F452908
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 225 | 484 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100012887|Ga0075428_1000128877 |
| Length | 273 |
| Sequence | VVRSSSTDIPNRSDNARLTEDRSLPIIVFTDGAAKGNPGPGGWGAIVVSPDQHVVELGGGSPHTTNNRMELSGAIAALQHVVNRPGPVAIYMDSTYVIQGITQWVWGWRKRGWRTAQGGDVLNRDLWEQLTSLVGARARGDVDWHWVRGHVGTPGNERADQISVAFALQQSADLYDGPFDGYPRPILQLPDDTALPKRTGSVSGAKTKAAAYSYLSVVDGVPMRHTTWAECEGRVKGQSGARFKKATSAADEAAILRSWGIESSRIQPHPVPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 158 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 159 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 176 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 181 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 182 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 183 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 215 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 217 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 224 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.79 |
| Nodule | 0 |
| Rhizoplane | 2.48 |
| Rhizosphere | 91.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1759361 | 2162886007 | Bacteria | 232727 |
| 2 | JGI24751J29686_10003264 | 3300002459 | Bacteria | 3265 |
| 3 | Ga0065704_10070132 | 3300005289 | Bacteria | 1955461 |
| 4 | Ga0065712_10002563 | 3300005290 | Bacteria | 5247 |
| 5 | Ga0065712_10109964 | 3300005290 | Unclassified | 1845 |
| 6 | Ga0065712_10180367 | 3300005290 | Bacteria | 1195 |
| 7 | Ga0065715_10127979 | 3300005293 | Bacteria | 2075 |
| 8 | Ga0065715_10137030 | 3300005293 | Unclassified | 1913 |
| 9 | Ga0065715_10152854 | 3300005293 | Bacteria | 1709 |
| 10 | Ga0065707_10001855 | 3300005295 | Bacteria | 6835 |
| 11 | Ga0065707_10315487 | 3300005295 | Unclassified | 976 |
| 12 | Ga0070658_10360426 | 3300005327 | Bacteria | 1245 |
| 13 | Ga0070676_10062250 | 3300005328 | Bacteria | 2220 |
| 14 | Ga0070683_100046357 | 3300005329 | Bacteria | 4015 |
| 15 | Ga0070690_100005245 | 3300005330 | Bacteria | 7261 |
| 16 | Ga0070670_100000207 | 3300005331 | Bacteria | 54657 |
| 17 | Ga0070670_100040123 | 3300005331 | Bacteria | 4026 |
| 18 | Ga0070670_100066700 | 3300005331 | Bacteria | 3088 |
| 19 | Ga0070670_100142774 | 3300005331 | Bacteria | 2071 |
| 20 | Ga0070670_100147277 | 3300005331 | Bacteria | 2037 |
| 21 | Ga0070670_100471731 | 3300005331 | Unclassified | 1114 |
| 22 | Ga0070677_10174774 | 3300005333 | Bacteria | 1018 |
| 23 | Ga0068869_100001813 | 3300005334 | Bacteria | 12828 |
| 24 | Ga0068869_100073865 | 3300005334 | Bacteria | 2530 |
| 25 | Ga0068869_100309937 | 3300005334 | Bacteria | 1277 |
| 26 | Ga0068869_100356790 | 3300005334 | Bacteria | 1193 |
| 27 | Ga0068869_100370306 | 3300005334 | Bacteria | 1172 |
| 28 | Ga0070666_10008275 | 3300005335 | Bacteria | 6450 |
| 29 | Ga0070666_10216613 | 3300005335 | Bacteria | 1350 |
| 30 | Ga0068868_100000724 | 3300005338 | Bacteria | 22276 |
| 31 | Ga0068868_100261093 | 3300005338 | Bacteria | 1461 |
| 32 | Ga0070689_100396442 | 3300005340 | Bacteria | 1166 |
| 33 | Ga0070689_100600335 | 3300005340 | Bacteria | 953 |
| 34 | Ga0070687_100036490 | 3300005343 | Unclassified | 2450 |
| 35 | Ga0070661_100005546 | 3300005344 | Bacteria | 8701 |
| 36 | Ga0070661_100102461 | 3300005344 | Bacteria | 2131 |
| 37 | Ga0070668_100133777 | 3300005347 | Bacteria | 1992 |
| 38 | Ga0070669_100004878 | 3300005353 | Bacteria | 9680 |
| 39 | Ga0070669_100022830 | 3300005353 | Bacteria | 4475 |
| 40 | Ga0070669_100274860 | 3300005353 | Bacteria | 1348 |
| 41 | Ga0070675_100006639 | 3300005354 | Bacteria | 8894 |
| 42 | Ga0070675_100006764 | 3300005354 | Bacteria | 8811 |
| 43 | Ga0070675_100074474 | 3300005354 | Bacteria | 2820 |
| 44 | Ga0070675_100098680 | 3300005354 | Bacteria | 2457 |
| 45 | Ga0070675_100255124 | 3300005354 | Bacteria | 1536 |
| 46 | Ga0070671_100015724 | 3300005355 | Bacteria | 6114 |
| 47 | Ga0070671_100020344 | 3300005355 | Bacteria | 5411 |
| 48 | Ga0070671_100028507 | 3300005355 | Bacteria | 4597 |
| 49 | Ga0070674_100131465 | 3300005356 | Bacteria | 1866 |
| 50 | Ga0070674_100300634 | 3300005356 | Bacteria | 1279 |
| 51 | Ga0070674_100534295 | 3300005356 | Bacteria | 981 |
| 52 | Ga0070673_100004578 | 3300005364 | Bacteria | 8765 |
| 53 | Ga0070673_100009471 | 3300005364 | Bacteria | 6538 |
| 54 | Ga0070673_100175126 | 3300005364 | Bacteria | 1833 |
| 55 | Ga0070688_100004722 | 3300005365 | Bacteria | 7119 |
| 56 | Ga0070688_100120078 | 3300005365 | Bacteria | 1759 |
| 57 | Ga0070688_100192470 | 3300005365 | Bacteria | 1422 |
| 58 | Ga0070688_100258216 | 3300005365 | Unclassified | 1243 |
| 59 | Ga0070688_100332158 | 3300005365 | Bacteria | 1108 |
| 60 | Ga0070688_100354483 | 3300005365 | Unclassified | 1075 |
| 61 | Ga0070688_100515234 | 3300005365 | Bacteria | 904 |
| 62 | Ga0070659_100324443 | 3300005366 | Unclassified | 1288 |
| 63 | Ga0070667_100008716 | 3300005367 | Bacteria | 8410 |
| 64 | Ga0070667_100168191 | 3300005367 | Unclassified | 1934 |
| 65 | Ga0070667_100437552 | 3300005367 | Bacteria | 1194 |
| 66 | Ga0070701_10004006 | 3300005438 | Bacteria | 5900 |
| 67 | Ga0070711_100000355 | 3300005439 | Bacteria | 23715 |
| 68 | Ga0070700_100001339 | 3300005441 | Bacteria | 12246 |
| 69 | Ga0070700_100119250 | 3300005441 | Bacteria | 1765 |
| 70 | Ga0070700_100229381 | 3300005441 | Bacteria | 1321 |
| 71 | Ga0070700_100390052 | 3300005441 | Bacteria | 1044 |
| 72 | Ga0070694_100244171 | 3300005444 | Unclassified | 1356 |
| 73 | Ga0070663_100181665 | 3300005455 | Unclassified | 1632 |
| 74 | Ga0070678_100232519 | 3300005456 | Bacteria | 1538 |
| 75 | Ga0068867_100000241 | 3300005459 | Bacteria | 36023 |
| 76 | Ga0068867_100229572 | 3300005459 | Bacteria | 1500 |
| 77 | Ga0068867_100244298 | 3300005459 | Bacteria | 1457 |
| 78 | Ga0070685_10158606 | 3300005466 | Unclassified | 1440 |
| 79 | Ga0070698_100397035 | 3300005471 | Bacteria | 1312 |
| 80 | Ga0070699_100007806 | 3300005518 | Bacteria | 9302 |
| 81 | Ga0070699_100073174 | 3300005518 | Bacteria | 2981 |
| 82 | Ga0070684_100036749 | 3300005535 | Bacteria | 4197 |
| 83 | Ga0070684_100062058 | 3300005535 | Bacteria | 3273 |
| 84 | Ga0068853_100157775 | 3300005539 | Unclassified | 2045 |
| 85 | Ga0070672_100002505 | 3300005543 | Bacteria | 11688 |
| 86 | Ga0070672_100054123 | 3300005543 | Bacteria | 3140 |
| 87 | Ga0070672_100064185 | 3300005543 | Bacteria | 2901 |
| 88 | Ga0070672_100242272 | 3300005543 | Unclassified | 1517 |
| 89 | Ga0070686_100019905 | 3300005544 | Bacteria | 3966 |
| 90 | Ga0070686_100021930 | 3300005544 | Bacteria | 3801 |
| 91 | Ga0070686_100411375 | 3300005544 | Bacteria | 1031 |
| 92 | Ga0070696_100339090 | 3300005546 | Bacteria | 1161 |
| 93 | Ga0070665_100049526 | 3300005548 | Bacteria | 4215 |
| 94 | Ga0070704_100108374 | 3300005549 | Bacteria | 2109 |
| 95 | Ga0068855_100018735 | 3300005563 | Bacteria | 8323 |
| 96 | Ga0070664_100001854 | 3300005564 | Bacteria | 16923 |
| 97 | Ga0070664_100005981 | 3300005564 | Bacteria | 9835 |
| 98 | Ga0068854_100410155 | 3300005578 | Unclassified | 1123 |
| 99 | Ga0070702_100031860 | 3300005615 | Bacteria | 2888 |
| 100 | Ga0068859_100076740 | 3300005617 | Bacteria | 3382 |
| 101 | Ga0068859_100151941 | 3300005617 | Bacteria | 2391 |
| 102 | Ga0068859_100174230 | 3300005617 | Bacteria | 2233 |
| 103 | Ga0068859_100355806 | 3300005617 | Bacteria | 1559 |
| 104 | Ga0068859_100477659 | 3300005617 | Unclassified | 1342 |
| 105 | Ga0068864_100001821 | 3300005618 | Bacteria | 17498 |
| 106 | Ga0068864_100011330 | 3300005618 | Bacteria | 7368 |
| 107 | Ga0068864_100049383 | 3300005618 | Unclassified | 3620 |
| 108 | Ga0068864_100074257 | 3300005618 | Bacteria | 2967 |
| 109 | Ga0068864_100356289 | 3300005618 | Bacteria | 1382 |
| 110 | Ga0068866_10010482 | 3300005718 | Bacteria | 3976 |
| 111 | Ga0068861_100226635 | 3300005719 | Bacteria | 1583 |
| 112 | Ga0068851_10020004 | 3300005834 | Bacteria | 3238 |
| 113 | Ga0068870_10007640 | 3300005840 | Bacteria | 4834 |
| 114 | Ga0068870_10240846 | 3300005840 | Bacteria | 1117 |
| 115 | Ga0068870_10258958 | 3300005840 | Bacteria | 1082 |
| 116 | Ga0068863_100017575 | 3300005841 | Bacteria | 6852 |
| 117 | Ga0068863_100043928 | 3300005841 | Bacteria | 4242 |
| 118 | Ga0068863_100148362 | 3300005841 | Bacteria | 2244 |
| 119 | Ga0068863_100232372 | 3300005841 | Bacteria | 1779 |
| 120 | Ga0068863_100337925 | 3300005841 | Bacteria | 1465 |
| 121 | Ga0068858_100010410 | 3300005842 | Bacteria | 8811 |
