045836 Ga0466958_0011794 Ga0466958_0011794_3150_4442 394
62 3300045836 Ga0466958_0137602 Ga0466958_0137602_145_1431 394
63 3300045976 Ga0466967_0043217 Ga0466967_0043217_726_2012 394
64 3300061719 Ga0466962_0084543 Ga0466962_0084543_104_1396 394
65 3300035111 Ga0373923_0006485 Ga0373923_0006485_901_2217 395
66 3300035113 Ga0373936_0026672 Ga0373936_0026672_837_2153 395
67 3300035117 Ga0373953_0013097 Ga0373953_0013097_227_1543 395
68 3300035118 Ga0373954_0012350 Ga0373954_0012350_2079_3395 395
69 3300035119 Ga0373956_0003076 Ga0373956_0003076_3098_4414 395
70 3300035120 Ga0373957_0015517 Ga0373957_0015517_194_1510 395
71 3300035171 Ga0373946_0045579 Ga0373946_0045579_311_1627 395
72 3300035410 Ga0373924_0035749 Ga0373924_0035749_176_1492 395
73 3300035692 Ga0373935_0044280 Ga0373935_0044280_1437_2753 395
74 3300035724 Ga0373933_0001758 Ga0373933_0001758_1321_2637 395
75 3300046462 Ga0495651_0065663 Ga0495651_0065663_1176_2492 395
76 3300046463 Ga0495653_0034000 Ga0495653_0034000_1419_2735 395
77 3300046511 Ga0495608_0020301 Ga0495608_0020301_2396_3712 395
78 3300046514 Ga0495618_0026855 Ga0495618_0026855_474_1790 395
79 3300046533 Ga0495640_0162236 Ga0495640_0162236_53_1369 395
80 3300046536 Ga0495587_0016503 Ga0495587_0016503_2002_3318 395
81 3300046543 Ga0495645_0018616 Ga0495645_0018616_1688_3004 395
82 3300046559 Ga0495667_0047062 Ga0495667_0047062_1240_2556 395
83 3300046642 Ga0495634_0031351 Ga0495634_0031351_868_2184 395
84 3300046663 Ga0495635_0036900 Ga0495635_0036900_710_2026 395
85 3300046675 Ga0495657_0048146 Ga0495657_0048146_396_1712 395
86 3300046678 Ga0495599_0026632 Ga0495599_0026632_1169_2485 395
87 3300046689 Ga0495613_0075878 Ga0495613_0075878_900_2216 395
88 3300046809 Ga0495600_0011396 Ga0495600_0011396_2308_3624 395
89 3300047317 Ga0495604_0015711 Ga0495604_0015711_2984_4300 395
90 3300047322 Ga0495680_0033433 Ga0495680_0033433_749_2065 395
91 3300047471 Ga0495684_0015156 Ga0495684_0015156_3461_4777 395
92 3300048088 Ga0495602_0032490 Ga0495602_0032490_960_2276 395
93 3300006038 Ga0075365_10002346 Ga0075365_100023466 397
94 3300006051 Ga0075364_10024742 Ga0075364_100247421 397
95 3300050491 nmdc:mga00v17_87633_c1 nmdc:mga00v17_87633_c1_630_1904 397
96 3300053078 Ga0495612_0035759 Ga0495612_0035759_486_1895 397
97 3300006048 Ga0075363_100038494 Ga0075363_1000384942 398
98 3300006353 Ga0075370_10045595 Ga0075370_100455951 398
99 3300035120 Ga0373957_0004674 Ga0373957_0004674_471_1826 398
100 3300035410 Ga0373924_0031240 Ga0373924_0031240_167_1537 398
101 3300035724 Ga0373933_0004437 Ga0373933_0004437_2486_3856 398
102 3300036401 Ga0373937_0032811 Ga0373937_0032811_2591_3961 398
103 3300046477 Ga0495664_0011653 Ga0495664_0011653_848_2185 398
104 3300046679 Ga0495623_0017848 Ga0495623_0017848_603_1973 398
105 3300005842 Ga0068858_100123044 Ga0068858_1001230441 399
106 3300026035 Ga0207703_10075010 Ga0207703_100750101 399
107 3300036401 Ga0373937_0022234 Ga0373937_0022234_4325_5680 399
108 3300048904 Ga0496101_0115516 Ga0496101_0115516_60_1361 399
109 3300048905 Ga0496102_0201281 Ga0496102_0201281_395_1696 399
110 3300025915 Ga0207693_10058949 Ga0207693_100589493 400
111 3300035088 Ga0373940_0006868 Ga0373940_0006868_321_1658 400
112 3300047444 Ga0495675_0166073 Ga0495675_0166073_53_1321 400
113 3300048907 Ga0496104_0174257 Ga0496104_0174257_343_1680 400
114 3300048917 Ga0496114_0051359 Ga0496114_0051359_645_1982 400
115 3300049578 Ga0501042_0117988 Ga0501042_0117988_131_1699 400
116 3300005546 Ga0070696_100065838 Ga0070696_1000658382 401
