F452908

General Info

Members Datasets Scaffolds Average Seq Length
484 225 484 244

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100012887|Ga0075428_1000128877
Length 273
Sequence VVRSSSTDIPNRSDNARLTEDRSLPIIVFTDGAAKGNPGPGGWGAIVVSPDQHVVELGGGSPHTTNNRMELSGAIAALQHVVNRPGPVAIYMDSTYVIQGITQWVWGWRKRGWRTAQGGDVLNRDLWEQLTSLVGARARGDVDWHWVRGHVGTPGNERADQISVAFALQQSADLYDGPFDGYPRPILQLPDDTALPKRTGSVSGAKTKAAAYSYLSVVDGVPMRHTTWAECEGRVKGQSGARFKKATSAADEAAILRSWGIESSRIQPHPVPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 0
Rhizoplane 2.48
Rhizosphere 91.32
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759361 2162886007 Bacteria 232727
2 JGI24751J29686_10003264 3300002459 Bacteria 3265
3 Ga0065704_10070132 3300005289 Bacteria 1955461
4 Ga0065712_10002563 3300005290 Bacteria 5247
5 Ga0065712_10109964 3300005290 Unclassified 1845
6 Ga0065712_10180367 3300005290 Bacteria 1195
7 Ga0065715_10127979 3300005293 Bacteria 2075
8 Ga0065715_10137030 3300005293 Unclassified 1913
9 Ga0065715_10152854 3300005293 Bacteria 1709
10 Ga0065707_10001855 3300005295 Bacteria 6835
11 Ga0065707_10315487 3300005295 Unclassified 976
12 Ga0070658_10360426 3300005327 Bacteria 1245
13 Ga0070676_10062250 3300005328 Bacteria 2220
14 Ga0070683_100046357 3300005329 Bacteria 4015
15 Ga0070690_100005245 3300005330 Bacteria 7261
16 Ga0070670_100000207 3300005331 Bacteria 54657
17 Ga0070670_100040123 3300005331 Bacteria 4026
18 Ga0070670_100066700 3300005331 Bacteria 3088
19 Ga0070670_100142774 3300005331 Bacteria 2071
20 Ga0070670_100147277 3300005331 Bacteria 2037
21 Ga0070670_100471731 3300005331 Unclassified 1114
22 Ga0070677_10174774 3300005333 Bacteria 1018
23 Ga0068869_100001813 3300005334 Bacteria 12828
24 Ga0068869_100073865 3300005334 Bacteria 2530
25 Ga0068869_100309937 3300005334 Bacteria 1277
26 Ga0068869_100356790 3300005334 Bacteria 1193
27 Ga0068869_100370306 3300005334 Bacteria 1172
28 Ga0070666_10008275 3300005335 Bacteria 6450
29 Ga0070666_10216613 3300005335 Bacteria 1350
30 Ga0068868_100000724 3300005338 Bacteria 22276
31 Ga0068868_100261093 3300005338 Bacteria 1461
32 Ga0070689_100396442 3300005340 Bacteria 1166
33 Ga0070689_100600335 3300005340 Bacteria 953
34 Ga0070687_100036490 3300005343 Unclassified 2450
35 Ga0070661_100005546 3300005344 Bacteria 8701
36 Ga0070661_100102461 3300005344 Bacteria 2131
37 Ga0070668_100133777 3300005347 Bacteria 1992
38 Ga0070669_100004878 3300005353 Bacteria 9680
39 Ga0070669_100022830 3300005353 Bacteria 4475
40 Ga0070669_100274860 3300005353 Bacteria 1348
41 Ga0070675_100006639 3300005354 Bacteria 8894
42 Ga0070675_100006764 3300005354 Bacteria 8811
43 Ga0070675_100074474 3300005354 Bacteria 2820
44 Ga0070675_100098680 3300005354 Bacteria 2457
45 Ga0070675_100255124 3300005354 Bacteria 1536
46 Ga0070671_100015724 3300005355 Bacteria 6114
47 Ga0070671_100020344 3300005355 Bacteria 5411
48 Ga0070671_100028507 3300005355 Bacteria 4597
49 Ga0070674_100131465 3300005356 Bacteria 1866
50 Ga0070674_100300634 3300005356 Bacteria 1279
51 Ga0070674_100534295 3300005356 Bacteria 981
52 Ga0070673_100004578 3300005364 Bacteria 8765
53 Ga0070673_100009471 3300005364 Bacteria 6538
54 Ga0070673_100175126 3300005364 Bacteria 1833
55 Ga0070688_100004722 3300005365 Bacteria 7119
56 Ga0070688_100120078 3300005365 Bacteria 1759
57 Ga0070688_100192470 3300005365 Bacteria 1422
58 Ga0070688_100258216 3300005365 Unclassified 1243
59 Ga0070688_100332158 3300005365 Bacteria 1108
60 Ga0070688_100354483 3300005365 Unclassified 1075
61 Ga0070688_100515234 3300005365 Bacteria 904
62 Ga0070659_100324443 3300005366 Unclassified 1288
63 Ga0070667_100008716 3300005367 Bacteria 8410
64 Ga0070667_100168191 3300005367 Unclassified 1934
65 Ga0070667_100437552 3300005367 Bacteria 1194
66 Ga0070701_10004006 3300005438 Bacteria 5900
67 Ga0070711_100000355 3300005439 Bacteria 23715
68 Ga0070700_100001339 3300005441 Bacteria 12246
69 Ga0070700_100119250 3300005441 Bacteria 1765
70 Ga0070700_100229381 3300005441 Bacteria 1321
71 Ga0070700_100390052 3300005441 Bacteria 1044
72 Ga0070694_100244171 3300005444 Unclassified 1356
73 Ga0070663_100181665 3300005455 Unclassified 1632
74 Ga0070678_100232519 3300005456 Bacteria 1538
75 Ga0068867_100000241 3300005459 Bacteria 36023
76 Ga0068867_100229572 3300005459 Bacteria 1500
77 Ga0068867_100244298 3300005459 Bacteria 1457
78 Ga0070685_10158606 3300005466 Unclassified 1440
79 Ga0070698_100397035 3300005471 Bacteria 1312
80 Ga0070699_100007806 3300005518 Bacteria 9302
81 Ga0070699_100073174 3300005518 Bacteria 2981
82 Ga0070684_100036749 3300005535 Bacteria 4197
83 Ga0070684_100062058 3300005535 Bacteria 3273
84 Ga0068853_100157775 3300005539 Unclassified 2045
85 Ga0070672_100002505 3300005543 Bacteria 11688
86 Ga0070672_100054123 3300005543 Bacteria 3140
87 Ga0070672_100064185 3300005543 Bacteria 2901
88 Ga0070672_100242272 3300005543 Unclassified 1517
89 Ga0070686_100019905 3300005544 Bacteria 3966
90 Ga0070686_100021930 3300005544 Bacteria 3801
91 Ga0070686_100411375 3300005544 Bacteria 1031
92 Ga0070696_100339090 3300005546 Bacteria 1161
93 Ga0070665_100049526 3300005548 Bacteria 4215
94 Ga0070704_100108374 3300005549 Bacteria 2109
95 Ga0068855_100018735 3300005563 Bacteria 8323
96 Ga0070664_100001854 3300005564 Bacteria 16923
97 Ga0070664_100005981 3300005564 Bacteria 9835
98 Ga0068854_100410155 3300005578 Unclassified 1123
99 Ga0070702_100031860 3300005615 Bacteria 2888
100 Ga0068859_100076740 3300005617 Bacteria 3382
101 Ga0068859_100151941 3300005617 Bacteria 2391
102 Ga0068859_100174230 3300005617 Bacteria 2233
103 Ga0068859_100355806 3300005617 Bacteria 1559
104 Ga0068859_100477659 3300005617 Unclassified 1342
105 Ga0068864_100001821 3300005618 Bacteria 17498
106 Ga0068864_100011330 3300005618 Bacteria 7368
107 Ga0068864_100049383 3300005618 Unclassified 3620
108 Ga0068864_100074257 3300005618 Bacteria 2967
109 Ga0068864_100356289 3300005618 Bacteria 1382
110 Ga0068866_10010482 3300005718 Bacteria 3976
111 Ga0068861_100226635 3300005719 Bacteria 1583
112 Ga0068851_10020004 3300005834 Bacteria 3238
113 Ga0068870_10007640 3300005840 Bacteria 4834
114 Ga0068870_10240846 3300005840 Bacteria 1117
115 Ga0068870_10258958 3300005840 Bacteria 1082
116 Ga0068863_100017575 3300005841 Bacteria 6852
117 Ga0068863_100043928 3300005841 Bacteria 4242
118 Ga0068863_100148362 3300005841 Bacteria 2244
119 Ga0068863_100232372 3300005841 Bacteria 1779
120 Ga0068863_100337925 3300005841 Bacteria 1465
121 Ga0068858_100010410 3300005842 Bacteria 8811
122 Ga0068858_100253837 3300005842 Unclassified 1671
123 Ga0068858_100513849 3300005842 Bacteria 1158
124 Ga0068860_100051034 3300005843 Bacteria 3937
125 Ga0068862_100411550 3300005844 Bacteria 1267
126 Ga0075368_10077886 3300006042 Bacteria 1346
127 Ga0075363_100080062 3300006048 Bacteria 1786
128 Ga0075364_10010452 3300006051 Bacteria 5607
129 Ga0075364_10268347 3300006051 Bacteria 1160
130 Ga0075367_10012156 3300006178 Bacteria 4579