| 122 | Ga0068858_100253837 | 3300005842 | Unclassified | 1671 |
| 123 | Ga0068858_100513849 | 3300005842 | Bacteria | 1158 |
| 124 | Ga0068860_100051034 | 3300005843 | Bacteria | 3937 |
| 125 | Ga0068862_100411550 | 3300005844 | Bacteria | 1267 |
| 126 | Ga0075368_10077886 | 3300006042 | Bacteria | 1346 |
| 127 | Ga0075363_100080062 | 3300006048 | Bacteria | 1786 |
| 128 | Ga0075364_10010452 | 3300006051 | Bacteria | 5607 |
| 129 | Ga0075364_10268347 | 3300006051 | Bacteria | 1160 |
| 130 | Ga0075367_10012156 | 3300006178 | Bacteria | 4579 |
| 131 | Ga0075367_10050766 | 3300006178 | Bacteria | 2450 |
| 132 | Ga0075367_10136565 | 3300006178 | Bacteria | 1517 |
| 133 | Ga0075367_10393134 | 3300006178 | Bacteria | 877 |
| 134 | Ga0075366_10020009 | 3300006195 | Bacteria | 3880 |
| 135 | Ga0075366_10047310 | 3300006195 | Bacteria | 2550 |
| 136 | Ga0075366_10055824 | 3300006195 | Bacteria | 2346 |
| 137 | Ga0075366_10086780 | 3300006195 | Bacteria | 1872 |
| 138 | Ga0097621_100006038 | 3300006237 | Bacteria | 8561 |
| 139 | Ga0097621_100480682 | 3300006237 | Bacteria | 1123 |
| 140 | Ga0075370_10063419 | 3300006353 | Bacteria | 2107 |
| 141 | Ga0068871_100030366 | 3300006358 | Bacteria | 4255 |
| 142 | Ga0068871_100066161 | 3300006358 | Bacteria | 2962 |
| 143 | Ga0075428_100012887 | 3300006844 | Bacteria | 9302 |
| 144 | Ga0075428_100023405 | 3300006844 | Bacteria | 6836 |
| 145 | Ga0075428_100032736 | 3300006844 | Bacteria | 5742 |
| 146 | Ga0075428_100049483 | 3300006844 | Bacteria | 4611 |
| 147 | Ga0075428_100563335 | 3300006844 | Bacteria | 1218 |
| 148 | Ga0075430_100089459 | 3300006846 | Bacteria | 2576 |
| 149 | Ga0075431_100008709 | 3300006847 | Bacteria | 10166 |
| 150 | Ga0075431_100174073 | 3300006847 | Bacteria | 2211 |
| 151 | Ga0075433_10000616 | 3300006852 | Bacteria | 23761 |
| 152 | Ga0075433_10002832 | 3300006852 | Bacteria | 13274 |
| 153 | Ga0075433_10023143 | 3300006852 | Bacteria | 5226 |
| 154 | Ga0075433_10053391 | 3300006852 | Bacteria | 3523 |
| 155 | Ga0075433_10160483 | 3300006852 | Bacteria | 2001 |
| 156 | Ga0075433_10227225 | 3300006852 | Bacteria | 1658 |
| 157 | Ga0075433_10412649 | 3300006852 | Bacteria | 1191 |
| 158 | Ga0075434_100000950 | 3300006871 | Bacteria | 23336 |
| 159 | Ga0075434_100011925 | 3300006871 | Bacteria | 8221 |
| 160 | Ga0075429_100077033 | 3300006880 | Bacteria | 2905 |
| 161 | Ga0075429_100220407 | 3300006880 | Unclassified | 1662 |
| 162 | Ga0068865_100004420 | 3300006881 | Bacteria | 8478 |
| 163 | Ga0097620_100076741 | 3300006931 | Bacteria | 3382 |
| 164 | Ga0097620_100151942 | 3300006931 | Bacteria | 2391 |
| 165 | Ga0097620_100174223 | 3300006931 | Bacteria | 2233 |
| 166 | Ga0097620_100355788 | 3300006931 | Bacteria | 1559 |
| 167 | Ga0097620_100477710 | 3300006931 | Unclassified | 1342 |
| 168 | Ga0111539_10000956 | 3300009094 | Bacteria | 37902 |
| 169 | Ga0111539_10015035 | 3300009094 | Bacteria | 9646 |
| 170 | Ga0111539_10040969 | 3300009094 | Bacteria | 5571 |
| 171 | Ga0111539_10054729 | 3300009094 | Bacteria | 4746 |
| 172 | Ga0111539_10072499 | 3300009094 | Bacteria | 4061 |
| 173 | Ga0111539_10121450 | 3300009094 | Bacteria | 3061 |
| 174 | Ga0111539_10441637 | 3300009094 | Bacteria | 1515 |
| 175 | Ga0111539_10531274 | 3300009094 | Bacteria | 1370 |
| 176 | Ga0105245_10840267 | 3300009098 | Bacteria | 958 |
| 177 | Ga0105247_10015861 | 3300009101 | Bacteria | 4511 |
| 178 | Ga0114129_10024087 | 3300009147 | Bacteria | 8625 |
| 179 | Ga0114129_10123446 | 3300009147 | Bacteria | 3562 |
| 180 | Ga0114129_10158300 | 3300009147 | Bacteria | 3096 |
| 181 | Ga0114129_10346089 | 3300009147 | Bacteria | 1970 |
| 182 | Ga0114129_10568355 | 3300009147 | Bacteria | 1473 |
| 183 | Ga0105243_10010632 | 3300009148 | Bacteria | 6982 |
| 184 | Ga0105243_10390594 | 3300009148 | Bacteria | 1290 |
| 185 | Ga0105243_10547824 | 3300009148 | Bacteria | 1105 |
| 186 | Ga0105242_10022081 | 3300009176 | Bacteria | 5001 |
| 187 | Ga0105248_10004704 | 3300009177 | Bacteria | 15098 |
| 188 | Ga0105248_10047080 | 3300009177 | Bacteria | 4835 |
| 189 | Ga0105248_10170667 | 3300009177 | Bacteria | 2451 |
| 190 | Ga0105248_10185305 | 3300009177 | Bacteria | 2346 |
| 191 | Ga0105248_10313065 | 3300009177 | Bacteria | 1768 |
| 192 | Ga0105248_10437129 | 3300009177 | Bacteria | 1474 |
| 193 | Ga0105248_10705365 | 3300009177 | Bacteria | 1138 |
| 194 | Ga0105238_10055307 | 3300009551 | Bacteria | 3984 |
| 195 | Ga0105238_10749634 | 3300009551 | Bacteria | 990 |
| 196 | Ga0105249_10020467 | 3300009553 | Bacteria | 5915 |
| 197 | Ga0105249_10193009 | 3300009553 | Bacteria | 1989 |
| 198 | Ga0105249_10283028 | 3300009553 | Unclassified | 1657 |
| 199 | Ga0105249_10432073 | 3300009553 | Bacteria | 1353 |
| 200 | Ga0163162_10002123 | 3300013306 | Bacteria | 18627 |
| 201 | Ga0157375_10054175 | 3300013308 | Bacteria | 3950 |
| 202 | Ga0157375_10463845 | 3300013308 | Bacteria | 1432 |
| 203 | Ga0163163_10003461 | 3300014325 | Bacteria | 13417 |
| 204 | Ga0163163_10008634 | 3300014325 | Bacteria | 9061 |
| 205 | Ga0163163_10034264 | 3300014325 | Unclassified | 4916 |
| 206 | Ga0163163_10053071 | 3300014325 | Bacteria | 4001 |
| 207 | Ga0163163_10066888 | 3300014325 | Bacteria | 3571 |
| 208 | Ga0163163_10070834 | 3300014325 | Bacteria | 3473 |
| 209 | Ga0163163_10110392 | 3300014325 | Bacteria | 2778 |
| 210 | Ga0163163_10785944 | 3300014325 | Bacteria | 1015 |
| 211 | Ga0157380_10003839 | 3300014326 | Bacteria | 10350 |
| 212 | Ga0157380_10004786 | 3300014326 | Bacteria | 9432 |
| 213 | Ga0157380_10031703 | 3300014326 | Bacteria | 4059 |
| 214 | Ga0157380_10048203 | 3300014326 | Bacteria | 3354 |
| 215 | Ga0157380_10096227 | 3300014326 | Bacteria | 2454 |
| 216 | Ga0157380_10156379 | 3300014326 | Bacteria | 1976 |
| 217 | Ga0157380_10177956 | 3300014326 | Bacteria | 1866 |
| 218 | Ga0157380_10980440 | 3300014326 | Bacteria | 877 |
| 219 | Ga0157377_10006714 | 3300014745 | Bacteria | 5509 |
| 220 | Ga0157377_10059622 | 3300014745 | Bacteria | 2176 |
| 221 | Ga0157379_10016021 | 3300014968 | Bacteria | 6589 |
| 222 | Ga0157376_10089604 | 3300014969 | Bacteria | 2660 |
| 223 | Ga0157376_10771713 | 3300014969 | Bacteria | 972 |
| 224 | Ga0163161_10344680 | 3300017792 | Bacteria | 1183 |
| 225 | Ga0207656_10029559 | 3300025321 | Bacteria | 2258 |
| 226 | Ga0207682_10012564 | 3300025893 | Bacteria | 3305 |
| 227 | Ga0207682_10038361 | 3300025893 | Bacteria | 1943 |
| 228 | Ga0207682_10048811 | 3300025893 | Bacteria | 1746 |
| 229 | Ga0207642_10130147 | 3300025899 | Bacteria | 1312 |
| 230 | Ga0207710_10009266 | 3300025900 | Bacteria | 4140 |
| 231 | Ga0207688_10046157 | 3300025901 | Unclassified | 2432 |
| 232 | Ga0207680_10046279 | 3300025903 | Bacteria | 2571 |
| 233 | Ga0207645_10007138 | 3300025907 | Bacteria | 7932 |
| 234 | Ga0207643_10025085 | 3300025908 | Bacteria | 3294 |
| 235 | Ga0207643_10046636 | 3300025908 | Bacteria | 2450 |
| 236 | Ga0207643_10072847 | 3300025908 | Bacteria | 1979 |
| 237 | Ga0207684_10478778 | 3300025910 | Bacteria | 1068 |
| 238 | Ga0207663_10000002 | 3300025916 | Bacteria | 534155 |
| 239 | Ga0207663_10311055 | 3300025916 | Bacteria | 1181 |
| 240 | Ga0207662_10122526 | 3300025918 | Unclassified | 1632 |
| 241 | Ga0207662_10237352 | 3300025918 | Unclassified | 1192 |
| 242 | Ga0207649_10043593 | 3300025920 | Bacteria | 2744 |
| 243 | Ga0207681_10004262 | 3300025923 | Bacteria | 8827 |
| 244 | Ga0207681_10028915 | 3300025923 | Bacteria | 3594 |
| 245 | Ga0207681_10138386 | 3300025923 | Bacteria | 1810 |
| 246 | Ga0207694_10006465 | 3300025924 | Bacteria | 8929 |
| 247 | Ga0207650_10094401 | 3300025925 | Bacteria | 2291 |
| 248 | Ga0207650_10163312 | 3300025925 | Bacteria | 1766 |
| 249 | Ga0207650_10293789 | 3300025925 | Bacteria | 1325 |
| 250 | Ga0207659_10010910 | 3300025926 | Bacteria | 5722 |
| 251 | Ga0207659_10032849 | 3300025926 | Bacteria | 3565 |
| 252 | Ga0207659_10260030 | 3300025926 | Unclassified | 1412 |
| 253 | Ga0207659_10268490 | 3300025926 | Bacteria | 1391 |
| 254 | Ga0207659_10322682 | 3300025926 | Bacteria | 1274 |
| 255 | Ga0207644_10036461 | 3300025931 | Bacteria | 3453 |
| 256 | Ga0207644_10157755 | 3300025931 | Bacteria | 1761 |
| 257 | Ga0207686_10025844 | 3300025934 | Bacteria | 3421 |
| 258 | Ga0207709_10130926 | 3300025935 | Bacteria | 1710 |
| 259 | Ga0207670_10489726 | 3300025936 | Bacteria | 997 |
| 260 | Ga0207669_10039206 | 3300025937 | Bacteria | 2735 |
| 261 | Ga0207704_10105469 | 3300025938 | Bacteria | 1890 |