117 3300005614 Ga0068856_100047753 Ga0068856_1000477535 401
118 3300005841 Ga0068863_100048749 Ga0068863_1000487494 401
119 3300006048 Ga0075363_100061583 Ga0075363_1000615831 401
120 3300021384 Ga0213876_10019693 Ga0213876_100196933 401
121 3300039437 Ga0436365_0393187 Ga0436365_0393187_5456_6703 401
122 3300045976 Ga0466967_0226818 Ga0466967_0226818_85_1296 401
123 3300050490 nmdc:mga03n38_68866_c1 nmdc:mga03n38_68866_c1_189_1469 401
124 3300050491 nmdc:mga00v17_1839_c1 nmdc:mga00v17_1839_c1_8243_9481 401
125 3300050509 nmdc:mga0qj67_148927_c1 nmdc:mga0qj67_148927_c1_590_1849 401
126 3300050516 nmdc:mga0sz30_17583_c1 nmdc:mga0sz30_17583_c1_110_1348 401
127 3300049823 Ga0501044_0042122 Ga0501044_0042122_2299_3558 402
128 3300006844 Ga0075428_100034318 Ga0075428_1000343185 403
129 3300006847 Ga0075431_100158252 Ga0075431_1001582522 403
130 3300005983 Ga0081540_1002330 Ga0081540_10023309 404
131 3300031727 Ga0316576_10013494 Ga0316576_100134945 404
132 3300031728 Ga0316578_10009742 Ga0316578_100097427 404
133 3300035086 Ga0373934_0004892 Ga0373934_0004892_2189_3526 404
134 3300035724 Ga0373933_0014534 Ga0373933_0014534_1128_2465 404
135 3300044901 Ga0466960_0007045 Ga0466960_0007045_237_1451 404
136 3300046454 Ga0495592_0076931 Ga0495592_0076931_359_1696 404
137 3300046459 Ga0495629_0009680 Ga0495629_0009680_3257_4594 404
138 3300046462 Ga0495651_0176822 Ga0495651_0176822_158_1495 404
139 3300046533 Ga0495640_0030704 Ga0495640_0030704_2465_3802 404
140 3300046674 Ga0495588_0013820 Ga0495588_0013820_2089_3426 404
141 3300046675 Ga0495657_0059118 Ga0495657_0059118_589_1926 404
142 3300046680 Ga0495646_0040201 Ga0495646_0040201_619_1956 404
143 3300046689 Ga0495613_0023513 Ga0495613_0023513_428_1765 404
144 3300047315 Ga0495581_0005534 Ga0495581_0005534_5875_7212 404
145 3300047319 Ga0495674_0021122 Ga0495674_0021122_880_2217 404
146 3300047471 Ga0495684_0001898 Ga0495684_0001898_5534_6871 404
147 3300047471 Ga0495684_0127420 Ga0495684_0127420_20_1357 404
148 3300047673 Ga0495593_0004138 Ga0495593_0004138_1057_2394 404
149 3300048088 Ga0495602_0046174 Ga0495602_0046174_359_1696 404
150 3300053077 Ga0495601_0103477 Ga0495601_0103477_35_1372 404
151 3300005329 Ga0070683_100017361 Ga0070683_1000173617 405
152 3300005329 Ga0070683_100171097 Ga0070683_1001710972 405
153 3300005337 Ga0070682_100032302 Ga0070682_1000323022 405
154 3300005339 Ga0070660_100039490 Ga0070660_1000394902 405
155 3300005366 Ga0070659_100021705 Ga0070659_1000217054 405
156 3300005535 Ga0070684_100062003 Ga0070684_1000620032 405
157 3300005535 Ga0070684_100131825 Ga0070684_1001318252 405
158 3300005615 Ga0070702_100044624 Ga0070702_1000446243 405
159 3300009098 Ga0105245_10001875 Ga0105245_1000187512 405
160 3300009551 Ga0105238_10222463 Ga0105238_102224632 405
161 3300009553 Ga0105249_10018486 Ga0105249_100184863 405
162 3300010375 Ga0105239_10084008 Ga0105239_100840083 405
163 3300013306 Ga0163162_10258505 Ga0163162_102585052 405
164 3300013308 Ga0157375_10003685 Ga0157375_1000368510 405
165 3300013308 Ga0157375_10369156 Ga0157375_103691562 405
166 3300014325 Ga0163163_10098501 Ga0163163_100985013 405
167 3300014968 Ga0157379_10002556 Ga0157379_1000255617 405
168 3300025944 Ga0207661_10103551 Ga0207661_101035512 405
169 3300046683 Ga0495658_0076385 Ga0495658_0076385_414_1640 405
170 3300048912 Ga0496109_0054464 Ga0496109_0054464_682_1905 405
171 3300048913 Ga0496110_0001726 Ga0496110_0001726_328_1551 405
172 3300048914 Ga0496111_0043079 Ga0496111_0043079_204_1427 405