131 Ga0075367_10050766 3300006178 Bacteria 2450
132 Ga0075367_10136565 3300006178 Bacteria 1517
133 Ga0075367_10393134 3300006178 Bacteria 877
134 Ga0075366_10020009 3300006195 Bacteria 3880
135 Ga0075366_10047310 3300006195 Bacteria 2550
136 Ga0075366_10055824 3300006195 Bacteria 2346
137 Ga0075366_10086780 3300006195 Bacteria 1872
138 Ga0097621_100006038 3300006237 Bacteria 8561
139 Ga0097621_100480682 3300006237 Bacteria 1123
140 Ga0075370_10063419 3300006353 Bacteria 2107
141 Ga0068871_100030366 3300006358 Bacteria 4255
142 Ga0068871_100066161 3300006358 Bacteria 2962
143 Ga0075428_100012887 3300006844 Bacteria 9302
144 Ga0075428_100023405 3300006844 Bacteria 6836
145 Ga0075428_100032736 3300006844 Bacteria 5742
146 Ga0075428_100049483 3300006844 Bacteria 4611
147 Ga0075428_100563335 3300006844 Bacteria 1218
148 Ga0075430_100089459 3300006846 Bacteria 2576
149 Ga0075431_100008709 3300006847 Bacteria 10166
150 Ga0075431_100174073 3300006847 Bacteria 2211
151 Ga0075433_10000616 3300006852 Bacteria 23761
152 Ga0075433_10002832 3300006852 Bacteria 13274
153 Ga0075433_10023143 3300006852 Bacteria 5226
154 Ga0075433_10053391 3300006852 Bacteria 3523
155 Ga0075433_10160483 3300006852 Bacteria 2001
156 Ga0075433_10227225 3300006852 Bacteria 1658
157 Ga0075433_10412649 3300006852 Bacteria 1191
158 Ga0075434_100000950 3300006871 Bacteria 23336
159 Ga0075434_100011925 3300006871 Bacteria 8221
160 Ga0075429_100077033 3300006880 Bacteria 2905
161 Ga0075429_100220407 3300006880 Unclassified 1662
162 Ga0068865_100004420 3300006881 Bacteria 8478
163 Ga0097620_100076741 3300006931 Bacteria 3382
164 Ga0097620_100151942 3300006931 Bacteria 2391
165 Ga0097620_100174223 3300006931 Bacteria 2233
166 Ga0097620_100355788 3300006931 Bacteria 1559
167 Ga0097620_100477710 3300006931 Unclassified 1342
168 Ga0111539_10000956 3300009094 Bacteria 37902
169 Ga0111539_10015035 3300009094 Bacteria 9646
170 Ga0111539_10040969 3300009094 Bacteria 5571
171 Ga0111539_10054729 3300009094 Bacteria 4746
172 Ga0111539_10072499 3300009094 Bacteria 4061
173 Ga0111539_10121450 3300009094 Bacteria 3061
174 Ga0111539_10441637 3300009094 Bacteria 1515
175 Ga0111539_10531274 3300009094 Bacteria 1370
176 Ga0105245_10840267 3300009098 Bacteria 958
177 Ga0105247_10015861 3300009101 Bacteria 4511
178 Ga0114129_10024087 3300009147 Bacteria 8625
179 Ga0114129_10123446 3300009147 Bacteria 3562
180 Ga0114129_10158300 3300009147 Bacteria 3096
181 Ga0114129_10346089 3300009147 Bacteria 1970
182 Ga0114129_10568355 3300009147 Bacteria 1473
183 Ga0105243_10010632 3300009148 Bacteria 6982
184 Ga0105243_10390594 3300009148 Bacteria 1290
185 Ga0105243_10547824 3300009148 Bacteria 1105
186 Ga0105242_10022081 3300009176 Bacteria 5001
187 Ga0105248_10004704 3300009177 Bacteria 15098
188 Ga0105248_10047080 3300009177 Bacteria 4835
189 Ga0105248_10170667 3300009177 Bacteria 2451
190 Ga0105248_10185305 3300009177 Bacteria 2346
191 Ga0105248_10313065 3300009177 Bacteria 1768
192 Ga0105248_10437129 3300009177 Bacteria 1474
193 Ga0105248_10705365 3300009177 Bacteria 1138
194 Ga0105238_10055307 3300009551 Bacteria 3984
195 Ga0105238_10749634 3300009551 Bacteria 990
196 Ga0105249_10020467 3300009553 Bacteria 5915
197 Ga0105249_10193009 3300009553 Bacteria 1989
198 Ga0105249_10283028 3300009553 Unclassified 1657
199 Ga0105249_10432073 3300009553 Bacteria 1353
200 Ga0163162_10002123 3300013306 Bacteria 18627
201 Ga0157375_10054175 3300013308 Bacteria 3950
202 Ga0157375_10463845 3300013308 Bacteria 1432
203 Ga0163163_10003461 3300014325 Bacteria 13417
204 Ga0163163_10008634 3300014325 Bacteria 9061
205 Ga0163163_10034264 3300014325 Unclassified 4916
206 Ga0163163_10053071 3300014325 Bacteria 4001
207 Ga0163163_10066888 3300014325 Bacteria 3571
208 Ga0163163_10070834 3300014325 Bacteria 3473
209 Ga0163163_10110392 3300014325 Bacteria 2778
210 Ga0163163_10785944 3300014325 Bacteria 1015
211 Ga0157380_10003839 3300014326 Bacteria 10350
212 Ga0157380_10004786 3300014326 Bacteria 9432
213 Ga0157380_10031703 3300014326 Bacteria 4059
214 Ga0157380_10048203 3300014326 Bacteria 3354
215 Ga0157380_10096227 3300014326 Bacteria 2454
216 Ga0157380_10156379 3300014326 Bacteria 1976
217 Ga0157380_10177956 3300014326 Bacteria 1866
218 Ga0157380_10980440 3300014326 Bacteria 877
219 Ga0157377_10006714 3300014745 Bacteria 5509
220 Ga0157377_10059622 3300014745 Bacteria 2176
221 Ga0157379_10016021 3300014968 Bacteria 6589
222 Ga0157376_10089604 3300014969 Bacteria 2660
223 Ga0157376_10771713 3300014969 Bacteria 972
224 Ga0163161_10344680 3300017792 Bacteria 1183
225 Ga0207656_10029559 3300025321 Bacteria 2258
226 Ga0207682_10012564 3300025893 Bacteria 3305
227 Ga0207682_10038361 3300025893 Bacteria 1943
228 Ga0207682_10048811 3300025893 Bacteria 1746
229 Ga0207642_10130147 3300025899 Bacteria 1312
230 Ga0207710_10009266 3300025900 Bacteria 4140
231 Ga0207688_10046157 3300025901 Unclassified 2432
232 Ga0207680_10046279 3300025903 Bacteria 2571
233 Ga0207645_10007138 3300025907 Bacteria 7932
234 Ga0207643_10025085 3300025908 Bacteria 3294
235 Ga0207643_10046636 3300025908 Bacteria 2450
236 Ga0207643_10072847 3300025908 Bacteria 1979
237 Ga0207684_10478778 3300025910 Bacteria 1068
238 Ga0207663_10000002 3300025916 Bacteria 534155
239 Ga0207663_10311055 3300025916 Bacteria 1181
240 Ga0207662_10122526 3300025918 Unclassified 1632
241 Ga0207662_10237352 3300025918 Unclassified 1192
242 Ga0207649_10043593 3300025920 Bacteria 2744
243 Ga0207681_10004262 3300025923 Bacteria 8827
244 Ga0207681_10028915 3300025923 Bacteria 3594
245 Ga0207681_10138386 3300025923 Bacteria 1810
246 Ga0207694_10006465 3300025924 Bacteria 8929
247 Ga0207650_10094401 3300025925 Bacteria 2291
248 Ga0207650_10163312 3300025925 Bacteria 1766
249 Ga0207650_10293789 3300025925 Bacteria 1325
250 Ga0207659_10010910 3300025926 Bacteria 5722
251 Ga0207659_10032849 3300025926 Bacteria 3565
252 Ga0207659_10260030 3300025926 Unclassified 1412
253 Ga0207659_10268490 3300025926 Bacteria 1391
254 Ga0207659_10322682 3300025926 Bacteria 1274
255 Ga0207644_10036461 3300025931 Bacteria 3453
256 Ga0207644_10157755 3300025931 Bacteria 1761
257 Ga0207686_10025844 3300025934 Bacteria 3421
258 Ga0207709_10130926 3300025935 Bacteria 1710
259 Ga0207670_10489726 3300025936 Bacteria 997
260 Ga0207669_10039206 3300025937 Bacteria 2735
261 Ga0207704_10105469 3300025938 Bacteria 1890
262 Ga0207691_10070024 3300025940 Bacteria 3168
263 Ga0207691_10082017 3300025940 Bacteria 2898
264 Ga0207691_10158598 3300025940 Bacteria 1986
265 Ga0207691_10283027 3300025940 Bacteria 1427
266 Ga0207711_10003308 3300025941 Bacteria 14001
267 Ga0207711_10043722 3300025941 Bacteria 3823
268 Ga0207711_10142863 3300025941 Bacteria 2155
269 Ga0207711_10167713 3300025941 Bacteria 1991
270 Ga0207711_10386779 3300025941 Bacteria 1298
271 Ga0207711_10537204 3300025941 Bacteria 1090
272 Ga0207689_10004974 3300025942 Bacteria 11973
273 Ga0207689_10162999 3300025942 Bacteria 1837