| 262 | Ga0207691_10070024 | 3300025940 | Bacteria | 3168 |
| 263 | Ga0207691_10082017 | 3300025940 | Bacteria | 2898 |
| 264 | Ga0207691_10158598 | 3300025940 | Bacteria | 1986 |
| 265 | Ga0207691_10283027 | 3300025940 | Bacteria | 1427 |
| 266 | Ga0207711_10003308 | 3300025941 | Bacteria | 14001 |
| 267 | Ga0207711_10043722 | 3300025941 | Bacteria | 3823 |
| 268 | Ga0207711_10142863 | 3300025941 | Bacteria | 2155 |
| 269 | Ga0207711_10167713 | 3300025941 | Bacteria | 1991 |
| 270 | Ga0207711_10386779 | 3300025941 | Bacteria | 1298 |
| 271 | Ga0207711_10537204 | 3300025941 | Bacteria | 1090 |
| 272 | Ga0207689_10004974 | 3300025942 | Bacteria | 11973 |
| 273 | Ga0207689_10162999 | 3300025942 | Bacteria | 1837 |
| 274 | Ga0207689_10290366 | 3300025942 | Bacteria | 1354 |
| 275 | Ga0207689_10515083 | 3300025942 | Bacteria | 1003 |
| 276 | Ga0207661_10235043 | 3300025944 | Bacteria | 1624 |
| 277 | Ga0207679_10012999 | 3300025945 | Bacteria | 5446 |
| 278 | Ga0207679_10020320 | 3300025945 | Bacteria | 4480 |
| 279 | Ga0207667_10240370 | 3300025949 | Bacteria | 1853 |
| 280 | Ga0207651_10002533 | 3300025960 | Bacteria | 8726 |
| 281 | Ga0207651_10006040 | 3300025960 | Bacteria | 6289 |
| 282 | Ga0207651_10008493 | 3300025960 | Bacteria | 5551 |
| 283 | Ga0207651_10033218 | 3300025960 | Bacteria | 3325 |
| 284 | Ga0207651_10074122 | 3300025960 | Bacteria | 2423 |
| 285 | Ga0207651_10144644 | 3300025960 | Bacteria | 1842 |
| 286 | Ga0207651_10174713 | 3300025960 | Bacteria | 1698 |
| 287 | Ga0207712_10018694 | 3300025961 | Bacteria | 4516 |
| 288 | Ga0207712_10159238 | 3300025961 | Bacteria | 1752 |
| 289 | Ga0207668_10411918 | 3300025972 | Bacteria | 1145 |
| 290 | Ga0207668_10446150 | 3300025972 | Bacteria | 1103 |
| 291 | Ga0207640_10054543 | 3300025981 | Bacteria | 2614 |
| 292 | Ga0207640_10497231 | 3300025981 | Bacteria | 1015 |
| 293 | Ga0207658_10028631 | 3300025986 | Bacteria | 3925 |
| 294 | Ga0207658_10092108 | 3300025986 | Bacteria | 2354 |
| 295 | Ga0207677_10002302 | 3300026023 | Bacteria | 10038 |
| 296 | Ga0207703_10011031 | 3300026035 | Bacteria | 7041 |
| 297 | Ga0207639_10127815 | 3300026041 | Unclassified | 2099 |
| 298 | Ga0207678_10449639 | 3300026067 | Bacteria | 1120 |
| 299 | Ga0207678_10595007 | 3300026067 | Bacteria | 969 |
| 300 | Ga0207708_10003942 | 3300026075 | Bacteria | 10923 |
| 301 | Ga0207708_10167572 | 3300026075 | Bacteria | 1738 |
| 302 | Ga0207641_10029918 | 3300026088 | Bacteria | 4506 |
| 303 | Ga0207641_10064096 | 3300026088 | Bacteria | 3140 |
| 304 | Ga0207641_10090217 | 3300026088 | Bacteria | 2680 |
| 305 | Ga0207641_10264089 | 3300026088 | Bacteria | 1613 |
| 306 | Ga0207641_10320941 | 3300026088 | Unclassified | 1469 |
| 307 | Ga0207641_10653469 | 3300026088 | Bacteria | 1033 |
| 308 | Ga0207648_10000274 | 3300026089 | Bacteria | 55950 |
| 309 | Ga0207648_10189073 | 3300026089 | Bacteria | 1824 |
| 310 | Ga0207676_10003093 | 3300026095 | Bacteria | 11869 |
| 311 | Ga0207676_10063182 | 3300026095 | Bacteria | 2940 |
| 312 | Ga0207676_10295888 | 3300026095 | Bacteria | 1476 |
| 313 | Ga0207674_10245443 | 3300026116 | Bacteria | 1738 |
| 314 | Ga0207675_100066540 | 3300026118 | Bacteria | 3369 |
| 315 | Ga0207675_100406164 | 3300026118 | Bacteria | 1343 |
| 316 | Ga0207675_100423166 | 3300026118 | Bacteria | 1316 |
| 317 | Ga0207683_10091034 | 3300026121 | Bacteria | 2717 |
| 318 | Ga0207683_10116027 | 3300026121 | Bacteria | 2400 |
| 319 | Ga0207683_10173241 | 3300026121 | Bacteria | 1955 |
| 320 | Ga0207683_10483281 | 3300026121 | Unclassified | 1143 |
| 321 | Ga0209983_1019940 | 3300027665 | Unclassified | 1396 |
| 322 | Ga0209813_10039529 | 3300027866 | Bacteria | 1430 |
| 323 | Ga0207428_10015673 | 3300027907 | Bacteria | 6549 |
| 324 | Ga0207428_10098935 | 3300027907 | Unclassified | 2256 |
| 325 | Ga0207428_10116443 | 3300027907 | Bacteria | 2052 |
| 326 | Ga0207428_10180078 | 3300027907 | Bacteria | 1597 |
| 327 | Ga0268266_10093865 | 3300028379 | Bacteria | 2633 |
| 328 | Ga0268265_10094562 | 3300028380 | Bacteria | 2397 |
| 329 | Ga0268265_10162974 | 3300028380 | Bacteria | 1897 |
| 330 | Ga0268265_10262739 | 3300028380 | Bacteria | 1536 |
| 331 | Ga0268265_10371273 | 3300028380 | Bacteria | 1313 |
| 332 | Ga0268264_10114205 | 3300028381 | Bacteria | 2370 |
| 333 | Ga0265319_1100006 | 3300028563 | Bacteria | 911 |
| 334 | Ga0265334_10031884 | 3300028573 | Bacteria | 2104 |
| 335 | Ga0265338_10000899 | 3300028800 | Bacteria | 49992 |
| 336 | Ga0265338_10002345 | 3300028800 | Bacteria | 28610 |
| 337 | Ga0265338_10305970 | 3300028800 | Bacteria | 1154 |
| 338 | Ga0265330_10020430 | 3300031235 | Bacteria | 3025 |
| 339 | Ga0265330_10028907 | 3300031235 | Bacteria | 2495 |
| 340 | Ga0265332_10000169 | 3300031238 | Bacteria | 53146 |
| 341 | Ga0265320_10019909 | 3300031240 | Bacteria | 3653 |
| 342 | Ga0265320_10130245 | 3300031240 | Bacteria | 1143 |
| 343 | Ga0265320_10156279 | 3300031240 | Bacteria | 1028 |
| 344 | Ga0265329_10002408 | 3300031242 | Bacteria | 8487 |
| 345 | Ga0265329_10006440 | 3300031242 | Bacteria | 4657 |
| 346 | Ga0265331_10000117 | 3300031250 | Bacteria | 104134 |
| 347 | Ga0265331_10092562 | 3300031250 | Bacteria | 1396 |
| 348 | Ga0265316_10000031 | 3300031344 | Bacteria | 161451 |
| 349 | Ga0265314_10000183 | 3300031711 | Bacteria | 92559 |
| 350 | Ga0265342_10000869 | 3300031712 | Bacteria | 30180 |
| 351 | Ga0307413_10552074 | 3300031824 | Bacteria | 935 |
| 352 | Ga0307412_10331496 | 3300031911 | Bacteria | 1215 |
| 353 | Ga0307409_100266318 | 3300031995 | Bacteria | 1576 |
| 354 | Ga0307409_100598168 | 3300031995 | Bacteria | 1090 |
| 355 | Ga0373937_0124198 | 3300036401 | Bacteria | 2407 |
| 356 | Ga0439435_0002496 | 3300042436 | Bacteria | 3668 |
| 357 | Ga0451577_0890467 | 3300042876 | Archaea | 802 |
| 358 | Ga0453684_0000030 | 3300044712 | Bacteria | 752725 |
| 359 | Ga0453684_0117240 | 3300044712 | Archaea | 3223 |
| 360 | Ga0453684_0229780 | 3300044712 | Bacteria | 2142 |
| 361 | Ga0451576_0192592 | 3300045051 | Bacteria | 2130 |
| 362 | Ga0451576_0458970 | 3300045051 | Unclassified | 1338 |
| 363 | Ga0495592_0012002 | 3300046454 | Bacteria | 6566 |
| 364 | Ga0495629_0042837 | 3300046459 | Unclassified | 3180 |
| 365 | Ga0495582_0095458 | 3300046473 | Bacteria | 1661 |
| 366 | Ga0495608_0093361 | 3300046511 | Unclassified | 1944 |
| 367 | Ga0495643_0002635 | 3300046522 | Bacteria | 13919 |
| 368 | Ga0495586_0134641 | 3300046535 | Bacteria | 1385 |
| 369 | Ga0495598_0034065 | 3300046537 | Bacteria | 1449 |
| 370 | Ga0495667_0002634 | 3300046559 | Bacteria | 11984 |
| 371 | Ga0495599_0028904 | 3300046678 | Bacteria | 3474 |
| 372 | Ga0495658_0101995 | 3300046683 | Bacteria | 1714 |
| 373 | Ga0495658_0118661 | 3300046683 | Unclassified | 1598 |
| 374 | Ga0495613_0033742 | 3300046689 | Unclassified | 3801 |
| 375 | Ga0495670_0117041 | 3300046691 | Bacteria | 1383 |
| 376 | Ga0495672_0135602 | 3300047320 | Bacteria | 1291 |
| 377 | Ga0495684_0112631 | 3300047471 | Unclassified | 2052 |
| 378 | Ga0495684_0142035 | 3300047471 | Unclassified | 1800 |
| 379 | Ga0496104_0214586 | 3300048907 | Bacteria | 1836 |
| 380 | Ga0496105_0125782 | 3300048908 | Bacteria | 2113 |
| 381 | Ga0496108_0025999 | 3300048911 | Bacteria | 4828 |
| 382 | Ga0496109_0027877 | 3300048912 | Bacteria | 5048 |
| 383 | Ga0496109_0140809 | 3300048912 | Bacteria | 2255 |
| 384 | Ga0496110_0052588 | 3300048913 | Bacteria | 3579 |
| 385 | Ga0496111_0127354 | 3300048914 | Bacteria | 1883 |
| 386 | Ga0496112_0009274 | 3300048915 | Bacteria | 8848 |
| 387 | Ga0496112_0061082 | 3300048915 | Bacteria | 3714 |
| 388 | Ga0496113_0116033 | 3300048916 | Bacteria | 2089 |
| 389 | Ga0496114_0216166 | 3300048917 | Unclassified | 1682 |
| 390 | Ga0496114_0655742 | 3300048917 | Unclassified | 923 |
| 391 | Ga0496121_0283418 | 3300048924 | Bacteria | 1132 |
| 392 | Ga0496122_0089455 | 3300048925 | Bacteria | 2105 |
| 393 | Ga0501032_0005741 | 3300049569 | Bacteria | 9179 |
| 394 | Ga0501033_0102324 | 3300049570 | Bacteria | 2089 |
| 395 | Ga0501033_0128732 | 3300049570 | Bacteria | 1835 |
| 396 | Ga0501034_0009700 | 3300049571 | Bacteria | 10067 |
| 397 | Ga0501034_0031291 | 3300049571 | Bacteria | 5405 |
| 398 | Ga0501034_0050944 | 3300049571 | Bacteria | 4175 |
| 399 | Ga0501034_0101760 | 3300049571 | Bacteria | 2866 |
| 400 | Ga0501034_0114497 | 3300049571 | Bacteria | 2685 |
| 401 | Ga0501034_0567918 | 3300049571 | Bacteria | 1042 |
| 402 | Ga0501036_0217066 | 3300049572 | Bacteria | 1606 |