173 3300049586 Ga0501070_0085824 Ga0501070_0085824_299_1579 405
174 3300005445 Ga0070708_100026434 Ga0070708_1000264345 406
175 3300005467 Ga0070706_100028692 Ga0070706_1000286925 406
176 3300005468 Ga0070707_100249192 Ga0070707_1002491922 406
177 3300005471 Ga0070698_100002462 Ga0070698_10000246213 406
178 3300006028 Ga0070717_10111550 Ga0070717_101115502 406
179 3300025910 Ga0207684_10001782 Ga0207684_1000178222 406
180 3300025922 Ga0207646_10001334 Ga0207646_1000133428 406
181 3300005467 Ga0070706_100090675 Ga0070706_1000906751 407
182 3300006844 Ga0075428_100084581 Ga0075428_1000845813 407
183 3300006847 Ga0075431_100014188 Ga0075431_10001418811 407
184 3300044693 Ga0466961_0096181 Ga0466961_0096181_519_1811 407
185 3300048913 Ga0496110_0007706 Ga0496110_0007706_270_1526 407
186 3300048918 Ga0496115_0120003 Ga0496115_0120003_814_2070 407
187 3300007076 Ga0075435_100005309 Ga0075435_1000053097 408
188 3300007076 Ga0075435_100025516 Ga0075435_1000255163 408
189 3300027907 Ga0207428_10015813 Ga0207428_100158137 408
190 3300035398 Ga0316574_0047149 Ga0316574_0047149_1245_2492 408
191 3300036712 Ga0316584_0001229 Ga0316584_0001229_6966_8213 408
192 3300048913 Ga0496110_0254212 Ga0496110_0254212_331_1557 408
193 3300050507 nmdc:mga05p37_5027_c1 nmdc:mga05p37_5027_c1_9474_10814 408
194 3300050511 nmdc:mga08y16_126114_c1 nmdc:mga08y16_126114_c1_885_2225 408
195 3300005563 Ga0068855_100003196 Ga0068855_10000319615 409
196 3300009147 Ga0114129_10001931 Ga0114129_1000193112 409
197 3300025949 Ga0207667_10003875 Ga0207667_100038752 409
198 3300047444 Ga0495675_0103782 Ga0495675_0103782_30_1346 409
199 3300005983 Ga0081540_1016528 Ga0081540_10165285 410
200 3300006051 Ga0075364_10042605 Ga0075364_100426052 410
201 3300035120 Ga0373957_0000738 Ga0373957_0000738_6462_7850 410
202 3300005577 Ga0068857_100078875 Ga0068857_1000788752 411
203 3300005937 Ga0081455_10020473 Ga0081455_100204735 411
204 3300005985 Ga0081539_10002008 Ga0081539_1000200829 411
205 3300026116 Ga0207674_10004074 Ga0207674_100040746 411
206 iso_pu_bacteria 2929212328 2929214245 411
207 3300005614 Ga0068856_100089196 Ga0068856_1000891962 412
208 3300006173 Ga0070716_100040485 Ga0070716_1000404853 412
209 3300006175 Ga0070712_100023717 Ga0070712_1000237172 412
210 3300026088 Ga0207641_10096044 Ga0207641_100960442 412
211 3300035083 Ga0373926_0004231 Ga0373926_0004231_1541_2854 412
212 3300035089 Ga0373944_0004380 Ga0373944_0004380_1515_2828 412
213 3300035113 Ga0373936_0000347 Ga0373936_0000347_3449_4762 412
214 3300035170 Ga0373943_0000269 Ga0373943_0000269_19710_21023 412
215 3300035171 Ga0373946_0002656 Ga0373946_0002656_503_1816 412
216 3300035692 Ga0373935_0006429 Ga0373935_0006429_555_1868 412
217 3300035695 Ga0373927_0003404 Ga0373927_0003404_84_1397 412
218 3300035725 Ga0373947_0005634 Ga0373947_0005634_4639_5952 412
219 3300036401 Ga0373937_0206248 Ga0373937_0206248_456_1799 412
220 3300037068 Ga0373925_0001710 Ga0373925_0001710_6569_7882 412
221 3300046461 Ga0495641_0011293 Ga0495641_0011293_605_1918 412
222 3300046475 Ga0495639_0026077 Ga0495639_0026077_109_1422 412
223 3300046477 Ga0495664_0000535 Ga0495664_0000535_16331_17644 412
224 3300046529 Ga0495652_0088949 Ga0495652_0088949_425_1738 412
225 3300046531 Ga0495665_0022190 Ga0495665_0022190_705_2018 412
226 3300046559 Ga0495667_0024018 Ga0495667_0024018_2687_4030 412
227 3300046642 Ga0495634_0025430 Ga0495634_0025430_2626_3939 412
228 3300046663 Ga0495635_0003979 Ga0495635_0003979_6298_7611 412
229 3300046678 Ga0495599_0016286 Ga0495599_0016286_347_1660 412