274 Ga0207689_10290366 3300025942 Bacteria 1354
275 Ga0207689_10515083 3300025942 Bacteria 1003
276 Ga0207661_10235043 3300025944 Bacteria 1624
277 Ga0207679_10012999 3300025945 Bacteria 5446
278 Ga0207679_10020320 3300025945 Bacteria 4480
279 Ga0207667_10240370 3300025949 Bacteria 1853
280 Ga0207651_10002533 3300025960 Bacteria 8726
281 Ga0207651_10006040 3300025960 Bacteria 6289
282 Ga0207651_10008493 3300025960 Bacteria 5551
283 Ga0207651_10033218 3300025960 Bacteria 3325
284 Ga0207651_10074122 3300025960 Bacteria 2423
285 Ga0207651_10144644 3300025960 Bacteria 1842
286 Ga0207651_10174713 3300025960 Bacteria 1698
287 Ga0207712_10018694 3300025961 Bacteria 4516
288 Ga0207712_10159238 3300025961 Bacteria 1752
289 Ga0207668_10411918 3300025972 Bacteria 1145
290 Ga0207668_10446150 3300025972 Bacteria 1103
291 Ga0207640_10054543 3300025981 Bacteria 2614
292 Ga0207640_10497231 3300025981 Bacteria 1015
293 Ga0207658_10028631 3300025986 Bacteria 3925
294 Ga0207658_10092108 3300025986 Bacteria 2354
295 Ga0207677_10002302 3300026023 Bacteria 10038
296 Ga0207703_10011031 3300026035 Bacteria 7041
297 Ga0207639_10127815 3300026041 Unclassified 2099
298 Ga0207678_10449639 3300026067 Bacteria 1120
299 Ga0207678_10595007 3300026067 Bacteria 969
300 Ga0207708_10003942 3300026075 Bacteria 10923
301 Ga0207708_10167572 3300026075 Bacteria 1738
302 Ga0207641_10029918 3300026088 Bacteria 4506
303 Ga0207641_10064096 3300026088 Bacteria 3140
304 Ga0207641_10090217 3300026088 Bacteria 2680
305 Ga0207641_10264089 3300026088 Bacteria 1613
306 Ga0207641_10320941 3300026088 Unclassified 1469
307 Ga0207641_10653469 3300026088 Bacteria 1033
308 Ga0207648_10000274 3300026089 Bacteria 55950
309 Ga0207648_10189073 3300026089 Bacteria 1824
310 Ga0207676_10003093 3300026095 Bacteria 11869
311 Ga0207676_10063182 3300026095 Bacteria 2940
312 Ga0207676_10295888 3300026095 Bacteria 1476
313 Ga0207674_10245443 3300026116 Bacteria 1738
314 Ga0207675_100066540 3300026118 Bacteria 3369
315 Ga0207675_100406164 3300026118 Bacteria 1343
316 Ga0207675_100423166 3300026118 Bacteria 1316
317 Ga0207683_10091034 3300026121 Bacteria 2717
318 Ga0207683_10116027 3300026121 Bacteria 2400
319 Ga0207683_10173241 3300026121 Bacteria 1955
320 Ga0207683_10483281 3300026121 Unclassified 1143
321 Ga0209983_1019940 3300027665 Unclassified 1396
322 Ga0209813_10039529 3300027866 Bacteria 1430
323 Ga0207428_10015673 3300027907 Bacteria 6549
324 Ga0207428_10098935 3300027907 Unclassified 2256
325 Ga0207428_10116443 3300027907 Bacteria 2052
326 Ga0207428_10180078 3300027907 Bacteria 1597
327 Ga0268266_10093865 3300028379 Bacteria 2633
328 Ga0268265_10094562 3300028380 Bacteria 2397
329 Ga0268265_10162974 3300028380 Bacteria 1897
330 Ga0268265_10262739 3300028380 Bacteria 1536
331 Ga0268265_10371273 3300028380 Bacteria 1313
332 Ga0268264_10114205 3300028381 Bacteria 2370
333 Ga0265319_1100006 3300028563 Bacteria 911
334 Ga0265334_10031884 3300028573 Bacteria 2104
335 Ga0265338_10000899 3300028800 Bacteria 49992
336 Ga0265338_10002345 3300028800 Bacteria 28610
337 Ga0265338_10305970 3300028800 Bacteria 1154
338 Ga0265330_10020430 3300031235 Bacteria 3025
339 Ga0265330_10028907 3300031235 Bacteria 2495
340 Ga0265332_10000169 3300031238 Bacteria 53146
341 Ga0265320_10019909 3300031240 Bacteria 3653
342 Ga0265320_10130245 3300031240 Bacteria 1143
343 Ga0265320_10156279 3300031240 Bacteria 1028
344 Ga0265329_10002408 3300031242 Bacteria 8487
345 Ga0265329_10006440 3300031242 Bacteria 4657
346 Ga0265331_10000117 3300031250 Bacteria 104134
347 Ga0265331_10092562 3300031250 Bacteria 1396
348 Ga0265316_10000031 3300031344 Bacteria 161451
349 Ga0265314_10000183 3300031711 Bacteria 92559
350 Ga0265342_10000869 3300031712 Bacteria 30180
351 Ga0307413_10552074 3300031824 Bacteria 935
352 Ga0307412_10331496 3300031911 Bacteria 1215
353 Ga0307409_100266318 3300031995 Bacteria 1576
354 Ga0307409_100598168 3300031995 Bacteria 1090
355 Ga0373937_0124198 3300036401 Bacteria 2407
356 Ga0439435_0002496 3300042436 Bacteria 3668
357 Ga0451577_0890467 3300042876 Archaea 802
358 Ga0453684_0000030 3300044712 Bacteria 752725
359 Ga0453684_0117240 3300044712 Archaea 3223
360 Ga0453684_0229780 3300044712 Bacteria 2142
361 Ga0451576_0192592 3300045051 Bacteria 2130
362 Ga0451576_0458970 3300045051 Unclassified 1338
363 Ga0495592_0012002 3300046454 Bacteria 6566
364 Ga0495629_0042837 3300046459 Unclassified 3180
365 Ga0495582_0095458 3300046473 Bacteria 1661
366 Ga0495608_0093361 3300046511 Unclassified 1944
367 Ga0495643_0002635 3300046522 Bacteria 13919
368 Ga0495586_0134641 3300046535 Bacteria 1385
369 Ga0495598_0034065 3300046537 Bacteria 1449
370 Ga0495667_0002634 3300046559 Bacteria 11984
371 Ga0495599_0028904 3300046678 Bacteria 3474
372 Ga0495658_0101995 3300046683 Bacteria 1714
373 Ga0495658_0118661 3300046683 Unclassified 1598
374 Ga0495613_0033742 3300046689 Unclassified 3801
375 Ga0495670_0117041 3300046691 Bacteria 1383
376 Ga0495672_0135602 3300047320 Bacteria 1291
377 Ga0495684_0112631 3300047471 Unclassified 2052
378 Ga0495684_0142035 3300047471 Unclassified 1800
379 Ga0496104_0214586 3300048907 Bacteria 1836
380 Ga0496105_0125782 3300048908 Bacteria 2113
381 Ga0496108_0025999 3300048911 Bacteria 4828
382 Ga0496109_0027877 3300048912 Bacteria 5048
383 Ga0496109_0140809 3300048912 Bacteria 2255
384 Ga0496110_0052588 3300048913 Bacteria 3579
385 Ga0496111_0127354 3300048914 Bacteria 1883
386 Ga0496112_0009274 3300048915 Bacteria 8848
387 Ga0496112_0061082 3300048915 Bacteria 3714
388 Ga0496113_0116033 3300048916 Bacteria 2089
389 Ga0496114_0216166 3300048917 Unclassified 1682
390 Ga0496114_0655742 3300048917 Unclassified 923
391 Ga0496121_0283418 3300048924 Bacteria 1132
392 Ga0496122_0089455 3300048925 Bacteria 2105
393 Ga0501032_0005741 3300049569 Bacteria 9179
394 Ga0501033_0102324 3300049570 Bacteria 2089
395 Ga0501033_0128732 3300049570 Bacteria 1835
396 Ga0501034_0009700 3300049571 Bacteria 10067
397 Ga0501034_0031291 3300049571 Bacteria 5405
398 Ga0501034_0050944 3300049571 Bacteria 4175
399 Ga0501034_0101760 3300049571 Bacteria 2866
400 Ga0501034_0114497 3300049571 Bacteria 2685
401 Ga0501034_0567918 3300049571 Bacteria 1042
402 Ga0501036_0217066 3300049572 Bacteria 1606
403 Ga0501037_0000493 3300049573 Bacteria 31918
404 Ga0501037_0007484 3300049573 Unclassified 7991
405 Ga0501037_0440734 3300049573 Bacteria 889
406 Ga0501038_0036850 3300049574 Bacteria 4292
407 Ga0501038_0038584 3300049574 Bacteria 4182
408 Ga0501038_0398585 3300049574 Bacteria 1065
409 Ga0501039_0206282 3300049575 Unclassified 1545
410 Ga0501040_0020833 3300049576 Bacteria 4372
411 Ga0501041_0003239 3300049577 Bacteria 9359
412 Ga0501043_0000292 3300049579 Bacteria 45250
413 Ga0501043_0023533 3300049579 Unclassified 4832
414 Ga0501046_0035788 3300049580 Bacteria 3999
415 Ga0501046_0163667 3300049580 Bacteria 1672
416 Ga0501047_0032682 3300049581 Bacteria 5025
417 Ga0501047_0044854 3300049581 Unclassified 4273