| 403 | Ga0501037_0000493 | 3300049573 | Bacteria | 31918 |
| 404 | Ga0501037_0007484 | 3300049573 | Unclassified | 7991 |
| 405 | Ga0501037_0440734 | 3300049573 | Bacteria | 889 |
| 406 | Ga0501038_0036850 | 3300049574 | Bacteria | 4292 |
| 407 | Ga0501038_0038584 | 3300049574 | Bacteria | 4182 |
| 408 | Ga0501038_0398585 | 3300049574 | Bacteria | 1065 |
| 409 | Ga0501039_0206282 | 3300049575 | Unclassified | 1545 |
| 410 | Ga0501040_0020833 | 3300049576 | Bacteria | 4372 |
| 411 | Ga0501041_0003239 | 3300049577 | Bacteria | 9359 |
| 412 | Ga0501043_0000292 | 3300049579 | Bacteria | 45250 |
| 413 | Ga0501043_0023533 | 3300049579 | Unclassified | 4832 |
| 414 | Ga0501046_0035788 | 3300049580 | Bacteria | 3999 |
| 415 | Ga0501046_0163667 | 3300049580 | Bacteria | 1672 |
| 416 | Ga0501047_0032682 | 3300049581 | Bacteria | 5025 |
| 417 | Ga0501047_0044854 | 3300049581 | Unclassified | 4273 |
| 418 | Ga0501047_0306890 | 3300049581 | Bacteria | 1428 |
| 419 | Ga0501048_0125012 | 3300049582 | Bacteria | 1818 |
| 420 | Ga0501067_0017128 | 3300049583 | Unclassified | 4004 |
| 421 | Ga0501071_0081804 | 3300049587 | Bacteria | 2364 |
| 422 | Ga0501071_0133707 | 3300049587 | Bacteria | 1844 |
| 423 | Ga0501072_0285657 | 3300049588 | Bacteria | 1312 |
| 424 | Ga0501073_0000001 | 3300049589 | Bacteria | 677932 |
| 425 | Ga0501073_0103784 | 3300049589 | Bacteria | 1973 |
| 426 | Ga0501074_0044650 | 3300049590 | Unclassified | 3207 |
| 427 | Ga0501075_0100957 | 3300049591 | Bacteria | 2191 |
| 428 | Ga0501077_0170995 | 3300049593 | Bacteria | 1381 |
| 429 | Ga0501077_0277684 | 3300049593 | Bacteria | 1066 |
| 430 | Ga0501079_0009999 | 3300049741 | Bacteria | 7202 |
| 431 | Ga0501079_0104902 | 3300049741 | Unclassified | 2193 |
| 432 | Ga0501080_0000757 | 3300049742 | Bacteria | 26177 |
| 433 | Ga0501081_0046935 | 3300049743 | Bacteria | 2970 |
| 434 | Ga0501081_0166911 | 3300049743 | Bacteria | 1588 |
| 435 | Ga0501083_0060676 | 3300049744 | Unclassified | 2526 |
| 436 | Ga0501083_0100363 | 3300049744 | Bacteria | 1909 |
| 437 | Ga0501044_0004285 | 3300049823 | Bacteria | 16001 |
| 438 | Ga0501044_0136560 | 3300049823 | Bacteria | 2443 |
| 439 | Ga0501044_0292091 | 3300049823 | Bacteria | 1561 |
| 440 | Ga0501045_0209837 | 3300049824 | Bacteria | 1451 |
| 441 | Ga0501045_0579770 | 3300049824 | Bacteria | 831 |
| 442 | nmdc:mga03n38_119490_c1 | 3300050490 | Bacteria | 1293 |
| 443 | nmdc:mga00v17_476534_c1 | 3300050491 | Bacteria | 810 |
| 444 | nmdc:mga00v17_63719_c1 | 3300050491 | Bacteria | 2271 |
| 445 | nmdc:mga0k408_116211_c1 | 3300050493 | Bacteria | 1583 |
| 446 | nmdc:mga0k408_208747_c1 | 3300050493 | Bacteria | 1166 |
| 447 | nmdc:mga0k408_27956_c1 | 3300050493 | Bacteria | 3205 |
| 448 | nmdc:mga0k408_57524_c1 | 3300050493 | Bacteria | 2257 |
| 449 | nmdc:mga06z11_31964_c1 | 3300050494 | Bacteria | 2563 |
| 450 | nmdc:mga06z11_37067_c1 | 3300050494 | Bacteria | 2412 |
| 451 | nmdc:mga06z11_43572_c1 | 3300050494 | Bacteria | 2259 |
| 452 | nmdc:mga06z11_81859_c1 | 3300050494 | Bacteria | 1734 |
| 453 | nmdc:mga07m45_22763_c1 | 3300050496 | Bacteria | 3423 |
| 454 | nmdc:mga07m45_4492_c1 | 3300050496 | Bacteria | 6828 |
| 455 | nmdc:mga05p37_153730_c1 | 3300050507 | Bacteria | 2813 |
| 456 | nmdc:mga05p37_44098_c1 | 3300050507 | Bacteria | 5487 |
| 457 | nmdc:mga05p37_51832_c1 | 3300050507 | Bacteria | 5046 |
| 458 | nmdc:mga05p37_92914_c1 | 3300050507 | Unclassified | 3718 |
| 459 | nmdc:mga0qj67_204050_c1 | 3300050509 | Bacteria | 1606 |
| 460 | nmdc:mga0qj67_243228_c1 | 3300050509 | Bacteria | 1460 |
| 461 | nmdc:mga06r32_207622_c1 | 3300050510 | Bacteria | 1947 |
| 462 | nmdc:mga06r32_248141_c1 | 3300050510 | Bacteria | 1768 |
| 463 | nmdc:mga06r32_313749_c1 | 3300050510 | Bacteria | 1554 |
| 464 | nmdc:mga06r32_573884_c1 | 3300050510 | Bacteria | 1100 |
| 465 | nmdc:mga08y16_172153_c1 | 3300050511 | Bacteria | 2249 |
| 466 | nmdc:mga08y16_214790_c1 | 3300050511 | Bacteria | 1992 |
| 467 | nmdc:mga08y16_37257_c1 | 3300050511 | Bacteria | 5109 |
| 468 | nmdc:mga08y16_44216_c1 | 3300050511 | Bacteria | 4666 |
| 469 | nmdc:mga08y16_450644_c1 | 3300050511 | Bacteria | 1312 |
| 470 | nmdc:mga08y16_64083_c1 | 3300050511 | Bacteria | 3838 |
| 471 | nmdc:mga08y16_79064_c1 | 3300050511 | Bacteria | 3428 |
| 472 | nmdc:mga08y16_82294_c1 | 3300050511 | Unclassified | 3356 |
| 473 | nmdc:mga0n895_30096_c1 | 3300050512 | Bacteria | 5185 |
| 474 | nmdc:mga0n895_321586_c1 | 3300050512 | Bacteria | 1568 |
| 475 | nmdc:mga0n895_429_c1 | 3300050512 | Bacteria | 28206 |
| 476 | nmdc:mga0n895_660568_c1 | 3300050512 | Bacteria | 1043 |
| 477 | nmdc:mga0a205_114198_c1 | 3300050515 | Bacteria | 2599 |
| 478 | nmdc:mga0a205_368083_c1 | 3300050515 | Bacteria | 1303 |
| 479 | nmdc:mga0a205_53190_c1 | 3300050515 | Unclassified | 3908 |
| 480 | nmdc:mga0a205_58556_c1 | 3300050515 | Unclassified | 3721 |
| 481 | nmdc:mga0a205_867_c1 | 3300050515 | Bacteria | 24788 |
| 482 | Ga0500568_0004002 | 3300053139 | Bacteria | 7996 |
| 483 | Ga0501084_0704813 | 3300054114 | Bacteria | 851 |
| 484 | Ga0530510_0242024 | 3300061734 | Bacteria | 1343 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0163667 | Ga0501046_0163667_65_694 | 192 |
| 2 | 3300054114 | Ga0501084_0704813 | Ga0501084_0704813_182_811 | 192 |
| 3 | 3300048917 | Ga0496114_0216166 | Ga0496114_0216166_984_1583 | 193 |
| 4 | 3300049575 | Ga0501039_0206282 | Ga0501039_0206282_267_947 | 204 |
| 5 | 3300049579 | Ga0501043_0023533 | Ga0501043_0023533_2905_3585 | 204 |
| 6 | 3300049581 | Ga0501047_0044854 | Ga0501047_0044854_1183_1863 | 204 |
| 7 | 3300049742 | Ga0501080_0000757 | Ga0501080_0000757_15533_16213 | 204 |
| 8 | 3300049571 | Ga0501034_0009700 | Ga0501034_0009700_5240_5920 | 205 |
| 9 | 3300049573 | Ga0501037_0007484 | Ga0501037_0007484_4188_4868 | 205 |
| 10 | 3300049583 | Ga0501067_0017128 | Ga0501067_0017128_668_1348 | 205 |
| 11 | 3300049589 | Ga0501073_0000001 | Ga0501073_0000001_140162_140842 | 205 |
| 12 | 3300049590 | Ga0501074_0044650 | Ga0501074_0044650_1973_2653 | 205 |
| 13 | 3300049744 | Ga0501083_0060676 | Ga0501083_0060676_190_870 | 205 |
| 14 | 3300026121 | Ga0207683_10483281 | Ga0207683_104832812 | 212 |
| 15 | 3300005335 | Ga0070666_10008275 | Ga0070666_100082753 | 215 |
| 16 | 3300005338 | Ga0068868_100000724 | Ga0068868_10000072410 | 215 |
| 17 | 3300005344 | Ga0070661_100005546 | Ga0070661_1000055465 | 215 |
| 18 | 3300005544 | Ga0070686_100019905 | Ga0070686_1000199055 | 215 |
| 19 | 3300005617 | Ga0068859_100477659 | Ga0068859_1004776592 | 215 |
| 20 | 3300005618 | Ga0068864_100011330 | Ga0068864_1000113302 | 215 |
| 21 | 3300005841 | Ga0068863_100017575 | Ga0068863_1000175757 | 215 |
| 22 | 3300006931 | Ga0097620_100477710 | Ga0097620_1004777101 | 215 |
| 23 | 3300009177 | Ga0105248_10004704 | Ga0105248_1000470416 | 215 |
| 24 | 3300013306 | Ga0163162_10002123 | Ga0163162_1000212316 | 215 |
| 25 | 3300013308 | Ga0157375_10054175 | Ga0157375_100541753 | 215 |
| 26 | 3300014325 | Ga0163163_10070834 | Ga0163163_100708343 | 215 |
| 27 | 3300025941 | Ga0207711_10003308 | Ga0207711_1000330815 | 215 |
| 28 | 3300025945 | Ga0207679_10020320 | Ga0207679_100203205 | 215 |
| 29 | 3300025960 | Ga0207651_10006040 | Ga0207651_100060402 | 215 |
| 30 | 3300026023 | Ga0207677_10002302 | Ga0207677_100023028 | 215 |
| 31 | 3300026088 | Ga0207641_10064096 | Ga0207641_100640962 | 215 |
| 32 | 3300042876 | Ga0451577_0890467 | Ga0451577_0890467_39_713 | 216 |
| 33 | 3300044712 | Ga0453684_0117240 | Ga0453684_0117240_2516_3190 | 216 |
| 34 | 3300048917 | Ga0496114_0655742 | Ga0496114_0655742_17_688 | 217 |
| 35 | 3300005330 | Ga0070690_100005245 | Ga0070690_1000052453 | 218 |
| 36 | 3300005331 | Ga0070670_100000207 | Ga0070670_10000020712 | 218 |
| 37 | 3300005367 | Ga0070667_100008716 | Ga0070667_1000087166 | 218 |
| 38 | 3300005535 | Ga0070684_100036749 | Ga0070684_1000367494 | 218 |
| 39 | 3300005563 | Ga0068855_100018735 | Ga0068855_1000187359 | 218 |
| 40 | 3300005564 | Ga0070664_100001854 | Ga0070664_10000185413 | 218 |
| 41 | 3300025903 | Ga0207680_10046279 | Ga0207680_100462792 | 218 |
| 42 | 3300025949 | Ga0207667_10240370 | Ga0207667_102403702 | 218 |
| 43 | 3300025986 | Ga0207658_10028631 | Ga0207658_100286311 | 218 |
| 44 | 3300005441 | Ga0070700_100119250 | Ga0070700_1001192503 | 219 |
| 45 | 3300005539 | Ga0068853_100157775 | Ga0068853_1001577752 | 219 |
| 46 | 3300005544 | Ga0070686_100411375 | Ga0070686_1004113751 | 219 |