230 3300046690 Ga0495624_0020085 Ga0495624_0020085_1867_3180 412
231 3300047315 Ga0495581_0028749 Ga0495581_0028749_654_1967 412
232 3300047319 Ga0495674_0000921 Ga0495674_0000921_5081_6394 412
233 3300047321 Ga0495676_0013276 Ga0495676_0013276_1606_2919 412
234 3300047322 Ga0495680_0059386 Ga0495680_0059386_1143_2456 412
235 3300047471 Ga0495684_0009060 Ga0495684_0009060_4575_5888 412
236 3300006048 Ga0075363_100000630 Ga0075363_10000063011 413
237 3300006048 Ga0075363_100067962 Ga0075363_1000679621 413
238 3300006051 Ga0075364_10001416 Ga0075364_100014165 413
239 3300006186 Ga0075369_10003346 Ga0075369_100033466 413
240 3300035117 Ga0373953_0070663 Ga0373953_0070663_31_1362 413
241 3300035118 Ga0373954_0036834 Ga0373954_0036834_878_2209 413
242 3300035724 Ga0373933_0096785 Ga0373933_0096785_480_1811 413
243 3300037068 Ga0373925_0135597 Ga0373925_0135597_483_1814 413
244 3300037068 Ga0373925_0184714 Ga0373925_0184714_321_1637 413
245 3300041413 Ga0439465_0001921 Ga0439465_0001921_4310_5608 413
246 3300046529 Ga0495652_0090494 Ga0495652_0090494_1137_2468 413
247 3300046663 Ga0495635_0006344 Ga0495635_0006344_286_1617 413
248 3300046675 Ga0495657_0113653 Ga0495657_0113653_12_1343 413
249 3300046809 Ga0495600_0068109 Ga0495600_0068109_51_1382 413
250 3300047317 Ga0495604_0133836 Ga0495604_0133836_426_1757 413
251 3300049571 Ga0501034_0226101 Ga0501034_0226101_290_1597 413
252 3300049586 Ga0501070_0001163 Ga0501070_0001163_13540_14847 413
253 3300049589 Ga0501073_0066282 Ga0501073_0066282_563_1870 413
254 3300049590 Ga0501074_0006228 Ga0501074_0006228_1949_3256 413
255 3300049741 Ga0501079_0000971 Ga0501079_0000971_933_2240 413
256 3300049742 Ga0501080_0000278 Ga0501080_0000278_24468_25775 413
257 3300050490 nmdc:mga03n38_3638_c1 nmdc:mga03n38_3638_c1_1419_2693 413
258 iso_pu_bacteria 2675903060 2676489135 413
259 3300005548 Ga0070665_100001745 Ga0070665_10000174512 414
260 3300006038 Ga0075365_10012029 Ga0075365_100120293 414
261 3300006051 Ga0075364_10036265 Ga0075364_100362652 414
262 3300006051 Ga0075364_10074153 Ga0075364_100741532 414
263 3300006178 Ga0075367_10002790 Ga0075367_100027905 414
264 3300006353 Ga0075370_10007955 Ga0075370_100079552 414
265 3300028379 Ga0268266_10011077 Ga0268266_100110775 414
266 3300031852 Ga0307410_10009623 Ga0307410_100096234 414
267 3300031903 Ga0307407_10003878 Ga0307407_100038787 414
268 3300031995 Ga0307409_100000649 Ga0307409_10000064914 414
269 3300032002 Ga0307416_100045327 Ga0307416_1000453274 414
270 3300032126 Ga0307415_100000600 Ga0307415_10000060010 414
271 3300035086 Ga0373934_0009784 Ga0373934_0009784_252_1622 414
272 3300046529 Ga0495652_0041137 Ga0495652_0041137_2452_3822 414
273 3300046543 Ga0495645_0040139 Ga0495645_0040139_799_2166 414
274 3300046559 Ga0495667_0005676 Ga0495667_0005676_1539_2909 414
275 3300046679 Ga0495623_0063717 Ga0495623_0063717_181_1551 414
276 3300046680 Ga0495646_0045947 Ga0495646_0045947_1280_2650 414
277 3300047322 Ga0495680_0017113 Ga0495680_0017113_1387_2757 414
278 3300048088 Ga0495602_0088621 Ga0495602_0088621_35_1405 414
279 3300049586 Ga0501070_0089525 Ga0501070_0089525_101_1438 414
280 3300050492 nmdc:mga0yw44_85097_c1 nmdc:mga0yw44_85097_c1_56_1333 414
281 3300050494 nmdc:mga06z11_28987_c1 nmdc:mga06z11_28987_c1_856_2133 414
282 iso_pu_bacteria 2506783011 2506865514 414
283 iso_pu_bacteria 2643221615 2644090707 414
284 iso_pu_bacteria 2643221657 2644320511 414
285 iso_pu_bacteria 2884693830 2884702782 414
286 iso_pu_bacteria 2895442618 2895449097 414