418 Ga0501047_0306890 3300049581 Bacteria 1428
419 Ga0501048_0125012 3300049582 Bacteria 1818
420 Ga0501067_0017128 3300049583 Unclassified 4004
421 Ga0501071_0081804 3300049587 Bacteria 2364
422 Ga0501071_0133707 3300049587 Bacteria 1844
423 Ga0501072_0285657 3300049588 Bacteria 1312
424 Ga0501073_0000001 3300049589 Bacteria 677932
425 Ga0501073_0103784 3300049589 Bacteria 1973
426 Ga0501074_0044650 3300049590 Unclassified 3207
427 Ga0501075_0100957 3300049591 Bacteria 2191
428 Ga0501077_0170995 3300049593 Bacteria 1381
429 Ga0501077_0277684 3300049593 Bacteria 1066
430 Ga0501079_0009999 3300049741 Bacteria 7202
431 Ga0501079_0104902 3300049741 Unclassified 2193
432 Ga0501080_0000757 3300049742 Bacteria 26177
433 Ga0501081_0046935 3300049743 Bacteria 2970
434 Ga0501081_0166911 3300049743 Bacteria 1588
435 Ga0501083_0060676 3300049744 Unclassified 2526
436 Ga0501083_0100363 3300049744 Bacteria 1909
437 Ga0501044_0004285 3300049823 Bacteria 16001
438 Ga0501044_0136560 3300049823 Bacteria 2443
439 Ga0501044_0292091 3300049823 Bacteria 1561
440 Ga0501045_0209837 3300049824 Bacteria 1451
441 Ga0501045_0579770 3300049824 Bacteria 831
442 nmdc:mga03n38_119490_c1 3300050490 Bacteria 1293
443 nmdc:mga00v17_476534_c1 3300050491 Bacteria 810
444 nmdc:mga00v17_63719_c1 3300050491 Bacteria 2271
445 nmdc:mga0k408_116211_c1 3300050493 Bacteria 1583
446 nmdc:mga0k408_208747_c1 3300050493 Bacteria 1166
447 nmdc:mga0k408_27956_c1 3300050493 Bacteria 3205
448 nmdc:mga0k408_57524_c1 3300050493 Bacteria 2257
449 nmdc:mga06z11_31964_c1 3300050494 Bacteria 2563
450 nmdc:mga06z11_37067_c1 3300050494 Bacteria 2412
451 nmdc:mga06z11_43572_c1 3300050494 Bacteria 2259
452 nmdc:mga06z11_81859_c1 3300050494 Bacteria 1734
453 nmdc:mga07m45_22763_c1 3300050496 Bacteria 3423
454 nmdc:mga07m45_4492_c1 3300050496 Bacteria 6828
455 nmdc:mga05p37_153730_c1 3300050507 Bacteria 2813
456 nmdc:mga05p37_44098_c1 3300050507 Bacteria 5487
457 nmdc:mga05p37_51832_c1 3300050507 Bacteria 5046
458 nmdc:mga05p37_92914_c1 3300050507 Unclassified 3718
459 nmdc:mga0qj67_204050_c1 3300050509 Bacteria 1606
460 nmdc:mga0qj67_243228_c1 3300050509 Bacteria 1460
461 nmdc:mga06r32_207622_c1 3300050510 Bacteria 1947
462 nmdc:mga06r32_248141_c1 3300050510 Bacteria 1768
463 nmdc:mga06r32_313749_c1 3300050510 Bacteria 1554
464 nmdc:mga06r32_573884_c1 3300050510 Bacteria 1100
465 nmdc:mga08y16_172153_c1 3300050511 Bacteria 2249
466 nmdc:mga08y16_214790_c1 3300050511 Bacteria 1992
467 nmdc:mga08y16_37257_c1 3300050511 Bacteria 5109
468 nmdc:mga08y16_44216_c1 3300050511 Bacteria 4666
469 nmdc:mga08y16_450644_c1 3300050511 Bacteria 1312
470 nmdc:mga08y16_64083_c1 3300050511 Bacteria 3838
471 nmdc:mga08y16_79064_c1 3300050511 Bacteria 3428
472 nmdc:mga08y16_82294_c1 3300050511 Unclassified 3356
473 nmdc:mga0n895_30096_c1 3300050512 Bacteria 5185
474 nmdc:mga0n895_321586_c1 3300050512 Bacteria 1568
475 nmdc:mga0n895_429_c1 3300050512 Bacteria 28206
476 nmdc:mga0n895_660568_c1 3300050512 Bacteria 1043
477 nmdc:mga0a205_114198_c1 3300050515 Bacteria 2599
478 nmdc:mga0a205_368083_c1 3300050515 Bacteria 1303
479 nmdc:mga0a205_53190_c1 3300050515 Unclassified 3908
480 nmdc:mga0a205_58556_c1 3300050515 Unclassified 3721
481 nmdc:mga0a205_867_c1 3300050515 Bacteria 24788
482 Ga0500568_0004002 3300053139 Bacteria 7996
483 Ga0501084_0704813 3300054114 Bacteria 851
484 Ga0530510_0242024 3300061734 Bacteria 1343

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0163667 Ga0501046_0163667_65_694 192
2 3300054114 Ga0501084_0704813 Ga0501084_0704813_182_811 192
3 3300048917 Ga0496114_0216166 Ga0496114_0216166_984_1583 193
4 3300049575 Ga0501039_0206282 Ga0501039_0206282_267_947 204
5 3300049579 Ga0501043_0023533 Ga0501043_0023533_2905_3585 204
6 3300049581 Ga0501047_0044854 Ga0501047_0044854_1183_1863 204
7 3300049742 Ga0501080_0000757 Ga0501080_0000757_15533_16213 204
8 3300049571 Ga0501034_0009700 Ga0501034_0009700_5240_5920 205
9 3300049573 Ga0501037_0007484 Ga0501037_0007484_4188_4868 205
10 3300049583 Ga0501067_0017128 Ga0501067_0017128_668_1348 205
11 3300049589 Ga0501073_0000001 Ga0501073_0000001_140162_140842 205
12 3300049590 Ga0501074_0044650 Ga0501074_0044650_1973_2653 205
13 3300049744 Ga0501083_0060676 Ga0501083_0060676_190_870 205
14 3300026121 Ga0207683_10483281 Ga0207683_104832812 212
15 3300005335 Ga0070666_10008275 Ga0070666_100082753 215
16 3300005338 Ga0068868_100000724 Ga0068868_10000072410 215
17 3300005344 Ga0070661_100005546 Ga0070661_1000055465 215
18 3300005544 Ga0070686_100019905 Ga0070686_1000199055 215
19 3300005617 Ga0068859_100477659 Ga0068859_1004776592 215
20 3300005618 Ga0068864_100011330 Ga0068864_1000113302 215
21 3300005841 Ga0068863_100017575 Ga0068863_1000175757 215
22 3300006931 Ga0097620_100477710 Ga0097620_1004777101 215
23 3300009177 Ga0105248_10004704 Ga0105248_1000470416 215
24 3300013306 Ga0163162_10002123 Ga0163162_1000212316 215
25 3300013308 Ga0157375_10054175 Ga0157375_100541753 215
26 3300014325 Ga0163163_10070834 Ga0163163_100708343 215
27 3300025941 Ga0207711_10003308 Ga0207711_1000330815 215
28 3300025945 Ga0207679_10020320 Ga0207679_100203205 215
29 3300025960 Ga0207651_10006040 Ga0207651_100060402 215
30 3300026023 Ga0207677_10002302 Ga0207677_100023028 215
31 3300026088 Ga0207641_10064096 Ga0207641_100640962 215
32 3300042876 Ga0451577_0890467 Ga0451577_0890467_39_713 216
33 3300044712 Ga0453684_0117240 Ga0453684_0117240_2516_3190 216
34 3300048917 Ga0496114_0655742 Ga0496114_0655742_17_688 217
35 3300005330 Ga0070690_100005245 Ga0070690_1000052453 218
36 3300005331 Ga0070670_100000207 Ga0070670_10000020712 218
37 3300005367 Ga0070667_100008716 Ga0070667_1000087166 218
38 3300005535 Ga0070684_100036749 Ga0070684_1000367494 218
39 3300005563 Ga0068855_100018735 Ga0068855_1000187359 218
40 3300005564 Ga0070664_100001854 Ga0070664_10000185413 218
41 3300025903 Ga0207680_10046279 Ga0207680_100462792 218
42 3300025949 Ga0207667_10240370 Ga0207667_102403702 218
43 3300025986 Ga0207658_10028631 Ga0207658_100286311 218
44 3300005441 Ga0070700_100119250 Ga0070700_1001192503 219
45 3300005539 Ga0068853_100157775 Ga0068853_1001577752 219
46 3300005544 Ga0070686_100411375 Ga0070686_1004113751 219
47 3300026041 Ga0207639_10127815 Ga0207639_101278152 219
48 3300028800 Ga0265338_10000899 Ga0265338_1000089931 223
49 3300005439 Ga0070711_100000355 Ga0070711_10000035527 224
50 3300025916 Ga0207663_10000002 Ga0207663_10000002576 225
51 3300049571 Ga0501034_0031291 Ga0501034_0031291_1168_1902 226
52 3300028563 Ga0265319_1100006 Ga0265319_11000061 227
53 3300028573 Ga0265334_10031884 Ga0265334_100318841 227
54 3300031240 Ga0265320_10130245 Ga0265320_101302451 227
55 3300049570 Ga0501033_0102324 Ga0501033_0102324_649_1392 227
56 3300049571 Ga0501034_0114497 Ga0501034_0114497_1497_2240 227
57 3300049580 Ga0501046_0035788 Ga0501046_0035788_2661_3404 227
58 3300049589 Ga0501073_0103784 Ga0501073_0103784_708_1451 227