| 47 | 3300026041 | Ga0207639_10127815 | Ga0207639_101278152 | 219 |
| 48 | 3300028800 | Ga0265338_10000899 | Ga0265338_1000089931 | 223 |
| 49 | 3300005439 | Ga0070711_100000355 | Ga0070711_10000035527 | 224 |
| 50 | 3300025916 | Ga0207663_10000002 | Ga0207663_10000002576 | 225 |
| 51 | 3300049571 | Ga0501034_0031291 | Ga0501034_0031291_1168_1902 | 226 |
| 52 | 3300028563 | Ga0265319_1100006 | Ga0265319_11000061 | 227 |
| 53 | 3300028573 | Ga0265334_10031884 | Ga0265334_100318841 | 227 |
| 54 | 3300031240 | Ga0265320_10130245 | Ga0265320_101302451 | 227 |
| 55 | 3300049570 | Ga0501033_0102324 | Ga0501033_0102324_649_1392 | 227 |
| 56 | 3300049571 | Ga0501034_0114497 | Ga0501034_0114497_1497_2240 | 227 |
| 57 | 3300049580 | Ga0501046_0035788 | Ga0501046_0035788_2661_3404 | 227 |
| 58 | 3300049589 | Ga0501073_0103784 | Ga0501073_0103784_708_1451 | 227 |
| 59 | 3300049823 | Ga0501044_0136560 | Ga0501044_0136560_335_1078 | 227 |
| 60 | 3300014326 | Ga0157380_10177956 | Ga0157380_101779563 | 228 |
| 61 | 3300005842 | Ga0068858_100253837 | Ga0068858_1002538372 | 230 |
| 62 | 3300031240 | Ga0265320_10156279 | Ga0265320_101562792 | 230 |
| 63 | 3300053139 | Ga0500568_0004002 | Ga0500568_0004002_2709_3449 | 230 |
| 64 | 3300005466 | Ga0070685_10158606 | Ga0070685_101586062 | 231 |
| 65 | 3300025926 | Ga0207659_10260030 | Ga0207659_102600302 | 231 |
| 66 | 3300049573 | Ga0501037_0440734 | Ga0501037_0440734_66_809 | 231 |
| 67 | 3300049574 | Ga0501038_0038584 | Ga0501038_0038584_165_908 | 231 |
| 68 | 3300006042 | Ga0075368_10077886 | Ga0075368_100778861 | 232 |
| 69 | 3300006178 | Ga0075367_10050766 | Ga0075367_100507662 | 232 |
| 70 | 3300028800 | Ga0265338_10002345 | Ga0265338_1000234523 | 232 |
| 71 | 3300050491 | nmdc:mga00v17_476534_c1 | nmdc:mga00v17_476534_c1_15_761 | 232 |
| 72 | 3300050494 | nmdc:mga06z11_37067_c1 | nmdc:mga06z11_37067_c1_1128_1874 | 232 |
| 73 | 3300006195 | Ga0075366_10055824 | Ga0075366_100558242 | 233 |
| 74 | 3300005290 | Ga0065712_10180367 | Ga0065712_101803671 | 234 |
| 75 | 3300005354 | Ga0070675_100255124 | Ga0070675_1002551242 | 234 |
| 76 | 3300005356 | Ga0070674_100131465 | Ga0070674_1001314652 | 234 |
| 77 | 3300005549 | Ga0070704_100108374 | Ga0070704_1001083742 | 234 |
| 78 | 3300009177 | Ga0105248_10170667 | Ga0105248_101706672 | 234 |
| 79 | 3300025931 | Ga0207644_10157755 | Ga0207644_101577552 | 234 |
| 80 | 3300025940 | Ga0207691_10283027 | Ga0207691_102830272 | 234 |
| 81 | 3300026067 | Ga0207678_10595007 | Ga0207678_105950072 | 234 |
| 82 | 3300044712 | Ga0453684_0000030 | Ga0453684_0000030_383895_384599 | 234 |
| 83 | 3300049571 | Ga0501034_0050944 | Ga0501034_0050944_3003_3740 | 234 |
| 84 | 3300049581 | Ga0501047_0306890 | Ga0501047_0306890_589_1326 | 234 |
| 85 | 3300049823 | Ga0501044_0004285 | Ga0501044_0004285_7757_8494 | 234 |
| 86 | 3300005842 | Ga0068858_100513849 | Ga0068858_1005138491 | 235 |
| 87 | 3300009177 | Ga0105248_10437129 | Ga0105248_104371292 | 235 |
| 88 | 3300025910 | Ga0207684_10478778 | Ga0207684_104787782 | 235 |
| 89 | 3300025926 | Ga0207659_10322682 | Ga0207659_103226822 | 235 |
| 90 | 3300025941 | Ga0207711_10537204 | Ga0207711_105372041 | 235 |
| 91 | 3300048914 | Ga0496111_0127354 | Ga0496111_0127354_625_1350 | 235 |
| 92 | 3300005471 | Ga0070698_100397035 | Ga0070698_1003970352 | 236 |
| 93 | 3300009147 | Ga0114129_10568355 | Ga0114129_105683552 | 236 |
| 94 | 3300026088 | Ga0207641_10653469 | Ga0207641_106534691 | 236 |
| 95 | 3300045051 | Ga0451576_0458970 | Ga0451576_0458970_271_1017 | 236 |
| 96 | 3300049577 | Ga0501041_0003239 | Ga0501041_0003239_4904_5665 | 236 |
| 97 | 3300049587 | Ga0501071_0133707 | Ga0501071_0133707_227_988 | 236 |
| 98 | 3300049744 | Ga0501083_0100363 | Ga0501083_0100363_12_773 | 236 |
| 99 | 3300049824 | Ga0501045_0209837 | Ga0501045_0209837_202_963 | 236 |
| 100 | 3300050507 | nmdc:mga05p37_92914_c1 | nmdc:mga05p37_92914_c1_1627_2352 | 236 |
| 101 | 3300050509 | nmdc:mga0qj67_243228_c1 | nmdc:mga0qj67_243228_c1_605_1330 | 236 |
| 102 | 3300050510 | nmdc:mga06r32_573884_c1 | nmdc:mga06r32_573884_c1_35_763 | 236 |
| 103 | 3300005365 | Ga0070688_100004722 | Ga0070688_1000047227 | 237 |
| 104 | 3300005617 | Ga0068859_100174230 | Ga0068859_1001742305 | 237 |
| 105 | 3300005834 | Ga0068851_10020004 | Ga0068851_100200043 | 237 |
| 106 | 3300006844 | Ga0075428_100023405 | Ga0075428_1000234052 | 237 |
| 107 | 3300006931 | Ga0097620_100174223 | Ga0097620_1001742235 | 237 |
| 108 | 3300009551 | Ga0105238_10055307 | Ga0105238_100553072 | 237 |
| 109 | 3300025321 | Ga0207656_10029559 | Ga0207656_100295593 | 237 |
| 110 | 3300025924 | Ga0207694_10006465 | Ga0207694_100064654 | 237 |
| 111 | 3300031995 | Ga0307409_100266318 | Ga0307409_1002663181 | 237 |
| 112 | 3300049576 | Ga0501040_0020833 | Ga0501040_0020833_878_1642 | 237 |
| 113 | 3300049582 | Ga0501048_0125012 | Ga0501048_0125012_120_884 | 237 |
| 114 | 3300049591 | Ga0501075_0100957 | Ga0501075_0100957_1055_1819 | 237 |
| 115 | 3300049741 | Ga0501079_0009999 | Ga0501079_0009999_3189_3953 | 237 |
| 116 | 3300049743 | Ga0501081_0046935 | Ga0501081_0046935_1048_1812 | 237 |
| 117 | 3300050510 | nmdc:mga06r32_313749_c1 | nmdc:mga06r32_313749_c1_367_1098 | 237 |
| 118 | 3300050511 | nmdc:mga08y16_37257_c1 | nmdc:mga08y16_37257_c1_2529_3260 | 237 |
| 119 | 3300002459 | JGI24751J29686_10003264 | JGI24751J29686_100032642 | 238 |
| 120 | 3300005295 | Ga0065707_10001855 | Ga0065707_100018552 | 238 |
| 121 | 3300005331 | Ga0070670_100471731 | Ga0070670_1004717311 | 238 |
| 122 | 3300005618 | Ga0068864_100001821 | Ga0068864_10000182111 | 238 |
| 123 | 3300005618 | Ga0068864_100049383 | Ga0068864_1000493831 | 238 |
| 124 | 3300005841 | Ga0068863_100337925 | Ga0068863_1003379252 | 238 |
| 125 | 3300006178 | Ga0075367_10012156 | Ga0075367_100121562 | 238 |
| 126 | 3300006195 | Ga0075366_10047310 | Ga0075366_100473103 | 238 |
| 127 | 3300006237 | Ga0097621_100006038 | Ga0097621_1000060383 | 238 |
| 128 | 3300006237 | Ga0097621_100480682 | Ga0097621_1004806821 | 238 |
| 129 | 3300006358 | Ga0068871_100030366 | Ga0068871_1000303662 | 238 |
| 130 | 3300006358 | Ga0068871_100066161 | Ga0068871_1000661612 | 238 |
| 131 | 3300009148 | Ga0105243_10547824 | Ga0105243_105478241 | 238 |
| 132 | 3300009553 | Ga0105249_10283028 | Ga0105249_102830282 | 238 |
| 133 | 3300014325 | Ga0163163_10003461 | Ga0163163_100034615 | 238 |
| 134 | 3300014325 | Ga0163163_10008634 | Ga0163163_100086342 | 238 |
| 135 | 3300014325 | Ga0163163_10034264 | Ga0163163_100342643 | 238 |
| 136 | 3300014969 | Ga0157376_10089604 | Ga0157376_100896042 | 238 |
| 137 | 3300026088 | Ga0207641_10264089 | Ga0207641_102640892 | 238 |
| 138 | 3300026095 | Ga0207676_10003093 | Ga0207676_100030936 | 238 |
| 139 | 3300026095 | Ga0207676_10295888 | Ga0207676_102958881 | 238 |
| 140 | 3300028800 | Ga0265338_10305970 | Ga0265338_103059702 | 238 |
| 141 | 3300046454 | Ga0495592_0012002 | Ga0495592_0012002_901_1647 | 238 |
| 142 | 3300046459 | Ga0495629_0042837 | Ga0495629_0042837_1005_1751 | 238 |
| 143 | 3300046473 | Ga0495582_0095458 | Ga0495582_0095458_812_1558 | 238 |
| 144 | 3300046511 | Ga0495608_0093361 | Ga0495608_0093361_85_831 | 238 |
| 145 | 3300046535 | Ga0495586_0134641 | Ga0495586_0134641_310_1056 | 238 |
| 146 | 3300046559 | Ga0495667_0002634 | Ga0495667_0002634_7102_7848 | 238 |
| 147 | 3300046678 | Ga0495599_0028904 | Ga0495599_0028904_1643_2389 | 238 |
| 148 | 3300046683 | Ga0495658_0118661 | Ga0495658_0118661_202_948 | 238 |
| 149 | 3300046689 | Ga0495613_0033742 | Ga0495613_0033742_2612_3358 | 238 |
| 150 | 3300046691 | Ga0495670_0117041 | Ga0495670_0117041_573_1304 | 238 |
| 151 | 3300047471 | Ga0495684_0112631 | Ga0495684_0112631_79_825 | 238 |
| 152 | 3300047471 | Ga0495684_0142035 | Ga0495684_0142035_778_1524 | 238 |
| 153 | 3300050493 | nmdc:mga0k408_57524_c1 | nmdc:mga0k408_57524_c1_1439_2179 | 238 |
| 154 | 3300050494 | nmdc:mga06z11_43572_c1 | nmdc:mga06z11_43572_c1_1407_2147 | 238 |
| 155 | 3300005290 | Ga0065712_10109964 | Ga0065712_101099641 | 239 |
| 156 | 3300005293 | Ga0065715_10127979 | Ga0065715_101279794 | 239 |
| 157 | 3300005293 | Ga0065715_10137030 | Ga0065715_101370302 | 239 |
| 158 | 3300005331 | Ga0070670_100040123 | Ga0070670_1000401231 | 239 |
| 159 | 3300005334 | Ga0068869_100309937 | Ga0068869_1003099372 | 239 |
| 160 | 3300005335 | Ga0070666_10216613 | Ga0070666_102166132 | 239 |
| 161 | 3300005353 | Ga0070669_100274860 | Ga0070669_1002748601 | 239 |
| 162 | 3300005355 | Ga0070671_100015724 | Ga0070671_1000157245 | 239 |