287 3300005445 Ga0070708_100047121 Ga0070708_1000471214 415
288 3300005468 Ga0070707_100025784 Ga0070707_1000257845 415
289 3300005471 Ga0070698_100072330 Ga0070698_1000723303 415
290 iso_pu_bacteria 2984592036 2984595322 415
291 3300009177 Ga0105248_10003471 Ga0105248_100034716 416
292 3300009553 Ga0105249_10325182 Ga0105249_103251822 416
293 3300025941 Ga0207711_10002035 Ga0207711_100020355 416
294 iso_pu_bacteria 2773857758 2774378551 416
295 iso_pu_bacteria 2908678064 2908678737 416
296 iso_pu_bacteria 2919069694 2919071088 416
297 iso_pu_bacteria 2974294766 2974298050 416
298 iso_pu_bacteria 2974324384 2974325712 416
299 iso_pu_bacteria 2977264416 2977265900 416
300 3300005467 Ga0070706_100206311 Ga0070706_1002063111 417
301 3300005564 Ga0070664_100105099 Ga0070664_1001050992 417
302 3300005577 Ga0068857_100004898 Ga0068857_1000048983 417
303 3300005618 Ga0068864_100014834 Ga0068864_1000148343 417
304 3300005843 Ga0068860_100118980 Ga0068860_1001189802 417
305 3300006038 Ga0075365_10000189 Ga0075365_1000018914 417
306 3300006881 Ga0068865_100024740 Ga0068865_1000247403 417
307 3300025918 Ga0207662_10031620 Ga0207662_100316203 417
308 3300025919 Ga0207657_10084327 Ga0207657_100843272 417
309 3300025927 Ga0207687_10012627 Ga0207687_100126272 417
310 3300025932 Ga0207690_10033498 Ga0207690_100334982 417
311 3300025942 Ga0207689_10043314 Ga0207689_100433143 417
312 3300025945 Ga0207679_10097452 Ga0207679_100974522 417
313 3300026023 Ga0207677_10236145 Ga0207677_102361451 417
314 3300026116 Ga0207674_10002647 Ga0207674_1000264714 417
315 3300028381 Ga0268264_10040270 Ga0268264_100402703 417
316 3300035724 Ga0373933_0044033 Ga0373933_0044033_375_1724 417
317 3300036401 Ga0373937_0083590 Ga0373937_0083590_1062_2411 417
318 3300046454 Ga0495592_0101656 Ga0495592_0101656_174_1523 417
319 3300046529 Ga0495652_0140879 Ga0495652_0140879_37_1386 417
320 3300046536 Ga0495587_0018672 Ga0495587_0018672_2785_4134 417
321 3300048910 Ga0496107_0089003 Ga0496107_0089003_831_2114 417
322 3300053084 Ga0495595_0026902 Ga0495595_0026902_927_2276 417
323 iso_pu_bacteria 8056060235 8056063349 417
324 3300005548 Ga0070665_100196512 Ga0070665_1001965122 418
325 3300009545 Ga0105237_10012012 Ga0105237_1001201211 418
326 3300013105 Ga0157369_10046817 Ga0157369_100468173 418
327 3300025908 Ga0207643_10034610 Ga0207643_100346102 418
328 3300025914 Ga0207671_10007956 Ga0207671_100079563 418
329 3300045049 Ga0466959_0004319 Ga0466959_0004319_737_2008 418
330 3300045836 Ga0466958_0018646 Ga0466958_0018646_229_1500 418
331 3300045976 Ga0466967_0224724 Ga0466967_0224724_154_1434 418
332 3300049570 Ga0501033_0005697 Ga0501033_0005697_5920_7191 418
333 3300049579 Ga0501043_0163726 Ga0501043_0163726_40_1311 418
334 3300005467 Ga0070706_100015699 Ga0070706_1000156992 419
335 3300005468 Ga0070707_100001180 Ga0070707_10000118011 419
336 3300025922 Ga0207646_10003773 Ga0207646_1000377311 419
337 3300046511 Ga0495608_0032142 Ga0495608_0032142_492_1835 419
338 3300049583 Ga0501067_0000186 Ga0501067_0000186_23777_25069 419
339 3300049585 Ga0501069_0014860 Ga0501069_0014860_923_2227 419
340 3300049741 Ga0501079_0018741 Ga0501079_0018741_3444_4736 419
341 3300049744 Ga0501083_0052819 Ga0501083_0052819_791_2083 419
342 iso_pu_bacteria 2643221697 2644538097 419
343 3300005843 Ga0068860_100200421 Ga0068860_1002004211 420
344 3300021388 Ga0213875_10030333 Ga0213875_100303332 420
345 3300025922 Ga0207646_10157834 Ga0207646_101578342 420
346 3300037853 Ga0436364_0106856 Ga0436364_0106856_269_1642 420