59 3300049823 Ga0501044_0136560 Ga0501044_0136560_335_1078 227
60 3300014326 Ga0157380_10177956 Ga0157380_101779563 228
61 3300005842 Ga0068858_100253837 Ga0068858_1002538372 230
62 3300031240 Ga0265320_10156279 Ga0265320_101562792 230
63 3300053139 Ga0500568_0004002 Ga0500568_0004002_2709_3449 230
64 3300005466 Ga0070685_10158606 Ga0070685_101586062 231
65 3300025926 Ga0207659_10260030 Ga0207659_102600302 231
66 3300049573 Ga0501037_0440734 Ga0501037_0440734_66_809 231
67 3300049574 Ga0501038_0038584 Ga0501038_0038584_165_908 231
68 3300006042 Ga0075368_10077886 Ga0075368_100778861 232
69 3300006178 Ga0075367_10050766 Ga0075367_100507662 232
70 3300028800 Ga0265338_10002345 Ga0265338_1000234523 232
71 3300050491 nmdc:mga00v17_476534_c1 nmdc:mga00v17_476534_c1_15_761 232
72 3300050494 nmdc:mga06z11_37067_c1 nmdc:mga06z11_37067_c1_1128_1874 232
73 3300006195 Ga0075366_10055824 Ga0075366_100558242 233
74 3300005290 Ga0065712_10180367 Ga0065712_101803671 234
75 3300005354 Ga0070675_100255124 Ga0070675_1002551242 234
76 3300005356 Ga0070674_100131465 Ga0070674_1001314652 234
77 3300005549 Ga0070704_100108374 Ga0070704_1001083742 234
78 3300009177 Ga0105248_10170667 Ga0105248_101706672 234
79 3300025931 Ga0207644_10157755 Ga0207644_101577552 234
80 3300025940 Ga0207691_10283027 Ga0207691_102830272 234
81 3300026067 Ga0207678_10595007 Ga0207678_105950072 234
82 3300044712 Ga0453684_0000030 Ga0453684_0000030_383895_384599 234
83 3300049571 Ga0501034_0050944 Ga0501034_0050944_3003_3740 234
84 3300049581 Ga0501047_0306890 Ga0501047_0306890_589_1326 234
85 3300049823 Ga0501044_0004285 Ga0501044_0004285_7757_8494 234
86 3300005842 Ga0068858_100513849 Ga0068858_1005138491 235
87 3300009177 Ga0105248_10437129 Ga0105248_104371292 235
88 3300025910 Ga0207684_10478778 Ga0207684_104787782 235
89 3300025926 Ga0207659_10322682 Ga0207659_103226822 235
90 3300025941 Ga0207711_10537204 Ga0207711_105372041 235
91 3300048914 Ga0496111_0127354 Ga0496111_0127354_625_1350 235
92 3300005471 Ga0070698_100397035 Ga0070698_1003970352 236
93 3300009147 Ga0114129_10568355 Ga0114129_105683552 236
94 3300026088 Ga0207641_10653469 Ga0207641_106534691 236
95 3300045051 Ga0451576_0458970 Ga0451576_0458970_271_1017 236
96 3300049577 Ga0501041_0003239 Ga0501041_0003239_4904_5665 236
97 3300049587 Ga0501071_0133707 Ga0501071_0133707_227_988 236
98 3300049744 Ga0501083_0100363 Ga0501083_0100363_12_773 236
99 3300049824 Ga0501045_0209837 Ga0501045_0209837_202_963 236
100 3300050507 nmdc:mga05p37_92914_c1 nmdc:mga05p37_92914_c1_1627_2352 236
101 3300050509 nmdc:mga0qj67_243228_c1 nmdc:mga0qj67_243228_c1_605_1330 236
102 3300050510 nmdc:mga06r32_573884_c1 nmdc:mga06r32_573884_c1_35_763 236
103 3300005365 Ga0070688_100004722 Ga0070688_1000047227 237
104 3300005617 Ga0068859_100174230 Ga0068859_1001742305 237
105 3300005834 Ga0068851_10020004 Ga0068851_100200043 237
106 3300006844 Ga0075428_100023405 Ga0075428_1000234052 237
107 3300006931 Ga0097620_100174223 Ga0097620_1001742235 237
108 3300009551 Ga0105238_10055307 Ga0105238_100553072 237
109 3300025321 Ga0207656_10029559 Ga0207656_100295593 237
110 3300025924 Ga0207694_10006465 Ga0207694_100064654 237
111 3300031995 Ga0307409_100266318 Ga0307409_1002663181 237
112 3300049576 Ga0501040_0020833 Ga0501040_0020833_878_1642 237
113 3300049582 Ga0501048_0125012 Ga0501048_0125012_120_884 237
114 3300049591 Ga0501075_0100957 Ga0501075_0100957_1055_1819 237
115 3300049741 Ga0501079_0009999 Ga0501079_0009999_3189_3953 237
116 3300049743 Ga0501081_0046935 Ga0501081_0046935_1048_1812 237
117 3300050510 nmdc:mga06r32_313749_c1 nmdc:mga06r32_313749_c1_367_1098 237
118 3300050511 nmdc:mga08y16_37257_c1 nmdc:mga08y16_37257_c1_2529_3260 237
119 3300002459 JGI24751J29686_10003264 JGI24751J29686_100032642 238
120 3300005295 Ga0065707_10001855 Ga0065707_100018552 238
121 3300005331 Ga0070670_100471731 Ga0070670_1004717311 238
122 3300005618 Ga0068864_100001821 Ga0068864_10000182111 238
123 3300005618 Ga0068864_100049383 Ga0068864_1000493831 238
124 3300005841 Ga0068863_100337925 Ga0068863_1003379252 238
125 3300006178 Ga0075367_10012156 Ga0075367_100121562 238
126 3300006195 Ga0075366_10047310 Ga0075366_100473103 238
127 3300006237 Ga0097621_100006038 Ga0097621_1000060383 238
128 3300006237 Ga0097621_100480682 Ga0097621_1004806821 238
129 3300006358 Ga0068871_100030366 Ga0068871_1000303662 238
130 3300006358 Ga0068871_100066161 Ga0068871_1000661612 238
131 3300009148 Ga0105243_10547824 Ga0105243_105478241 238
132 3300009553 Ga0105249_10283028 Ga0105249_102830282 238
133 3300014325 Ga0163163_10003461 Ga0163163_100034615 238
134 3300014325 Ga0163163_10008634 Ga0163163_100086342 238
135 3300014325 Ga0163163_10034264 Ga0163163_100342643 238
136 3300014969 Ga0157376_10089604 Ga0157376_100896042 238
137 3300026088 Ga0207641_10264089 Ga0207641_102640892 238
138 3300026095 Ga0207676_10003093 Ga0207676_100030936 238
139 3300026095 Ga0207676_10295888 Ga0207676_102958881 238
140 3300028800 Ga0265338_10305970 Ga0265338_103059702 238
141 3300046454 Ga0495592_0012002 Ga0495592_0012002_901_1647 238
142 3300046459 Ga0495629_0042837 Ga0495629_0042837_1005_1751 238
143 3300046473 Ga0495582_0095458 Ga0495582_0095458_812_1558 238
144 3300046511 Ga0495608_0093361 Ga0495608_0093361_85_831 238
145 3300046535 Ga0495586_0134641 Ga0495586_0134641_310_1056 238
146 3300046559 Ga0495667_0002634 Ga0495667_0002634_7102_7848 238
147 3300046678 Ga0495599_0028904 Ga0495599_0028904_1643_2389 238
148 3300046683 Ga0495658_0118661 Ga0495658_0118661_202_948 238
149 3300046689 Ga0495613_0033742 Ga0495613_0033742_2612_3358 238
150 3300046691 Ga0495670_0117041 Ga0495670_0117041_573_1304 238
151 3300047471 Ga0495684_0112631 Ga0495684_0112631_79_825 238
152 3300047471 Ga0495684_0142035 Ga0495684_0142035_778_1524 238
153 3300050493 nmdc:mga0k408_57524_c1 nmdc:mga0k408_57524_c1_1439_2179 238
154 3300050494 nmdc:mga06z11_43572_c1 nmdc:mga06z11_43572_c1_1407_2147 238
155 3300005290 Ga0065712_10109964 Ga0065712_101099641 239
156 3300005293 Ga0065715_10127979 Ga0065715_101279794 239
157 3300005293 Ga0065715_10137030 Ga0065715_101370302 239
158 3300005331 Ga0070670_100040123 Ga0070670_1000401231 239
159 3300005334 Ga0068869_100309937 Ga0068869_1003099372 239
160 3300005335 Ga0070666_10216613 Ga0070666_102166132 239
161 3300005353 Ga0070669_100274860 Ga0070669_1002748601 239
162 3300005355 Ga0070671_100015724 Ga0070671_1000157245 239
163 3300005364 Ga0070673_100175126 Ga0070673_1001751262 239
164 3300005518 Ga0070699_100007806 Ga0070699_1000078065 239
165 3300005543 Ga0070672_100054123 Ga0070672_1000541233 239
166 3300005617 Ga0068859_100076740 Ga0068859_1000767402 239
167 3300005840 Ga0068870_10258958 Ga0068870_102589582 239
168 3300005841 Ga0068863_100232372 Ga0068863_1002323723 239
169 3300005843 Ga0068860_100051034 Ga0068860_1000510344 239
170 3300006051 Ga0075364_10010452 Ga0075364_100104522 239
171 3300006852 Ga0075433_10412649 Ga0075433_104126492 239
172 3300006880 Ga0075429_100077033 Ga0075429_1000770332 239