| 163 | 3300005364 | Ga0070673_100175126 | Ga0070673_1001751262 | 239 |
| 164 | 3300005518 | Ga0070699_100007806 | Ga0070699_1000078065 | 239 |
| 165 | 3300005543 | Ga0070672_100054123 | Ga0070672_1000541233 | 239 |
| 166 | 3300005617 | Ga0068859_100076740 | Ga0068859_1000767402 | 239 |
| 167 | 3300005840 | Ga0068870_10258958 | Ga0068870_102589582 | 239 |
| 168 | 3300005841 | Ga0068863_100232372 | Ga0068863_1002323723 | 239 |
| 169 | 3300005843 | Ga0068860_100051034 | Ga0068860_1000510344 | 239 |
| 170 | 3300006051 | Ga0075364_10010452 | Ga0075364_100104522 | 239 |
| 171 | 3300006852 | Ga0075433_10412649 | Ga0075433_104126492 | 239 |
| 172 | 3300006880 | Ga0075429_100077033 | Ga0075429_1000770332 | 239 |
| 173 | 3300006931 | Ga0097620_100076741 | Ga0097620_1000767413 | 239 |
| 174 | 3300009177 | Ga0105248_10185305 | Ga0105248_101853052 | 239 |
| 175 | 3300009177 | Ga0105248_10313065 | Ga0105248_103130652 | 239 |
| 176 | 3300014326 | Ga0157380_10048203 | Ga0157380_100482034 | 239 |
| 177 | 3300017792 | Ga0163161_10344680 | Ga0163161_103446801 | 239 |
| 178 | 3300025908 | Ga0207643_10072847 | Ga0207643_100728472 | 239 |
| 179 | 3300025923 | Ga0207681_10138386 | Ga0207681_101383862 | 239 |
| 180 | 3300025925 | Ga0207650_10163312 | Ga0207650_101633121 | 239 |
| 181 | 3300025938 | Ga0207704_10105469 | Ga0207704_101054692 | 239 |
| 182 | 3300025940 | Ga0207691_10158598 | Ga0207691_101585982 | 239 |
| 183 | 3300025941 | Ga0207711_10142863 | Ga0207711_101428631 | 239 |
| 184 | 3300025941 | Ga0207711_10167713 | Ga0207711_101677132 | 239 |
| 185 | 3300025942 | Ga0207689_10290366 | Ga0207689_102903662 | 239 |
| 186 | 3300025960 | Ga0207651_10002533 | Ga0207651_100025334 | 239 |
| 187 | 3300028381 | Ga0268264_10114205 | Ga0268264_101142054 | 239 |
| 188 | 3300036401 | Ga0373937_0124198 | Ga0373937_0124198_200_961 | 239 |
| 189 | 3300046522 | Ga0495643_0002635 | Ga0495643_0002635_6234_6971 | 239 |
| 190 | 3300049571 | Ga0501034_0567918 | Ga0501034_0567918_24_767 | 239 |
| 191 | 3300050512 | nmdc:mga0n895_660568_c1 | nmdc:mga0n895_660568_c1_102_836 | 239 |
| 192 | 3300050515 | nmdc:mga0a205_368083_c1 | nmdc:mga0a205_368083_c1_83_817 | 239 |
| 193 | 3300005290 | Ga0065712_10002563 | Ga0065712_100025634 | 240 |
| 194 | 3300005331 | Ga0070670_100066700 | Ga0070670_1000667003 | 240 |
| 195 | 3300005331 | Ga0070670_100142774 | Ga0070670_1001427742 | 240 |
| 196 | 3300005333 | Ga0070677_10174774 | Ga0070677_101747741 | 240 |
| 197 | 3300005340 | Ga0070689_100600335 | Ga0070689_1006003351 | 240 |
| 198 | 3300005343 | Ga0070687_100036490 | Ga0070687_1000364903 | 240 |
| 199 | 3300005347 | Ga0070668_100133777 | Ga0070668_1001337772 | 240 |
| 200 | 3300005355 | Ga0070671_100020344 | Ga0070671_1000203443 | 240 |
| 201 | 3300005356 | Ga0070674_100300634 | Ga0070674_1003006342 | 240 |
| 202 | 3300005356 | Ga0070674_100534295 | Ga0070674_1005342952 | 240 |
| 203 | 3300005365 | Ga0070688_100354483 | Ga0070688_1003544832 | 240 |
| 204 | 3300005365 | Ga0070688_100515234 | Ga0070688_1005152341 | 240 |
| 205 | 3300005548 | Ga0070665_100049526 | Ga0070665_1000495264 | 240 |
| 206 | 3300005564 | Ga0070664_100005981 | Ga0070664_1000059812 | 240 |
| 207 | 3300005617 | Ga0068859_100355806 | Ga0068859_1003558062 | 240 |
| 208 | 3300005618 | Ga0068864_100074257 | Ga0068864_1000742572 | 240 |
| 209 | 3300006852 | Ga0075433_10053391 | Ga0075433_100533912 | 240 |
| 210 | 3300006852 | Ga0075433_10160483 | Ga0075433_101604833 | 240 |
| 211 | 3300006931 | Ga0097620_100355788 | Ga0097620_1003557882 | 240 |
| 212 | 3300009094 | Ga0111539_10121450 | Ga0111539_101214503 | 240 |
| 213 | 3300009551 | Ga0105238_10749634 | Ga0105238_107496342 | 240 |
| 214 | 3300009553 | Ga0105249_10193009 | Ga0105249_101930092 | 240 |
| 215 | 3300014326 | Ga0157380_10156379 | Ga0157380_101563792 | 240 |
| 216 | 3300025908 | Ga0207643_10046636 | Ga0207643_100466362 | 240 |
| 217 | 3300025916 | Ga0207663_10311055 | Ga0207663_103110552 | 240 |
| 218 | 3300025918 | Ga0207662_10122526 | Ga0207662_101225262 | 240 |
| 219 | 3300025918 | Ga0207662_10237352 | Ga0207662_102373522 | 240 |
| 220 | 3300025925 | Ga0207650_10293789 | Ga0207650_102937892 | 240 |
| 221 | 3300025931 | Ga0207644_10036461 | Ga0207644_100364613 | 240 |
| 222 | 3300025936 | Ga0207670_10489726 | Ga0207670_104897262 | 240 |
| 223 | 3300025941 | Ga0207711_10043722 | Ga0207711_100437225 | 240 |
| 224 | 3300025945 | Ga0207679_10012999 | Ga0207679_100129994 | 240 |
| 225 | 3300025961 | Ga0207712_10159238 | Ga0207712_101592382 | 240 |
| 226 | 3300025972 | Ga0207668_10411918 | Ga0207668_104119182 | 240 |
| 227 | 3300026095 | Ga0207676_10063182 | Ga0207676_100631823 | 240 |
| 228 | 3300026118 | Ga0207675_100066540 | Ga0207675_1000665402 | 240 |
| 229 | 3300026121 | Ga0207683_10173241 | Ga0207683_101732412 | 240 |
| 230 | 3300027907 | Ga0207428_10180078 | Ga0207428_101800781 | 240 |
| 231 | 3300028379 | Ga0268266_10093865 | Ga0268266_100938653 | 240 |
| 232 | 3300028380 | Ga0268265_10162974 | Ga0268265_101629742 | 240 |
| 233 | 3300028380 | Ga0268265_10262739 | Ga0268265_102627392 | 240 |
| 234 | 3300048915 | Ga0496112_0009274 | Ga0496112_0009274_3856_4614 | 240 |
| 235 | 3300050511 | nmdc:mga08y16_172153_c1 | nmdc:mga08y16_172153_c1_1087_1818 | 240 |
| 236 | 3300050515 | nmdc:mga0a205_53190_c1 | nmdc:mga0a205_53190_c1_2585_3325 | 240 |
| 237 | 3300005328 | Ga0070676_10062250 | Ga0070676_100622503 | 241 |
| 238 | 3300005329 | Ga0070683_100046357 | Ga0070683_1000463575 | 241 |
| 239 | 3300005331 | Ga0070670_100147277 | Ga0070670_1001472773 | 241 |
| 240 | 3300005334 | Ga0068869_100001813 | Ga0068869_10000181311 | 241 |
| 241 | 3300005334 | Ga0068869_100073865 | Ga0068869_1000738652 | 241 |
| 242 | 3300005334 | Ga0068869_100370306 | Ga0068869_1003703062 | 241 |
| 243 | 3300005338 | Ga0068868_100261093 | Ga0068868_1002610932 | 241 |
| 244 | 3300005344 | Ga0070661_100102461 | Ga0070661_1001024611 | 241 |
| 245 | 3300005353 | Ga0070669_100004878 | Ga0070669_1000048783 | 241 |
| 246 | 3300005353 | Ga0070669_100022830 | Ga0070669_1000228303 | 241 |
| 247 | 3300005354 | Ga0070675_100006639 | Ga0070675_1000066396 | 241 |
| 248 | 3300005364 | Ga0070673_100004578 | Ga0070673_1000045786 | 241 |
| 249 | 3300005366 | Ga0070659_100324443 | Ga0070659_1003244432 | 241 |
| 250 | 3300005367 | Ga0070667_100168191 | Ga0070667_1001681912 | 241 |
| 251 | 3300005438 | Ga0070701_10004006 | Ga0070701_100040064 | 241 |
| 252 | 3300005441 | Ga0070700_100001339 | Ga0070700_10000133912 | 241 |
| 253 | 3300005441 | Ga0070700_100229381 | Ga0070700_1002293812 | 241 |
| 254 | 3300005444 | Ga0070694_100244171 | Ga0070694_1002441712 | 241 |
| 255 | 3300005455 | Ga0070663_100181665 | Ga0070663_1001816653 | 241 |
| 256 | 3300005456 | Ga0070678_100232519 | Ga0070678_1002325192 | 241 |
| 257 | 3300005459 | Ga0068867_100000241 | Ga0068867_10000024131 | 241 |
| 258 | 3300005459 | Ga0068867_100229572 | Ga0068867_1002295722 | 241 |
| 259 | 3300005535 | Ga0070684_100062058 | Ga0070684_1000620583 | 241 |
| 260 | 3300005543 | Ga0070672_100002505 | Ga0070672_1000025053 | 241 |
| 261 | 3300005546 | Ga0070696_100339090 | Ga0070696_1003390902 | 241 |
| 262 | 3300005615 | Ga0070702_100031860 | Ga0070702_1000318602 | 241 |
| 263 | 3300005617 | Ga0068859_100151941 | Ga0068859_1001519412 | 241 |
| 264 | 3300005618 | Ga0068864_100356289 | Ga0068864_1003562891 | 241 |
| 265 | 3300005718 | Ga0068866_10010482 | Ga0068866_100104822 | 241 |
| 266 | 3300005719 | Ga0068861_100226635 | Ga0068861_1002266352 | 241 |
| 267 | 3300005841 | Ga0068863_100148362 | Ga0068863_1001483621 | 241 |
| 268 | 3300005842 | Ga0068858_100010410 | Ga0068858_1000104106 | 241 |
| 269 | 3300005844 | Ga0068862_100411550 | Ga0068862_1004115501 | 241 |
| 270 | 3300006048 | Ga0075363_100080062 | Ga0075363_1000800622 | 241 |
| 271 | 3300006051 | Ga0075364_10268347 | Ga0075364_102683471 | 241 |
| 272 | 3300006178 | Ga0075367_10393134 | Ga0075367_103931342 | 241 |
| 273 | 3300006195 | Ga0075366_10020009 | Ga0075366_100200093 | 241 |
| 274 | 3300006844 | Ga0075428_100049483 | Ga0075428_1000494834 | 241 |
| 275 | 3300006844 | Ga0075428_100563335 | Ga0075428_1005633351 | 241 |
| 276 | 3300006852 | Ga0075433_10227225 | Ga0075433_102272254 | 241 |
| 277 | 3300006881 | Ga0068865_100004420 | Ga0068865_1000044203 | 241 |
| 278 | 3300006931 | Ga0097620_100151942 | Ga0097620_1001519422 | 241 |
| 279 | 3300009094 | Ga0111539_10040969 | Ga0111539_100409695 | 241 |