347 3300037853 Ga0436364_0209569 Ga0436364_0209569_98_1411 420
348 3300037853 Ga0436364_0986170 Ga0436364_0986170_735_2072 420
349 3300039437 Ga0436365_1691907 Ga0436365_1691907_96_1418 420
350 3300046559 Ga0495667_0047416 Ga0495667_0047416_85_1416 420
351 3300047319 Ga0495674_0056564 Ga0495674_0056564_1093_2424 420
352 3300048908 Ga0496105_0140857 Ga0496105_0140857_424_1689 420
353 3300048917 Ga0496114_0113226 Ga0496114_0113226_86_1351 420
354 iso_pu_bacteria 2773857933 2774901159 420
355 3300005434 Ga0070709_10011177 Ga0070709_100111773 421
356 3300005435 Ga0070714_100000526 Ga0070714_1000005269 421
357 3300005435 Ga0070714_100029576 Ga0070714_1000295761 421
358 3300005435 Ga0070714_100038110 Ga0070714_1000381103 421
359 3300005436 Ga0070713_100003751 Ga0070713_1000037512 421
360 3300005436 Ga0070713_100036583 Ga0070713_1000365834 421
361 3300005437 Ga0070710_10002321 Ga0070710_1000232111 421
362 3300005439 Ga0070711_100008206 Ga0070711_1000082064 421
363 3300005467 Ga0070706_100005959 Ga0070706_1000059598 421
364 3300005467 Ga0070706_100013802 Ga0070706_1000138027 421
365 3300005468 Ga0070707_100000127 Ga0070707_10000012764 421
366 3300005471 Ga0070698_100002810 Ga0070698_1000028104 421
367 3300006173 Ga0070716_100001777 Ga0070716_1000017773 421
368 3300006175 Ga0070712_100049787 Ga0070712_1000497873 421
369 3300006852 Ga0075433_10028383 Ga0075433_100283833 421
370 3300006871 Ga0075434_100028737 Ga0075434_1000287373 421
371 3300006914 Ga0075436_100008756 Ga0075436_1000087563 421
372 3300025898 Ga0207692_10009411 Ga0207692_100094113 421
373 3300025906 Ga0207699_10003044 Ga0207699_100030443 421
374 3300025910 Ga0207684_10011796 Ga0207684_100117962 421
375 3300025915 Ga0207693_10036188 Ga0207693_100361882 421
376 3300025916 Ga0207663_10011430 Ga0207663_100114302 421
377 3300025922 Ga0207646_10000264 Ga0207646_100002642 421
378 3300025928 Ga0207700_10003000 Ga0207700_100030003 421
379 3300025928 Ga0207700_10031952 Ga0207700_100319524 421
380 3300025928 Ga0207700_10080405 Ga0207700_100804052 421
381 3300025929 Ga0207664_10002040 Ga0207664_1000204012 421
382 3300025929 Ga0207664_10007914 Ga0207664_100079143 421
383 3300025929 Ga0207664_10019554 Ga0207664_100195543 421
384 3300025939 Ga0207665_10004765 Ga0207665_100047654 421
385 3300028556 Ga0265337_1000047 Ga0265337_100004731 421
386 3300028558 Ga0265326_10004458 Ga0265326_100044583 421
387 3300028563 Ga0265319_1010152 Ga0265319_10101522 421
388 3300028573 Ga0265334_10000196 Ga0265334_100001963 421
389 3300028800 Ga0265338_10000315 Ga0265338_1000031538 421
390 3300028800 Ga0265338_10004007 Ga0265338_1000400719 421
391 3300028800 Ga0265338_10013005 Ga0265338_100130058 421
392 3300029957 Ga0265324_10003734 Ga0265324_100037345 421
393 3300031238 Ga0265332_10000555 Ga0265332_1000055522 421
394 3300031240 Ga0265320_10001951 Ga0265320_100019518 421
395 3300031241 Ga0265325_10012168 Ga0265325_100121683 421
396 3300031247 Ga0265340_10005298 Ga0265340_100052987 421
397 3300031249 Ga0265339_10033366 Ga0265339_100333662 421
398 3300031711 Ga0265314_10007466 Ga0265314_100074669 421
399 3300031712 Ga0265342_10011381 Ga0265342_100113814 421
400 3300035111 Ga0373923_0002025 Ga0373923_0002025_3963_5369 421
401 3300035118 Ga0373954_0028913 Ga0373954_0028913_382_1788 421
402 3300035119 Ga0373956_0023416 Ga0373956_0023416_763_2169 421
403 3300035172 Ga0373955_0005070 Ga0373955_0005070_3215_4621 421
404 3300035410 Ga0373924_0004987 Ga0373924_0004987_2142_3548 421
405 3300037068 Ga0373925_0049696 Ga0373925_0049696_423_1829 421
406 3300037068 Ga0373925_0081340 Ga0373925_0081340_1009_2418 421
407 3300046459 Ga0495629_0003669 Ga0495629_0003669_6481_7887 421
408 3300046461 Ga0495641_0003291 Ga0495641_0003291_10045_11451 421
409 3300046462 Ga0495651_0095120 Ga0495651_0095120_623_2029 421
410 3300046463 Ga0495653_0117350 Ga0495653_0117350_296_1702 421
411 3300046473 Ga0495582_0006221 Ga0495582_0006221_3612_5018 421
412 3300046476 Ga0495662_0010098 Ga0495662_0010098_2478_3884 421
413 3300046477 Ga0495664_0007516 Ga0495664_0007516_3576_4943 421
414 3300046477 Ga0495664_0017428 Ga0495664_0017428_1794_3200 421
415 3300046511 Ga0495608_0061103 Ga0495608_0061103_348_1754 421
416 3300046514 Ga0495618_0013261 Ga0495618_0013261_2659_4065 421
417 3300046514 Ga0495618_0016971 Ga0495618_0016971_2298_3665 421
418 3300046516 Ga0495628_0082037 Ga0495628_0082037_476_1882 421
419 3300046517 Ga0495630_0011233 Ga0495630_0011233_1123_2529 421
420 3300046531 Ga0495665_0002309 Ga0495665_0002309_2216_3622 421
421 3300046533 Ga0495640_0009144 Ga0495640_0009144_2661_4067 421
422 3300046536 Ga0495587_0034811 Ga0495587_0034811_778_2184 421
423 3300046543 Ga0495645_0049044 Ga0495645_0049044_907_2313 421
424 3300046559 Ga0495667_0096151 Ga0495667_0096151_440_1846 421
425 3300046642 Ga0495634_0013575 Ga0495634_0013575_3587_4993 421
426 3300046663 Ga0495635_0074739 Ga0495635_0074739_440_1846 421
427 3300046675 Ga0495657_0095350 Ga0495657_0095350_200_1606 421
428 3300046680 Ga0495646_0027232 Ga0495646_0027232_1794_3200 421
429 3300046681 Ga0495647_0051760 Ga0495647_0051760_138_1544 421
430 3300046809 Ga0495600_0003363 Ga0495600_0003363_5375_6781 421
431 3300047315 Ga0495581_0019829 Ga0495581_0019829_2203_3609 421
432 3300047317 Ga0495604_0033529 Ga0495604_0033529_2363_3769 421
433 3300047319 Ga0495674_0063732 Ga0495674_0063732_296_1702 421
434 3300047444 Ga0495675_0016882 Ga0495675_0016882_2476_3882 421
435 3300047471 Ga0495684_0086460 Ga0495684_0086460_348_1754 421
436 3300048088 Ga0495602_0078347 Ga0495602_0078347_448_1854 421
437 3300049576 Ga0501040_0195599 Ga0501040_0195599_10_1287 421
438 3300050513 nmdc:mga0rr50_22725_c1 nmdc:mga0rr50_22725_c1_2430_3836 421
439 3300050514 nmdc:mga08x19_12800_c1 nmdc:mga08x19_12800_c1_629_2035 421
440 3300050515 nmdc:mga0a205_93339_c1 nmdc:mga0a205_93339_c1_94_1500 421
441 3300053077 Ga0495601_0017946 Ga0495601_0017946_2531_3937 421
442 3300053078 Ga0495612_0006530 Ga0495612_0006530_1793_3199 421
443 3300053084 Ga0495595_0004215 Ga0495595_0004215_1532_2938 421
444 3300053085 Ga0495619_0016278 Ga0495619_0016278_826_2232 421
445 iso_pu_bacteria 2811994872 2812322446 421
446 iso_pu_bacteria 2906799679 2906800826 421
447 iso_pu_bacteria 2984576629 2984576899 421
448 iso_pu_bacteria 2990256926 2990258647 421
449 3300005434 Ga0070709_10014866 Ga0070709_100148662 422
450 3300005437 Ga0070710_10051417 Ga0070710_100514171 422
451 3300005614 Ga0068856_100008876 Ga0068856_1000088764 422
452 3300006163 Ga0070715_10002562 Ga0070715_100025622 422
453 3300006173 Ga0070716_100011764 Ga0070716_1000117642 422
454 3300025906 Ga0207699_10000723 Ga0207699_1000072315 422
455 3300025915 Ga0207693_10111753 Ga0207693_101117532 422
456 3300025928 Ga0207700_10005604 Ga0207700_100056049 422
457 3300025929 Ga0207664_10035807 Ga0207664_100358072 422
458 3300025939 Ga0207665_10014219 Ga0207665_100142193 422
459 3300048904 Ga0496101_0066767 Ga0496101_0066767_229_1584 422
460 3300048905 Ga0496102_0103674 Ga0496102_0103674_188_1468 422
461 3300048907 Ga0496104_0001843 Ga0496104_0001843_5470_6825 422
462 3300048909 Ga0496106_0116961 Ga0496106_0116961_213_1493 422
463 3300048910 Ga0496107_0091765 Ga0496107_0091765_633_1913 422
464 3300048911 Ga0496108_0215702 Ga0496108_0215702_79_1359 422
465 3300048912 Ga0496109_0031639 Ga0496109_0031639_531_1886 422
466 3300048913 Ga0496110_0021583 Ga0496110_0021583_3590_4945 422
467 3300048913 Ga0496110_0262219 Ga0496110_0262219_167_1471 422
468 3300048915 Ga0496112_0002530 Ga0496112_0002530_12173_13528 422
469 3300048918 Ga0496115_0032672 Ga0496115_0032672_127_1482 422
470 3300048918 Ga0496115_0081306 Ga0496115_0081306_1250_2575 422
471 3300049583 Ga0501067_0007567 Ga0501067_0007567_1602_2882 422
472 3300061734 Ga0530510_0047460 Ga0530510_0047460_1807_3087 422
473 3300035083 Ga0373926_0005034 Ga0373926_0005034_715_2259 423
474 3300035692 Ga0373935_0000373 Ga0373935_0000373_8159_9703 423
475 3300035725 Ga0373947_0000007 Ga0373947_0000007_66353_67897 423
476 3300053080 Ga0500635_0018017 Ga0500635_0018017_197_1606 423
477 3300005435 Ga0070714_100010642 Ga0070714_1000106422 425
478 3300005437 Ga0070710_10006274 Ga0070710_100062742 425
479 3300005439 Ga0070711_100091400 Ga0070711_1000914002 425
480 3300005445 Ga0070708_100063495 Ga0070708_1000634952 425
481 3300025898 Ga0207692_10007834 Ga0207692_100078344 425
482 3300025922 Ga0207646_10026051 Ga0207646_100260514 425
483 3300001990 JGI24737J22298_10005641 JGI24737J22298_100056412 428
484 3300026116 Ga0207674_10042289 Ga0207674_100422893 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

293

506

0.93

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

31

94

0.93

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

120

299

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o15-assembly1.cif.gz_A mycobacterium tuberculosis epsp synthase after partial products withdrawal 0.9227 4 428
2o15-assembly1.cif.gz_A mycobacterium tuberculosis epsp synthase after partial products withdrawal 0.9206 4 428
7tm4-assembly1.cif.gz_A crystal structure of apo 3-phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae 0.9136 5 428
7tm4-assembly1.cif.gz_A crystal structure of apo 3-phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae 0.9074 5 428
7tbu-assembly2.cif.gz_B crystal structure of the 5-enolpyruvate-shikimate-3-phosphate synthase (epsps) domain of aro1 from candida albicans in complex with shikimate-3-phosphate 0.9073 14 410
ID Description Score Start End Superfamily
af_P9WPY5_236_421_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9756 242 424 1.20.200.10
2o0eA01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9717 245 428 3.65.10.10
af_P9WPY5_236_421_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.955 242 424 1.20.200.10
af_Q57925_221_429_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9453 233 428 3.65.10.10
1g6sA01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9325 245 428 3.65.10.10
ID Description Score Start End GO Terms
AF-A0A0F7FX65-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9906 264 423 GO:0003866
GO:0009423
AF-A0A6B3H562-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9906 98 209 GO:0003866
GO:0009423
AF-A0A7J0CZ36-F1-model_v4 Enolpyruvate transferase domain-containing protein 0.9876 259 426 GO:0003866
GO:0009423
AF-A0A2G4G6L7-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9856 305 428 GO:0003866
GO:0009423
AF-W0Z9A9-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) 0.9833 302 426 GO:0003866
GO:0009423

Feature Viewer

pLDDT pTM Quality
94.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map