173 3300006931 Ga0097620_100076741 Ga0097620_1000767413 239
174 3300009177 Ga0105248_10185305 Ga0105248_101853052 239
175 3300009177 Ga0105248_10313065 Ga0105248_103130652 239
176 3300014326 Ga0157380_10048203 Ga0157380_100482034 239
177 3300017792 Ga0163161_10344680 Ga0163161_103446801 239
178 3300025908 Ga0207643_10072847 Ga0207643_100728472 239
179 3300025923 Ga0207681_10138386 Ga0207681_101383862 239
180 3300025925 Ga0207650_10163312 Ga0207650_101633121 239
181 3300025938 Ga0207704_10105469 Ga0207704_101054692 239
182 3300025940 Ga0207691_10158598 Ga0207691_101585982 239
183 3300025941 Ga0207711_10142863 Ga0207711_101428631 239
184 3300025941 Ga0207711_10167713 Ga0207711_101677132 239
185 3300025942 Ga0207689_10290366 Ga0207689_102903662 239
186 3300025960 Ga0207651_10002533 Ga0207651_100025334 239
187 3300028381 Ga0268264_10114205 Ga0268264_101142054 239
188 3300036401 Ga0373937_0124198 Ga0373937_0124198_200_961 239
189 3300046522 Ga0495643_0002635 Ga0495643_0002635_6234_6971 239
190 3300049571 Ga0501034_0567918 Ga0501034_0567918_24_767 239
191 3300050512 nmdc:mga0n895_660568_c1 nmdc:mga0n895_660568_c1_102_836 239
192 3300050515 nmdc:mga0a205_368083_c1 nmdc:mga0a205_368083_c1_83_817 239
193 3300005290 Ga0065712_10002563 Ga0065712_100025634 240
194 3300005331 Ga0070670_100066700 Ga0070670_1000667003 240
195 3300005331 Ga0070670_100142774 Ga0070670_1001427742 240
196 3300005333 Ga0070677_10174774 Ga0070677_101747741 240
197 3300005340 Ga0070689_100600335 Ga0070689_1006003351 240
198 3300005343 Ga0070687_100036490 Ga0070687_1000364903 240
199 3300005347 Ga0070668_100133777 Ga0070668_1001337772 240
200 3300005355 Ga0070671_100020344 Ga0070671_1000203443 240
201 3300005356 Ga0070674_100300634 Ga0070674_1003006342 240
202 3300005356 Ga0070674_100534295 Ga0070674_1005342952 240
203 3300005365 Ga0070688_100354483 Ga0070688_1003544832 240
204 3300005365 Ga0070688_100515234 Ga0070688_1005152341 240
205 3300005548 Ga0070665_100049526 Ga0070665_1000495264 240
206 3300005564 Ga0070664_100005981 Ga0070664_1000059812 240
207 3300005617 Ga0068859_100355806 Ga0068859_1003558062 240
208 3300005618 Ga0068864_100074257 Ga0068864_1000742572 240
209 3300006852 Ga0075433_10053391 Ga0075433_100533912 240
210 3300006852 Ga0075433_10160483 Ga0075433_101604833 240
211 3300006931 Ga0097620_100355788 Ga0097620_1003557882 240
212 3300009094 Ga0111539_10121450 Ga0111539_101214503 240
213 3300009551 Ga0105238_10749634 Ga0105238_107496342 240
214 3300009553 Ga0105249_10193009 Ga0105249_101930092 240
215 3300014326 Ga0157380_10156379 Ga0157380_101563792 240
216 3300025908 Ga0207643_10046636 Ga0207643_100466362 240
217 3300025916 Ga0207663_10311055 Ga0207663_103110552 240
218 3300025918 Ga0207662_10122526 Ga0207662_101225262 240
219 3300025918 Ga0207662_10237352 Ga0207662_102373522 240
220 3300025925 Ga0207650_10293789 Ga0207650_102937892 240
221 3300025931 Ga0207644_10036461 Ga0207644_100364613 240
222 3300025936 Ga0207670_10489726 Ga0207670_104897262 240
223 3300025941 Ga0207711_10043722 Ga0207711_100437225 240
224 3300025945 Ga0207679_10012999 Ga0207679_100129994 240
225 3300025961 Ga0207712_10159238 Ga0207712_101592382 240
226 3300025972 Ga0207668_10411918 Ga0207668_104119182 240
227 3300026095 Ga0207676_10063182 Ga0207676_100631823 240
228 3300026118 Ga0207675_100066540 Ga0207675_1000665402 240
229 3300026121 Ga0207683_10173241 Ga0207683_101732412 240
230 3300027907 Ga0207428_10180078 Ga0207428_101800781 240
231 3300028379 Ga0268266_10093865 Ga0268266_100938653 240
232 3300028380 Ga0268265_10162974 Ga0268265_101629742 240
233 3300028380 Ga0268265_10262739 Ga0268265_102627392 240
234 3300048915 Ga0496112_0009274 Ga0496112_0009274_3856_4614 240
235 3300050511 nmdc:mga08y16_172153_c1 nmdc:mga08y16_172153_c1_1087_1818 240
236 3300050515 nmdc:mga0a205_53190_c1 nmdc:mga0a205_53190_c1_2585_3325 240
237 3300005328 Ga0070676_10062250 Ga0070676_100622503 241
238 3300005329 Ga0070683_100046357 Ga0070683_1000463575 241
239 3300005331 Ga0070670_100147277 Ga0070670_1001472773 241
240 3300005334 Ga0068869_100001813 Ga0068869_10000181311 241
241 3300005334 Ga0068869_100073865 Ga0068869_1000738652 241
242 3300005334 Ga0068869_100370306 Ga0068869_1003703062 241
243 3300005338 Ga0068868_100261093 Ga0068868_1002610932 241
244 3300005344 Ga0070661_100102461 Ga0070661_1001024611 241
245 3300005353 Ga0070669_100004878 Ga0070669_1000048783 241
246 3300005353 Ga0070669_100022830 Ga0070669_1000228303 241
247 3300005354 Ga0070675_100006639 Ga0070675_1000066396 241
248 3300005364 Ga0070673_100004578 Ga0070673_1000045786 241
249 3300005366 Ga0070659_100324443 Ga0070659_1003244432 241
250 3300005367 Ga0070667_100168191 Ga0070667_1001681912 241
251 3300005438 Ga0070701_10004006 Ga0070701_100040064 241
252 3300005441 Ga0070700_100001339 Ga0070700_10000133912 241
253 3300005441 Ga0070700_100229381 Ga0070700_1002293812 241
254 3300005444 Ga0070694_100244171 Ga0070694_1002441712 241
255 3300005455 Ga0070663_100181665 Ga0070663_1001816653 241
256 3300005456 Ga0070678_100232519 Ga0070678_1002325192 241
257 3300005459 Ga0068867_100000241 Ga0068867_10000024131 241
258 3300005459 Ga0068867_100229572 Ga0068867_1002295722 241
259 3300005535 Ga0070684_100062058 Ga0070684_1000620583 241
260 3300005543 Ga0070672_100002505 Ga0070672_1000025053 241
261 3300005546 Ga0070696_100339090 Ga0070696_1003390902 241
262 3300005615 Ga0070702_100031860 Ga0070702_1000318602 241
263 3300005617 Ga0068859_100151941 Ga0068859_1001519412 241
264 3300005618 Ga0068864_100356289 Ga0068864_1003562891 241
265 3300005718 Ga0068866_10010482 Ga0068866_100104822 241
266 3300005719 Ga0068861_100226635 Ga0068861_1002266352 241
267 3300005841 Ga0068863_100148362 Ga0068863_1001483621 241
268 3300005842 Ga0068858_100010410 Ga0068858_1000104106 241
269 3300005844 Ga0068862_100411550 Ga0068862_1004115501 241
270 3300006048 Ga0075363_100080062 Ga0075363_1000800622 241
271 3300006051 Ga0075364_10268347 Ga0075364_102683471 241
272 3300006178 Ga0075367_10393134 Ga0075367_103931342 241
273 3300006195 Ga0075366_10020009 Ga0075366_100200093 241
274 3300006844 Ga0075428_100049483 Ga0075428_1000494834 241
275 3300006844 Ga0075428_100563335 Ga0075428_1005633351 241
276 3300006852 Ga0075433_10227225 Ga0075433_102272254 241
277 3300006881 Ga0068865_100004420 Ga0068865_1000044203 241
278 3300006931 Ga0097620_100151942 Ga0097620_1001519422 241
279 3300009094 Ga0111539_10040969 Ga0111539_100409695 241
280 3300009094 Ga0111539_10054729 Ga0111539_100547292 241
281 3300009098 Ga0105245_10840267 Ga0105245_108402671 241
282 3300009101 Ga0105247_10015861 Ga0105247_100158612 241
283 3300009147 Ga0114129_10158300 Ga0114129_101583002 241
284 3300009147 Ga0114129_10346089 Ga0114129_103460892 241
285 3300009148 Ga0105243_10010632 Ga0105243_100106324 241
286 3300009176 Ga0105242_10022081 Ga0105242_100220812 241
287 3300009177 Ga0105248_10705365 Ga0105248_107053652 241
288 3300009553 Ga0105249_10020467 Ga0105249_100204675 241