| 280 | 3300009094 | Ga0111539_10054729 | Ga0111539_100547292 | 241 |
| 281 | 3300009098 | Ga0105245_10840267 | Ga0105245_108402671 | 241 |
| 282 | 3300009101 | Ga0105247_10015861 | Ga0105247_100158612 | 241 |
| 283 | 3300009147 | Ga0114129_10158300 | Ga0114129_101583002 | 241 |
| 284 | 3300009147 | Ga0114129_10346089 | Ga0114129_103460892 | 241 |
| 285 | 3300009148 | Ga0105243_10010632 | Ga0105243_100106324 | 241 |
| 286 | 3300009176 | Ga0105242_10022081 | Ga0105242_100220812 | 241 |
| 287 | 3300009177 | Ga0105248_10705365 | Ga0105248_107053652 | 241 |
| 288 | 3300009553 | Ga0105249_10020467 | Ga0105249_100204675 | 241 |
| 289 | 3300009553 | Ga0105249_10432073 | Ga0105249_104320731 | 241 |
| 290 | 3300014325 | Ga0163163_10053071 | Ga0163163_100530715 | 241 |
| 291 | 3300014325 | Ga0163163_10110392 | Ga0163163_101103922 | 241 |
| 292 | 3300014325 | Ga0163163_10785944 | Ga0163163_107859441 | 241 |
| 293 | 3300014326 | Ga0157380_10004786 | Ga0157380_100047869 | 241 |
| 294 | 3300014326 | Ga0157380_10980440 | Ga0157380_109804401 | 241 |
| 295 | 3300014745 | Ga0157377_10059622 | Ga0157377_100596222 | 241 |
| 296 | 3300014968 | Ga0157379_10016021 | Ga0157379_100160214 | 241 |
| 297 | 3300014969 | Ga0157376_10771713 | Ga0157376_107717131 | 241 |
| 298 | 3300025893 | Ga0207682_10012564 | Ga0207682_100125643 | 241 |
| 299 | 3300025899 | Ga0207642_10130147 | Ga0207642_101301472 | 241 |
| 300 | 3300025900 | Ga0207710_10009266 | Ga0207710_100092662 | 241 |
| 301 | 3300025901 | Ga0207688_10046157 | Ga0207688_100461572 | 241 |
| 302 | 3300025907 | Ga0207645_10007138 | Ga0207645_100071384 | 241 |
| 303 | 3300025920 | Ga0207649_10043593 | Ga0207649_100435932 | 241 |
| 304 | 3300025923 | Ga0207681_10004262 | Ga0207681_100042626 | 241 |
| 305 | 3300025923 | Ga0207681_10028915 | Ga0207681_100289153 | 241 |
| 306 | 3300025934 | Ga0207686_10025844 | Ga0207686_100258442 | 241 |
| 307 | 3300025935 | Ga0207709_10130926 | Ga0207709_101309261 | 241 |
| 308 | 3300025937 | Ga0207669_10039206 | Ga0207669_100392063 | 241 |
| 309 | 3300025940 | Ga0207691_10070024 | Ga0207691_100700244 | 241 |
| 310 | 3300025941 | Ga0207711_10386779 | Ga0207711_103867792 | 241 |
| 311 | 3300025942 | Ga0207689_10004974 | Ga0207689_1000497410 | 241 |
| 312 | 3300025942 | Ga0207689_10162999 | Ga0207689_101629992 | 241 |
| 313 | 3300025942 | Ga0207689_10515083 | Ga0207689_105150832 | 241 |
| 314 | 3300025944 | Ga0207661_10235043 | Ga0207661_102350433 | 241 |
| 315 | 3300025960 | Ga0207651_10008493 | Ga0207651_100084932 | 241 |
| 316 | 3300025960 | Ga0207651_10144644 | Ga0207651_101446442 | 241 |
| 317 | 3300025961 | Ga0207712_10018694 | Ga0207712_100186942 | 241 |
| 318 | 3300025981 | Ga0207640_10054543 | Ga0207640_100545432 | 241 |
| 319 | 3300025986 | Ga0207658_10092108 | Ga0207658_100921083 | 241 |
| 320 | 3300026035 | Ga0207703_10011031 | Ga0207703_100110314 | 241 |
| 321 | 3300026067 | Ga0207678_10449639 | Ga0207678_104496391 | 241 |
| 322 | 3300026075 | Ga0207708_10003942 | Ga0207708_100039425 | 241 |
| 323 | 3300026075 | Ga0207708_10167572 | Ga0207708_101675722 | 241 |
| 324 | 3300026088 | Ga0207641_10090217 | Ga0207641_100902172 | 241 |
| 325 | 3300026089 | Ga0207648_10000274 | Ga0207648_1000027449 | 241 |
| 326 | 3300026116 | Ga0207674_10245443 | Ga0207674_102454432 | 241 |
| 327 | 3300026118 | Ga0207675_100406164 | Ga0207675_1004061642 | 241 |
| 328 | 3300026118 | Ga0207675_100423166 | Ga0207675_1004231662 | 241 |
| 329 | 3300026121 | Ga0207683_10116027 | Ga0207683_101160273 | 241 |
| 330 | 3300027907 | Ga0207428_10015673 | Ga0207428_100156732 | 241 |
| 331 | 3300027907 | Ga0207428_10116443 | Ga0207428_101164431 | 241 |
| 332 | 3300028380 | Ga0268265_10094562 | Ga0268265_100945622 | 241 |
| 333 | 3300028380 | Ga0268265_10371273 | Ga0268265_103712732 | 241 |
| 334 | 3300031235 | Ga0265330_10028907 | Ga0265330_100289074 | 241 |
| 335 | 3300031242 | Ga0265329_10006440 | Ga0265329_100064402 | 241 |
| 336 | 3300031250 | Ga0265331_10092562 | Ga0265331_100925623 | 241 |
| 337 | 3300031824 | Ga0307413_10552074 | Ga0307413_105520742 | 241 |
| 338 | 3300031995 | Ga0307409_100598168 | Ga0307409_1005981682 | 241 |
| 339 | 3300042436 | Ga0439435_0002496 | Ga0439435_0002496_895_1635 | 241 |
| 340 | 3300044712 | Ga0453684_0229780 | Ga0453684_0229780_466_1212 | 241 |
| 341 | 3300046683 | Ga0495658_0101995 | Ga0495658_0101995_663_1409 | 241 |
| 342 | 3300047320 | Ga0495672_0135602 | Ga0495672_0135602_156_899 | 241 |
| 343 | 3300048907 | Ga0496104_0214586 | Ga0496104_0214586_37_780 | 241 |
| 344 | 3300048908 | Ga0496105_0125782 | Ga0496105_0125782_110_853 | 241 |
| 345 | 3300048911 | Ga0496108_0025999 | Ga0496108_0025999_3778_4521 | 241 |
| 346 | 3300048912 | Ga0496109_0140809 | Ga0496109_0140809_378_1121 | 241 |
| 347 | 3300048913 | Ga0496110_0052588 | Ga0496110_0052588_1308_2051 | 241 |
| 348 | 3300048915 | Ga0496112_0061082 | Ga0496112_0061082_964_1707 | 241 |
| 349 | 3300048916 | Ga0496113_0116033 | Ga0496113_0116033_863_1606 | 241 |
| 350 | 3300048924 | Ga0496121_0283418 | Ga0496121_0283418_124_849 | 241 |
| 351 | 3300049570 | Ga0501033_0128732 | Ga0501033_0128732_699_1439 | 241 |
| 352 | 3300049588 | Ga0501072_0285657 | Ga0501072_0285657_113_853 | 241 |
| 353 | 3300049593 | Ga0501077_0170995 | Ga0501077_0170995_320_1060 | 241 |
| 354 | 3300049593 | Ga0501077_0277684 | Ga0501077_0277684_277_1017 | 241 |
| 355 | 3300049741 | Ga0501079_0104902 | Ga0501079_0104902_607_1347 | 241 |
| 356 | 3300049743 | Ga0501081_0166911 | Ga0501081_0166911_63_803 | 241 |
| 357 | 3300049824 | Ga0501045_0579770 | Ga0501045_0579770_35_775 | 241 |
| 358 | 3300050490 | nmdc:mga03n38_119490_c1 | nmdc:mga03n38_119490_c1_55_804 | 241 |
| 359 | 3300050491 | nmdc:mga00v17_63719_c1 | nmdc:mga00v17_63719_c1_946_1695 | 241 |
| 360 | 3300050494 | nmdc:mga06z11_31964_c1 | nmdc:mga06z11_31964_c1_577_1326 | 241 |
| 361 | 3300050496 | nmdc:mga07m45_22763_c1 | nmdc:mga07m45_22763_c1_236_985 | 241 |
| 362 | 3300050507 | nmdc:mga05p37_153730_c1 | nmdc:mga05p37_153730_c1_31_771 | 241 |
| 363 | 3300050511 | nmdc:mga08y16_44216_c1 | nmdc:mga08y16_44216_c1_3435_4175 | 241 |
| 364 | 3300050511 | nmdc:mga08y16_450644_c1 | nmdc:mga08y16_450644_c1_42_782 | 241 |
| 365 | 3300050511 | nmdc:mga08y16_79064_c1 | nmdc:mga08y16_79064_c1_1186_1929 | 241 |
| 366 | 3300050512 | nmdc:mga0n895_321586_c1 | nmdc:mga0n895_321586_c1_614_1357 | 241 |
| 367 | 3300061734 | Ga0530510_0242024 | Ga0530510_0242024_328_1068 | 241 |
| 368 | 3300005293 | Ga0065715_10152854 | Ga0065715_101528542 | 242 |
| 369 | 3300005295 | Ga0065707_10315487 | Ga0065707_103154871 | 242 |
| 370 | 3300005334 | Ga0068869_100356790 | Ga0068869_1003567902 | 242 |
| 371 | 3300005340 | Ga0070689_100396442 | Ga0070689_1003964421 | 242 |
| 372 | 3300005354 | Ga0070675_100074474 | Ga0070675_1000744742 | 242 |
| 373 | 3300005354 | Ga0070675_100098680 | Ga0070675_1000986802 | 242 |
| 374 | 3300005355 | Ga0070671_100028507 | Ga0070671_1000285075 | 242 |
| 375 | 3300005364 | Ga0070673_100009471 | Ga0070673_1000094712 | 242 |
| 376 | 3300005365 | Ga0070688_100120078 | Ga0070688_1001200782 | 242 |
| 377 | 3300005365 | Ga0070688_100258216 | Ga0070688_1002582162 | 242 |
| 378 | 3300005365 | Ga0070688_100332158 | Ga0070688_1003321581 | 242 |
| 379 | 3300005367 | Ga0070667_100437552 | Ga0070667_1004375521 | 242 |
| 380 | 3300005518 | Ga0070699_100073174 | Ga0070699_1000731743 | 242 |
| 381 | 3300005543 | Ga0070672_100242272 | Ga0070672_1002422722 | 242 |
| 382 | 3300005544 | Ga0070686_100021930 | Ga0070686_1000219302 | 242 |
| 383 | 3300005578 | Ga0068854_100410155 | Ga0068854_1004101552 | 242 |
| 384 | 3300005840 | Ga0068870_10240846 | Ga0068870_102408461 | 242 |
| 385 | 3300005841 | Ga0068863_100043928 | Ga0068863_1000439283 | 242 |
| 386 | 3300006178 | Ga0075367_10136565 | Ga0075367_101365652 | 242 |
| 387 | 3300006195 | Ga0075366_10086780 | Ga0075366_100867802 | 242 |
| 388 | 3300006353 | Ga0075370_10063419 | Ga0075370_100634192 | 242 |
| 389 | 3300006844 | Ga0075428_100032736 | Ga0075428_1000327364 | 242 |
| 390 | 3300006846 | Ga0075430_100089459 | Ga0075430_1000894592 | 242 |
| 391 | 3300006847 | Ga0075431_100008709 | Ga0075431_1000087093 | 242 |
| 392 | 3300006847 | Ga0075431_100174073 | Ga0075431_1001740732 | 242 |
| 393 | 3300006852 | Ga0075433_10000616 | Ga0075433_1000061619 | 242 |
| 394 | 3300006852 | Ga0075433_10002832 | Ga0075433_1000283210 | 242 |
| 395 | 3300006852 | Ga0075433_10023143 | Ga0075433_100231432 | 242 |
| 396 | 3300006871 | Ga0075434_100000950 | Ga0075434_10000095022 | 242 |