289 3300009553 Ga0105249_10432073 Ga0105249_104320731 241
290 3300014325 Ga0163163_10053071 Ga0163163_100530715 241
291 3300014325 Ga0163163_10110392 Ga0163163_101103922 241
292 3300014325 Ga0163163_10785944 Ga0163163_107859441 241
293 3300014326 Ga0157380_10004786 Ga0157380_100047869 241
294 3300014326 Ga0157380_10980440 Ga0157380_109804401 241
295 3300014745 Ga0157377_10059622 Ga0157377_100596222 241
296 3300014968 Ga0157379_10016021 Ga0157379_100160214 241
297 3300014969 Ga0157376_10771713 Ga0157376_107717131 241
298 3300025893 Ga0207682_10012564 Ga0207682_100125643 241
299 3300025899 Ga0207642_10130147 Ga0207642_101301472 241
300 3300025900 Ga0207710_10009266 Ga0207710_100092662 241
301 3300025901 Ga0207688_10046157 Ga0207688_100461572 241
302 3300025907 Ga0207645_10007138 Ga0207645_100071384 241
303 3300025920 Ga0207649_10043593 Ga0207649_100435932 241
304 3300025923 Ga0207681_10004262 Ga0207681_100042626 241
305 3300025923 Ga0207681_10028915 Ga0207681_100289153 241
306 3300025934 Ga0207686_10025844 Ga0207686_100258442 241
307 3300025935 Ga0207709_10130926 Ga0207709_101309261 241
308 3300025937 Ga0207669_10039206 Ga0207669_100392063 241
309 3300025940 Ga0207691_10070024 Ga0207691_100700244 241
310 3300025941 Ga0207711_10386779 Ga0207711_103867792 241
311 3300025942 Ga0207689_10004974 Ga0207689_1000497410 241
312 3300025942 Ga0207689_10162999 Ga0207689_101629992 241
313 3300025942 Ga0207689_10515083 Ga0207689_105150832 241
314 3300025944 Ga0207661_10235043 Ga0207661_102350433 241
315 3300025960 Ga0207651_10008493 Ga0207651_100084932 241
316 3300025960 Ga0207651_10144644 Ga0207651_101446442 241
317 3300025961 Ga0207712_10018694 Ga0207712_100186942 241
318 3300025981 Ga0207640_10054543 Ga0207640_100545432 241
319 3300025986 Ga0207658_10092108 Ga0207658_100921083 241
320 3300026035 Ga0207703_10011031 Ga0207703_100110314 241
321 3300026067 Ga0207678_10449639 Ga0207678_104496391 241
322 3300026075 Ga0207708_10003942 Ga0207708_100039425 241
323 3300026075 Ga0207708_10167572 Ga0207708_101675722 241
324 3300026088 Ga0207641_10090217 Ga0207641_100902172 241
325 3300026089 Ga0207648_10000274 Ga0207648_1000027449 241
326 3300026116 Ga0207674_10245443 Ga0207674_102454432 241
327 3300026118 Ga0207675_100406164 Ga0207675_1004061642 241
328 3300026118 Ga0207675_100423166 Ga0207675_1004231662 241
329 3300026121 Ga0207683_10116027 Ga0207683_101160273 241
330 3300027907 Ga0207428_10015673 Ga0207428_100156732 241
331 3300027907 Ga0207428_10116443 Ga0207428_101164431 241
332 3300028380 Ga0268265_10094562 Ga0268265_100945622 241
333 3300028380 Ga0268265_10371273 Ga0268265_103712732 241
334 3300031235 Ga0265330_10028907 Ga0265330_100289074 241
335 3300031242 Ga0265329_10006440 Ga0265329_100064402 241
336 3300031250 Ga0265331_10092562 Ga0265331_100925623 241
337 3300031824 Ga0307413_10552074 Ga0307413_105520742 241
338 3300031995 Ga0307409_100598168 Ga0307409_1005981682 241
339 3300042436 Ga0439435_0002496 Ga0439435_0002496_895_1635 241
340 3300044712 Ga0453684_0229780 Ga0453684_0229780_466_1212 241
341 3300046683 Ga0495658_0101995 Ga0495658_0101995_663_1409 241
342 3300047320 Ga0495672_0135602 Ga0495672_0135602_156_899 241
343 3300048907 Ga0496104_0214586 Ga0496104_0214586_37_780 241
344 3300048908 Ga0496105_0125782 Ga0496105_0125782_110_853 241
345 3300048911 Ga0496108_0025999 Ga0496108_0025999_3778_4521 241
346 3300048912 Ga0496109_0140809 Ga0496109_0140809_378_1121 241
347 3300048913 Ga0496110_0052588 Ga0496110_0052588_1308_2051 241
348 3300048915 Ga0496112_0061082 Ga0496112_0061082_964_1707 241
349 3300048916 Ga0496113_0116033 Ga0496113_0116033_863_1606 241
350 3300048924 Ga0496121_0283418 Ga0496121_0283418_124_849 241
351 3300049570 Ga0501033_0128732 Ga0501033_0128732_699_1439 241
352 3300049588 Ga0501072_0285657 Ga0501072_0285657_113_853 241
353 3300049593 Ga0501077_0170995 Ga0501077_0170995_320_1060 241
354 3300049593 Ga0501077_0277684 Ga0501077_0277684_277_1017 241
355 3300049741 Ga0501079_0104902 Ga0501079_0104902_607_1347 241
356 3300049743 Ga0501081_0166911 Ga0501081_0166911_63_803 241
357 3300049824 Ga0501045_0579770 Ga0501045_0579770_35_775 241
358 3300050490 nmdc:mga03n38_119490_c1 nmdc:mga03n38_119490_c1_55_804 241
359 3300050491 nmdc:mga00v17_63719_c1 nmdc:mga00v17_63719_c1_946_1695 241
360 3300050494 nmdc:mga06z11_31964_c1 nmdc:mga06z11_31964_c1_577_1326 241
361 3300050496 nmdc:mga07m45_22763_c1 nmdc:mga07m45_22763_c1_236_985 241
362 3300050507 nmdc:mga05p37_153730_c1 nmdc:mga05p37_153730_c1_31_771 241
363 3300050511 nmdc:mga08y16_44216_c1 nmdc:mga08y16_44216_c1_3435_4175 241
364 3300050511 nmdc:mga08y16_450644_c1 nmdc:mga08y16_450644_c1_42_782 241
365 3300050511 nmdc:mga08y16_79064_c1 nmdc:mga08y16_79064_c1_1186_1929 241
366 3300050512 nmdc:mga0n895_321586_c1 nmdc:mga0n895_321586_c1_614_1357 241
367 3300061734 Ga0530510_0242024 Ga0530510_0242024_328_1068 241
368 3300005293 Ga0065715_10152854 Ga0065715_101528542 242
369 3300005295 Ga0065707_10315487 Ga0065707_103154871 242
370 3300005334 Ga0068869_100356790 Ga0068869_1003567902 242
371 3300005340 Ga0070689_100396442 Ga0070689_1003964421 242
372 3300005354 Ga0070675_100074474 Ga0070675_1000744742 242
373 3300005354 Ga0070675_100098680 Ga0070675_1000986802 242
374 3300005355 Ga0070671_100028507 Ga0070671_1000285075 242
375 3300005364 Ga0070673_100009471 Ga0070673_1000094712 242
376 3300005365 Ga0070688_100120078 Ga0070688_1001200782 242
377 3300005365 Ga0070688_100258216 Ga0070688_1002582162 242
378 3300005365 Ga0070688_100332158 Ga0070688_1003321581 242
379 3300005367 Ga0070667_100437552 Ga0070667_1004375521 242
380 3300005518 Ga0070699_100073174 Ga0070699_1000731743 242
381 3300005543 Ga0070672_100242272 Ga0070672_1002422722 242
382 3300005544 Ga0070686_100021930 Ga0070686_1000219302 242
383 3300005578 Ga0068854_100410155 Ga0068854_1004101552 242
384 3300005840 Ga0068870_10240846 Ga0068870_102408461 242
385 3300005841 Ga0068863_100043928 Ga0068863_1000439283 242
386 3300006178 Ga0075367_10136565 Ga0075367_101365652 242
387 3300006195 Ga0075366_10086780 Ga0075366_100867802 242
388 3300006353 Ga0075370_10063419 Ga0075370_100634192 242
389 3300006844 Ga0075428_100032736 Ga0075428_1000327364 242
390 3300006846 Ga0075430_100089459 Ga0075430_1000894592 242
391 3300006847 Ga0075431_100008709 Ga0075431_1000087093 242
392 3300006847 Ga0075431_100174073 Ga0075431_1001740732 242
393 3300006852 Ga0075433_10000616 Ga0075433_1000061619 242
394 3300006852 Ga0075433_10002832 Ga0075433_1000283210 242
395 3300006852 Ga0075433_10023143 Ga0075433_100231432 242
396 3300006871 Ga0075434_100000950 Ga0075434_10000095022 242
397 3300006871 Ga0075434_100011925 Ga0075434_1000119257 242
398 3300006880 Ga0075429_100220407 Ga0075429_1002204072 242
399 3300009094 Ga0111539_10000956 Ga0111539_1000095631 242
400 3300009094 Ga0111539_10015035 Ga0111539_100150353 242
401 3300009094 Ga0111539_10072499 Ga0111539_100724992 242
402 3300009094 Ga0111539_10441637 Ga0111539_104416372 242
403 3300009147 Ga0114129_10024087 Ga0114129_100240874 242
404 3300009147 Ga0114129_10123446 Ga0114129_101234462 242
405 3300009177 Ga0105248_10047080 Ga0105248_100470803 242
406 3300013308 Ga0157375_10463845 Ga0157375_104638452 242
407 3300014325 Ga0163163_10066888 Ga0163163_100668881 242
408 3300014326 Ga0157380_10096227 Ga0157380_100962273 242
409 3300014745 Ga0157377_10006714 Ga0157377_100067144 242
410 3300025893 Ga0207682_10038361 Ga0207682_100383612 242
411 3300025908 Ga0207643_10025085 Ga0207643_100250853 242
412 3300025925 Ga0207650_10094401 Ga0207650_100944012 242
413 3300025926 Ga0207659_10010910 Ga0207659_100109103 242
414 3300025926 Ga0207659_10032849 Ga0207659_100328492 242
415 3300025926 Ga0207659_10268490 Ga0207659_102684902 242
416 3300025940 Ga0207691_10082017 Ga0207691_100820171 242
417 3300025960 Ga0207651_10033218 Ga0207651_100332182 242
418 3300025960 Ga0207651_10174713 Ga0207651_101747132 242
419 3300025972 Ga0207668_10446150 Ga0207668_104461501 242
420 3300025981 Ga0207640_10497231 Ga0207640_104972312 242
421 3300026088 Ga0207641_10029918 Ga0207641_100299183 242
422 3300026088 Ga0207641_10320941 Ga0207641_103209411 242
423 3300026089 Ga0207648_10189073 Ga0207648_101890732 242
424 3300026121 Ga0207683_10091034 Ga0207683_100910344 242
425 3300027665 Ga0209983_1019940 Ga0209983_10199402 242
426 3300027866 Ga0209813_10039529 Ga0209813_100395292 242
427 3300027907 Ga0207428_10098935 Ga0207428_100989352 242
428 3300031235 Ga0265330_10020430 Ga0265330_100204303 242
429 3300031238 Ga0265332_10000169 Ga0265332_1000016916 242
430 3300031240 Ga0265320_10019909 Ga0265320_100199093 242
431 3300031242 Ga0265329_10002408 Ga0265329_100024083 242
432 3300031250 Ga0265331_10000117 Ga0265331_1000011752 242
433 3300031344 Ga0265316_10000031 Ga0265316_10000031106 242
434 3300031711 Ga0265314_10000183 Ga0265314_1000018314 242
435 3300031712 Ga0265342_10000869 Ga0265342_100008697 242
436 3300031911 Ga0307412_10331496 Ga0307412_103314962 242
437 3300045051 Ga0451576_0192592 Ga0451576_0192592_353_1099 242
438 3300048912 Ga0496109_0027877 Ga0496109_0027877_3473_4216 242
439 3300049572 Ga0501036_0217066 Ga0501036_0217066_343_1107 242
440 3300049587 Ga0501071_0081804 Ga0501071_0081804_1126_1890 242
441 3300050493 nmdc:mga0k408_116211_c1 nmdc:mga0k408_116211_c1_150_908 242
442 3300050493 nmdc:mga0k408_208747_c1 nmdc:mga0k408_208747_c1_227_979 242
443 3300050494 nmdc:mga06z11_81859_c1 nmdc:mga06z11_81859_c1_706_1464 242
444 3300050507 nmdc:mga05p37_44098_c1 nmdc:mga05p37_44098_c1_700_1443 242
445 3300050507 nmdc:mga05p37_51832_c1 nmdc:mga05p37_51832_c1_753_1508 242
446 3300050509 nmdc:mga0qj67_204050_c1 nmdc:mga0qj67_204050_c1_456_1202 242
447 3300050510 nmdc:mga06r32_207622_c1 nmdc:mga06r32_207622_c1_233_979 242
448 3300050510 nmdc:mga06r32_248141_c1 nmdc:mga06r32_248141_c1_837_1583 242
449 3300050511 nmdc:mga08y16_214790_c1 nmdc:mga08y16_214790_c1_483_1238 242
450 3300050511 nmdc:mga08y16_64083_c1 nmdc:mga08y16_64083_c1_2356_3099 242
451 3300050511 nmdc:mga08y16_82294_c1 nmdc:mga08y16_82294_c1_111_854 242
452 3300050512 nmdc:mga0n895_30096_c1 nmdc:mga0n895_30096_c1_88_834 242
453 3300050512 nmdc:mga0n895_429_c1 nmdc:mga0n895_429_c1_12807_13553 242
454 3300050515 nmdc:mga0a205_114198_c1 nmdc:mga0a205_114198_c1_586_1329 242
455 3300050515 nmdc:mga0a205_58556_c1 nmdc:mga0a205_58556_c1_829_1575 242
456 3300050515 nmdc:mga0a205_867_c1 nmdc:mga0a205_867_c1_8032_8778 242
457 3300005327 Ga0070658_10360426 Ga0070658_103604261 243
458 3300005354 Ga0070675_100006764 Ga0070675_1000067648 243
459 3300005365 Ga0070688_100192470 Ga0070688_1001924702 243
460 3300005441 Ga0070700_100390052 Ga0070700_1003900521 243
461 3300005459 Ga0068867_100244298 Ga0068867_1002442982 243
462 3300005543 Ga0070672_100064185 Ga0070672_1000641853 243
463 3300005840 Ga0068870_10007640 Ga0068870_100076406 243
464 3300009094 Ga0111539_10531274 Ga0111539_105312742 243
465 3300009148 Ga0105243_10390594 Ga0105243_103905941 243
466 3300014326 Ga0157380_10003839 Ga0157380_100038395 243
467 3300014326 Ga0157380_10031703 Ga0157380_100317033 243
468 3300025893 Ga0207682_10048811 Ga0207682_100488112 243
469 3300025960 Ga0207651_10074122 Ga0207651_100741222 243
470 3300046537 Ga0495598_0034065 Ga0495598_0034065_620_1360 243
471 3300049574 Ga0501038_0398585 Ga0501038_0398585_59_838 243
472 3300049823 Ga0501044_0292091 Ga0501044_0292091_642_1391 244
473 3300050493 nmdc:mga0k408_27956_c1 nmdc:mga0k408_27956_c1_684_1481 244
474 3300050496 nmdc:mga07m45_4492_c1 nmdc:mga07m45_4492_c1_5817_6614 244
475 3300006844 Ga0075428_100012887 Ga0075428_1000128877 246
476 3300049569 Ga0501032_0005741 Ga0501032_0005741_2724_3479 246
477 3300049571 Ga0501034_0101760 Ga0501034_0101760_1396_2154 247
478 3300049573 Ga0501037_0000493 Ga0501037_0000493_5321_6079 247
479 3300049574 Ga0501038_0036850 Ga0501038_0036850_2971_3729 247
480 3300049579 Ga0501043_0000292 Ga0501043_0000292_5622_6380 247
481 3300049581 Ga0501047_0032682 Ga0501047_0032682_4001_4759 247
482 3300048925 Ga0496122_0089455 Ga0496122_0089455_802_1551 249
483 2162886007 SwRhRL2b_contig_1759361 SwRhRL2b_0440.00007420 250
484 3300005289 Ga0065704_10070132 Ga0065704_100701321478 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

24

167

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e4l-assembly1.cif.gz_A thermodynamic and structural analysis of thermolabile rnase hi from shewanella oneidensis mr-1 0.9378 6 152
1kvc-assembly1.cif.gz_A e. coli ribonuclease hi d134n mutant 0.9343 8 156
2z1j-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) 0.9323 7 156
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9316 7 156
1jl2-assembly1.cif.gz_C crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h 0.9294 8 156
ID Description Score Start End Superfamily
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9294 8 156 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8962 6 157 3.30.420.10
af_Q9XVE6_2_138_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8776 9 134 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8758 8 156 3.30.420.10
af_M0RAC3_1264_1411_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8632 8 153 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A838RSC6-F1-model_v4 Ribonuclease HI 0.9912 7 78 GO:0003676
GO:0004523
AF-A0A3P8MB71-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9783 7 153 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137
AF-A0A6I5NQP7-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9711 10 158 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137
AF-A0A2D8V7A9-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9689 5 153 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137
AF-A0A355VUJ1-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9685 6 153 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137

Feature Viewer

pLDDT pTM Quality
90.42 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map