| 397 | 3300006871 | Ga0075434_100011925 | Ga0075434_1000119257 | 242 |
| 398 | 3300006880 | Ga0075429_100220407 | Ga0075429_1002204072 | 242 |
| 399 | 3300009094 | Ga0111539_10000956 | Ga0111539_1000095631 | 242 |
| 400 | 3300009094 | Ga0111539_10015035 | Ga0111539_100150353 | 242 |
| 401 | 3300009094 | Ga0111539_10072499 | Ga0111539_100724992 | 242 |
| 402 | 3300009094 | Ga0111539_10441637 | Ga0111539_104416372 | 242 |
| 403 | 3300009147 | Ga0114129_10024087 | Ga0114129_100240874 | 242 |
| 404 | 3300009147 | Ga0114129_10123446 | Ga0114129_101234462 | 242 |
| 405 | 3300009177 | Ga0105248_10047080 | Ga0105248_100470803 | 242 |
| 406 | 3300013308 | Ga0157375_10463845 | Ga0157375_104638452 | 242 |
| 407 | 3300014325 | Ga0163163_10066888 | Ga0163163_100668881 | 242 |
| 408 | 3300014326 | Ga0157380_10096227 | Ga0157380_100962273 | 242 |
| 409 | 3300014745 | Ga0157377_10006714 | Ga0157377_100067144 | 242 |
| 410 | 3300025893 | Ga0207682_10038361 | Ga0207682_100383612 | 242 |
| 411 | 3300025908 | Ga0207643_10025085 | Ga0207643_100250853 | 242 |
| 412 | 3300025925 | Ga0207650_10094401 | Ga0207650_100944012 | 242 |
| 413 | 3300025926 | Ga0207659_10010910 | Ga0207659_100109103 | 242 |
| 414 | 3300025926 | Ga0207659_10032849 | Ga0207659_100328492 | 242 |
| 415 | 3300025926 | Ga0207659_10268490 | Ga0207659_102684902 | 242 |
| 416 | 3300025940 | Ga0207691_10082017 | Ga0207691_100820171 | 242 |
| 417 | 3300025960 | Ga0207651_10033218 | Ga0207651_100332182 | 242 |
| 418 | 3300025960 | Ga0207651_10174713 | Ga0207651_101747132 | 242 |
| 419 | 3300025972 | Ga0207668_10446150 | Ga0207668_104461501 | 242 |
| 420 | 3300025981 | Ga0207640_10497231 | Ga0207640_104972312 | 242 |
| 421 | 3300026088 | Ga0207641_10029918 | Ga0207641_100299183 | 242 |
| 422 | 3300026088 | Ga0207641_10320941 | Ga0207641_103209411 | 242 |
| 423 | 3300026089 | Ga0207648_10189073 | Ga0207648_101890732 | 242 |
| 424 | 3300026121 | Ga0207683_10091034 | Ga0207683_100910344 | 242 |
| 425 | 3300027665 | Ga0209983_1019940 | Ga0209983_10199402 | 242 |
| 426 | 3300027866 | Ga0209813_10039529 | Ga0209813_100395292 | 242 |
| 427 | 3300027907 | Ga0207428_10098935 | Ga0207428_100989352 | 242 |
| 428 | 3300031235 | Ga0265330_10020430 | Ga0265330_100204303 | 242 |
| 429 | 3300031238 | Ga0265332_10000169 | Ga0265332_1000016916 | 242 |
| 430 | 3300031240 | Ga0265320_10019909 | Ga0265320_100199093 | 242 |
| 431 | 3300031242 | Ga0265329_10002408 | Ga0265329_100024083 | 242 |
| 432 | 3300031250 | Ga0265331_10000117 | Ga0265331_1000011752 | 242 |
| 433 | 3300031344 | Ga0265316_10000031 | Ga0265316_10000031106 | 242 |
| 434 | 3300031711 | Ga0265314_10000183 | Ga0265314_1000018314 | 242 |
| 435 | 3300031712 | Ga0265342_10000869 | Ga0265342_100008697 | 242 |
| 436 | 3300031911 | Ga0307412_10331496 | Ga0307412_103314962 | 242 |
| 437 | 3300045051 | Ga0451576_0192592 | Ga0451576_0192592_353_1099 | 242 |
| 438 | 3300048912 | Ga0496109_0027877 | Ga0496109_0027877_3473_4216 | 242 |
| 439 | 3300049572 | Ga0501036_0217066 | Ga0501036_0217066_343_1107 | 242 |
| 440 | 3300049587 | Ga0501071_0081804 | Ga0501071_0081804_1126_1890 | 242 |
| 441 | 3300050493 | nmdc:mga0k408_116211_c1 | nmdc:mga0k408_116211_c1_150_908 | 242 |
| 442 | 3300050493 | nmdc:mga0k408_208747_c1 | nmdc:mga0k408_208747_c1_227_979 | 242 |
| 443 | 3300050494 | nmdc:mga06z11_81859_c1 | nmdc:mga06z11_81859_c1_706_1464 | 242 |
| 444 | 3300050507 | nmdc:mga05p37_44098_c1 | nmdc:mga05p37_44098_c1_700_1443 | 242 |
| 445 | 3300050507 | nmdc:mga05p37_51832_c1 | nmdc:mga05p37_51832_c1_753_1508 | 242 |
| 446 | 3300050509 | nmdc:mga0qj67_204050_c1 | nmdc:mga0qj67_204050_c1_456_1202 | 242 |
| 447 | 3300050510 | nmdc:mga06r32_207622_c1 | nmdc:mga06r32_207622_c1_233_979 | 242 |
| 448 | 3300050510 | nmdc:mga06r32_248141_c1 | nmdc:mga06r32_248141_c1_837_1583 | 242 |
| 449 | 3300050511 | nmdc:mga08y16_214790_c1 | nmdc:mga08y16_214790_c1_483_1238 | 242 |
| 450 | 3300050511 | nmdc:mga08y16_64083_c1 | nmdc:mga08y16_64083_c1_2356_3099 | 242 |
| 451 | 3300050511 | nmdc:mga08y16_82294_c1 | nmdc:mga08y16_82294_c1_111_854 | 242 |
| 452 | 3300050512 | nmdc:mga0n895_30096_c1 | nmdc:mga0n895_30096_c1_88_834 | 242 |
| 453 | 3300050512 | nmdc:mga0n895_429_c1 | nmdc:mga0n895_429_c1_12807_13553 | 242 |
| 454 | 3300050515 | nmdc:mga0a205_114198_c1 | nmdc:mga0a205_114198_c1_586_1329 | 242 |
| 455 | 3300050515 | nmdc:mga0a205_58556_c1 | nmdc:mga0a205_58556_c1_829_1575 | 242 |
| 456 | 3300050515 | nmdc:mga0a205_867_c1 | nmdc:mga0a205_867_c1_8032_8778 | 242 |
| 457 | 3300005327 | Ga0070658_10360426 | Ga0070658_103604261 | 243 |
| 458 | 3300005354 | Ga0070675_100006764 | Ga0070675_1000067648 | 243 |
| 459 | 3300005365 | Ga0070688_100192470 | Ga0070688_1001924702 | 243 |
| 460 | 3300005441 | Ga0070700_100390052 | Ga0070700_1003900521 | 243 |
| 461 | 3300005459 | Ga0068867_100244298 | Ga0068867_1002442982 | 243 |
| 462 | 3300005543 | Ga0070672_100064185 | Ga0070672_1000641853 | 243 |
| 463 | 3300005840 | Ga0068870_10007640 | Ga0068870_100076406 | 243 |
| 464 | 3300009094 | Ga0111539_10531274 | Ga0111539_105312742 | 243 |
| 465 | 3300009148 | Ga0105243_10390594 | Ga0105243_103905941 | 243 |
| 466 | 3300014326 | Ga0157380_10003839 | Ga0157380_100038395 | 243 |
| 467 | 3300014326 | Ga0157380_10031703 | Ga0157380_100317033 | 243 |
| 468 | 3300025893 | Ga0207682_10048811 | Ga0207682_100488112 | 243 |
| 469 | 3300025960 | Ga0207651_10074122 | Ga0207651_100741222 | 243 |
| 470 | 3300046537 | Ga0495598_0034065 | Ga0495598_0034065_620_1360 | 243 |
| 471 | 3300049574 | Ga0501038_0398585 | Ga0501038_0398585_59_838 | 243 |
| 472 | 3300049823 | Ga0501044_0292091 | Ga0501044_0292091_642_1391 | 244 |
| 473 | 3300050493 | nmdc:mga0k408_27956_c1 | nmdc:mga0k408_27956_c1_684_1481 | 244 |
| 474 | 3300050496 | nmdc:mga07m45_4492_c1 | nmdc:mga07m45_4492_c1_5817_6614 | 244 |
| 475 | 3300006844 | Ga0075428_100012887 | Ga0075428_1000128877 | 246 |
| 476 | 3300049569 | Ga0501032_0005741 | Ga0501032_0005741_2724_3479 | 246 |
| 477 | 3300049571 | Ga0501034_0101760 | Ga0501034_0101760_1396_2154 | 247 |
| 478 | 3300049573 | Ga0501037_0000493 | Ga0501037_0000493_5321_6079 | 247 |
| 479 | 3300049574 | Ga0501038_0036850 | Ga0501038_0036850_2971_3729 | 247 |
| 480 | 3300049579 | Ga0501043_0000292 | Ga0501043_0000292_5622_6380 | 247 |
| 481 | 3300049581 | Ga0501047_0032682 | Ga0501047_0032682_4001_4759 | 247 |
| 482 | 3300048925 | Ga0496122_0089455 | Ga0496122_0089455_802_1551 | 249 |
| 483 | 2162886007 | SwRhRL2b_contig_1759361 | SwRhRL2b_0440.00007420 | 250 |
| 484 | 3300005289 | Ga0065704_10070132 | Ga0065704_100701321478 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e4l-assembly1.cif.gz_A | thermodynamic and structural analysis of thermolabile rnase hi from shewanella oneidensis mr-1 | 0.9378 | 6 | 152 |
| 1kvc-assembly1.cif.gz_A | e. coli ribonuclease hi d134n mutant | 0.9343 | 8 | 156 |
| 2z1j-assembly1.cif.gz_A | crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) | 0.9323 | 7 | 156 |
| 1wsj-assembly3.cif.gz_C | crystal structure of e.coli rnase hi active site mutant (k87a/h124a) | 0.9316 | 7 | 156 |
| 1jl2-assembly1.cif.gz_C | crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h | 0.9294 | 8 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jl2C00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9294 | 8 | 156 | 3.30.420.10 |
| 2zqbB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8962 | 6 | 157 | 3.30.420.10 |
| af_Q9XVE6_2_138_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8776 | 9 | 134 | 3.30.420.10 |
| 1jl2C00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8758 | 8 | 156 | 3.30.420.10 |
| af_M0RAC3_1264_1411_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8632 | 8 | 153 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838RSC6-F1-model_v4 | Ribonuclease HI | 0.9912 | 7 | 78 |
GO:0003676
GO:0004523 |
| AF-A0A3P8MB71-F1-model_v4 | Ribonuclease H (RNase H) (EC 3.1.26.4) | 0.9783 | 7 | 153 |
GO:0000287
GO:0003676 GO:0004523 GO:0005737 GO:0043137 |
| AF-A0A6I5NQP7-F1-model_v4 | Ribonuclease H (RNase H) (EC 3.1.26.4) | 0.9711 | 10 | 158 |
GO:0000287
GO:0003676 GO:0004523 GO:0005737 GO:0043137 |
| AF-A0A2D8V7A9-F1-model_v4 | Ribonuclease H (RNase H) (EC 3.1.26.4) | 0.9689 | 5 | 153 |
GO:0000287
GO:0003676 GO:0004523 GO:0005737 GO:0043137 |
| AF-A0A355VUJ1-F1-model_v4 | Ribonuclease H (RNase H) (EC 3.1.26.4) | 0.9685 | 6 | 153 |
GO:0000287
GO:0003676 GO:0004523 GO:0005737 GO:0043137 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar