F452874

General Info

Members Datasets Scaffolds Average Seq Length
484 233 968 302

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10004202|Ga0065712_100042022
Length 333
Sequence VILNDAHCHFFSTELFAALARQRLDRTPXXXXRGSLQEAMEEDVNRQLSVSICDELGWETPGSAYTLADRWVRELDTHNVARAALIASVPSDETSVAAAVAKHPGRFVGLFMLDPAVGDPVARARRALGELGLRGICLFPAMHHVPLHHDRIEQIVAVAAAHPGTAVFVHCGVLSVGVRKKLGLPSRFDLRLGDPLGVARLALAFPHVPFIIPHFGAGLFRETLMAADTCSNLYLDTSSSNGWITYTPGLTMETVFRTTLAVTGASRLLFGTDSSFFPRGWQKPVFEAQRAIVASLGISAGDQALVFGGNFDRLFPPVPAPPPGSSPPRAGSR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
137 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
138 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
187 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0
Rhizoplane 1.45
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 21.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10004202 3300005290 Bacteria 6243
2 Ga0065712_10072026 3300005290 Bacteria 4933
3 Ga0065715_10014776 3300005293 Bacteria 2432
4 Ga0065715_10137557 3300005293 Bacteria 1905
5 Ga0070676_10124829 3300005328 Bacteria 1620
6 Ga0070676_10324400 3300005328 Bacteria 1051
7 Ga0070683_100007718 3300005329 Bacteria 9109
8 Ga0070690_100037968 3300005330 Bacteria 3037
9 Ga0070670_100031073 3300005331 Unclassified 4599
10 Ga0070670_100135248 3300005331 Bacteria 2130
11 Ga0070670_100342437 3300005331 Bacteria 1313
12 Ga0070666_10028003 3300005335 Unclassified 3695
13 Ga0070680_100109317 3300005336 Bacteria 2300
14 Ga0070680_100422702 3300005336 Bacteria 1137
15 Ga0070689_100157253 3300005340 Bacteria 1835
16 Ga0070689_100212729 3300005340 Bacteria 1583
17 Ga0070687_100013688 3300005343 Unclassified 3623
18 Ga0070661_100018058 3300005344 Bacteria 5011
19 Ga0070668_100269041 3300005347 Bacteria 1420
20 Ga0070669_100068910 3300005353 Unclassified 2612
21 Ga0070669_100387668 3300005353 Bacteria 1140
22 Ga0070675_100031139 3300005354 Bacteria 4311
23 Ga0070675_100054359 3300005354 Unclassified 3294
24 Ga0070675_100064606 3300005354 Bacteria 3025
25 Ga0070675_100076829 3300005354 Bacteria 2779
26 Ga0070675_100168194 3300005354 Bacteria 1889
27 Ga0070671_100089939 3300005355 Unclassified 2570
28 Ga0070671_100314937 3300005355 Bacteria 1333
29 Ga0070673_100013745 3300005364 Bacteria 5613
30 Ga0070673_100045496 3300005364 Bacteria 3404
31 Ga0070673_100097189 3300005364 Bacteria 2418
32 Ga0070688_100040162 3300005365 Unclassified 2866
33 Ga0070667_100026029 3300005367 Unclassified 4865
34 Ga0070705_100000875 3300005440 Bacteria 16845
35 Ga0070705_100008870 3300005440 Bacteria 4984
36 Ga0070705_100021655 3300005440 Unclassified 3422
37 Ga0070705_100026956 3300005440 Bacteria 3132
38 Ga0070694_100000297 3300005444 Bacteria 26713
39 Ga0070694_100001463 3300005444 Bacteria 13841
40 Ga0070681_10011814 3300005458 Bacteria 8657
41 Ga0070681_10091359 3300005458 Bacteria 2995
42 Ga0070681_10200160 3300005458 Bacteria 1916
43 Ga0068867_100125288 3300005459 Bacteria 1990
44 Ga0070706_100128693 3300005467 Bacteria 2362
45 Ga0070707_100148562 3300005468 Bacteria 2281
46 Ga0070707_100186934 3300005468 Unclassified 2020
47 Ga0070707_100303007 3300005468 Bacteria 1553
48 Ga0070698_100001159 3300005471 Bacteria 29220
49 Ga0070698_100628197 3300005471 Unclassified 1015
50 Ga0070699_100001593 3300005518 Bacteria 20706
51 Ga0070699_100003379 3300005518 Bacteria 14117
52 Ga0070699_100003786 3300005518 Bacteria 13372
53 Ga0070699_100006927 3300005518 Bacteria 9853
54 Ga0070699_100269003 3300005518 Unclassified 1525
55 Ga0070699_100304825 3300005518 Bacteria 1429
56 Ga0070679_100201967 3300005530 Bacteria 1953
57 Ga0070684_100013651 3300005535 Bacteria 6555
58 Ga0070684_100142207 3300005535 Bacteria 2170
59 Ga0070697_100054491 3300005536 Bacteria 3250
60 Ga0070697_100156329 3300005536 Bacteria 1925
61 Ga0070672_100062902 3300005543 Bacteria 2930
62 Ga0070686_100031702 3300005544 Unclassified 3234
63 Ga0070686_100252159 3300005544 Unclassified 1289
64 Ga0070686_100280227 3300005544 Bacteria 1229
65 Ga0070695_100005395 3300005545 Bacteria 7526
66 Ga0070695_100143730 3300005545 Bacteria 1657
67 Ga0070695_100222314 3300005545 Bacteria 1361
68 Ga0070696_100000257 3300005546 Bacteria 32176
69 Ga0070696_100000653 3300005546 Bacteria 22174
70 Ga0070696_100002220 3300005546 Bacteria 12796
71 Ga0070696_100018530 3300005546 Unclassified 4706
72 Ga0070696_100048716 3300005546 Bacteria 2941
73 Ga0070704_100005995 3300005549 Bacteria 7126
74 Ga0070704_100168516 3300005549 Unclassified 1739
75 Ga0070704_100182729 3300005549 Bacteria 1679
76 Ga0070664_100001479 3300005564 Bacteria 18721
77 Ga0070664_100032720 3300005564 Bacteria 4350
78 Ga0070664_100048008 3300005564 Unclassified 3608
79 Ga0070664_100107780 3300005564 Unclassified 2429
80 Ga0068857_100565426 3300005577 Bacteria 1072
81 Ga0068856_100344299 3300005614 Unclassified 1509
82 Ga0068859_100049160 3300005617 Unclassified 4236
83 Ga0068859_100126166 3300005617 Bacteria 2628
84 Ga0068859_100166996 3300005617 Bacteria 2281
85 Ga0068859_100659613 3300005617 Bacteria 1138
86 Ga0068859_100751365 3300005617 Bacteria 1064
87 Ga0068864_100066834 3300005618 Unclassified 3121
88 Ga0068864_100300336 3300005618 Bacteria 1503
89 Ga0068864_100383784 3300005618 Unclassified 1332
90 Ga0068861_100023947 3300005719 Bacteria 4409
91 Ga0068861_100120928 3300005719 Bacteria 2112
92 Ga0068863_100008244 3300005841 Bacteria 10181
93 Ga0068858_100035135 3300005842 Bacteria 4649
94 Ga0068860_100127855 3300005843 Unclassified 2436
95 Ga0068860_100129119 3300005843 Bacteria 2424
96 Ga0068862_100093522 3300005844 Bacteria 2622
97 Ga0068862_100100592 3300005844 Bacteria 2528
98 Ga0068862_100474016 3300005844 Bacteria 1184
99 Ga0081539_10017057 3300005985 Bacteria 5128
100 Ga0075365_10001445 3300006038 Bacteria 10771
101 Ga0075368_10079182 3300006042 Bacteria 1336
102 Ga0075364_10017822 3300006051 Bacteria 4440
103 Ga0075364_10038249 3300006051 Bacteria 3108
104 Ga0075364_10152613 3300006051 Bacteria 1557
105 Ga0097621_100196008 3300006237 Bacteria 1751
106 Ga0075370_10272500 3300006353 Bacteria 1005
107 Ga0068871_100257251 3300006358 Bacteria 1522
108 Ga0075428_100002608 3300006844 Bacteria 19614
109 Ga0075428_100018028 3300006844 Bacteria 7801
110 Ga0075428_100118329 3300006844 Bacteria 2885
111 Ga0075428_100163159 3300006844 Bacteria 2418
112 Ga0075428_100708532 3300006844 Unclassified 1072
113 Ga0075430_100007616 3300006846 Bacteria 9147
114 Ga0075430_100018754 3300006846 Bacteria 5887
115 Ga0075430_100160444 3300006846 Unclassified 1872
116 Ga0075430_100323279 3300006846 Bacteria 1275
117 Ga0075431_100002033 3300006847 Bacteria 19323
118 Ga0075431_100010586 3300006847 Bacteria 9274
119 Ga0075431_100032191 3300006847 Bacteria 5403
120 Ga0075431_100067207 3300006847 Bacteria 3701
121 Ga0075431_100136871 3300006847 Unclassified 2525
122 Ga0075431_100330037 3300006847 Bacteria 1536
123 Ga0075433_10000731 3300006852 Bacteria 22507
124 Ga0075433_10002682 3300006852 Bacteria 13593
125 Ga0075433_10035015 3300006852 Bacteria 4315
126 Ga0075433_10123773 3300006852 Bacteria 2297
127 Ga0075433_10184349 3300006852 Bacteria 1857
128 Ga0075434_100004498 3300006871 Bacteria 12576
129 Ga0075434_100049665 3300006871 Bacteria 4166
130 Ga0075434_100056856 3300006871 Bacteria 3888
131 Ga0075434_100064301 3300006871 Bacteria 3653
132 Ga0075429_100001379 3300006880 Bacteria 19874
133 Ga0075429_100002165 3300006880 Bacteria 16399
134 Ga0075429_100046150 3300006880 Bacteria 3791
135 Ga0075429_100082682 3300006880 Unclassified 2799
136 Ga0075429_100324732 3300006880 Unclassified 1347
137 Ga0068865_100220650 3300006881 Bacteria 1482
138 Ga0075436_100010238 3300006914 Bacteria 6420
139 Ga0097620_100049159 3300006931 Unclassified 4236
140 Ga0097620_100126165 3300006931 Bacteria 2628
141 Ga0097620_100166987 3300006931 Bacteria 2281
142 Ga0097620_100399332 3300006931 Bacteria 1471
143 Ga0097620_100659514 3300006931 Bacteria 1138
144 Ga0097620_100751273 3300006931 Bacteria 1064
145 Ga0075435_100010083 3300007076 Bacteria 6893
146 Ga0075435_100022705 3300007076 Bacteria 4842
147 Ga0075435_100061781 3300007076 Bacteria 3039
148 Ga0075435_100139539 3300007076 Bacteria 2033
149 Ga0075435_100365051 3300007076 Bacteria 1239
150 Ga0105240_10310763 3300009093 Unclassified 1800
151 Ga0111539_10000475 3300009094 Bacteria 50635
152 Ga0111539_10004707 3300009094 Bacteria 17832
153 Ga0111539_10028410 3300009094 Bacteria 6824
154 Ga0111539_10047588 3300009094 Bacteria 5125
155 Ga0111539_10070306 3300009094 Bacteria 4132
156 Ga0111539_10073680 3300009094 Bacteria 4025
157 Ga0111539_10353795 3300009094 Bacteria 1709
158 Ga0114129_10000362 3300009147 Bacteria 52441
159 Ga0114129_10005238 3300009147 Bacteria 18273
160 Ga0114129_10005513 3300009147 Bacteria 17896
161 Ga0114129_10033257 3300009147 Bacteria 7287
162 Ga0114129_10039747 3300009147 Bacteria 6635
163 Ga0114129_10045559 3300009147 Bacteria 6165
164 Ga0114129_10045789 3300009147 Bacteria 6148
165 Ga0114129_10079802 3300009147 Bacteria 4549
166 Ga0114129_10102015 3300009147 Bacteria 3968
167 Ga0114129_10155800 3300009147 Unclassified 3124
168 Ga0114129_10292347 3300009147 Bacteria 2174
169 Ga0114129_10644497 3300009147 Bacteria 1368
170 Ga0105243_10115240 3300009148 Bacteria 2256
171 Ga0105242_10420746 3300009176 Bacteria 1252
172 Ga0105248_10348905 3300009177 Bacteria 1666
173 Ga0105248_10546651 3300009177 Bacteria 1306
174 Ga0105248_10588398 3300009177 Bacteria 1256
175 Ga0105248_10619543 3300009177 Bacteria 1221
176 Ga0105249_10054734 3300009553 Bacteria 3649
177 Ga0105239_10391525 3300010375 Unclassified 1572
178 Ga0157370_10020631 3300013104 Bacteria 6579
179 Ga0157374_10135992 3300013296 Unclassified 2383
180 Ga0157378_10320922 3300013297 Bacteria 1505
181 Ga0157378_10663091 3300013297 Unclassified 1060
182 Ga0163162_10023297 3300013306 Bacteria 6111
183 Ga0157372_10255890 3300013307 Bacteria 2033
184 Ga0157375_10227239 3300013308 Unclassified 2025
185 Ga0163163_10030535 3300014325 Bacteria 5193
186 Ga0163163_10061059 3300014325 Unclassified 3734
187 Ga0163163_10071106 3300014325 Bacteria 3466
188 Ga0163163_10081949 3300014325 Unclassified 3229
189 Ga0163163_10150142 3300014325 Bacteria 2374
190 Ga0157380_10100847 3300014326 Unclassified 2404
191 Ga0157380_10112986 3300014326 Bacteria 2286
192 Ga0157380_10356637 3300014326 Bacteria 1370
193 Ga0157377_10033258 3300014745 Bacteria 2814
194 Ga0157379_10431752 3300014968 Bacteria 1214
195 Ga0163161_10137346 3300017792 Unclassified 1849
196 Ga0207697_10000326 3300025315 Bacteria 26570
197 Ga0207682_10000570 3300025893 Bacteria 17062
198 Ga0207688_10003776 3300025901 Bacteria 8258
199 Ga0207680_10135709 3300025903 Unclassified 1626
200 Ga0207645_10187277 3300025907 Bacteria 1359
201 Ga0207643_10104663 3300025908 Bacteria 1662
202 Ga0207684_10114653 3300025910 Bacteria 2308
203 Ga0207707_10124473 3300025912 Unclassified 2254
204 Ga0207649_10026777 3300025920 Unclassified 3376
205 Ga0207652_10256160 3300025921 Bacteria 1578
206 Ga0207652_10481552 3300025921 Bacteria 1118
207 Ga0207646_10039357 3300025922 Bacteria 4256
208 Ga0207646_10073063 3300025922 Bacteria 3063
209 Ga0207646_10315412 3300025922 Bacteria 1413
210 Ga0207681_10024604 3300025923 Bacteria 3866
211 Ga0207681_10099177 3300025923 Bacteria 2097
212 Ga0207681_10153103 3300025923 Bacteria 1730
213 Ga0207659_10009533 3300025926 Bacteria 6072
214 Ga0207659_10011655 3300025926 Bacteria 5562
215 Ga0207659_10025974 3300025926 Bacteria 3945
216 Ga0207659_10042065 3300025926 Unclassified 3202
217 Ga0207659_10113202 3300025926 Bacteria 2066
218 Ga0207644_10059558 3300025931 Unclassified 2762
219 Ga0207706_10105281 3300025933 Bacteria 2482
220 Ga0207709_10070335 3300025935 Bacteria 2219
221 Ga0207691_10008335 3300025940 Bacteria 9955
222 Ga0207691_10030331 3300025940 Bacteria 5054
223 Ga0207691_10097074 3300025940 Bacteria 2634
224 Ga0207691_10283350 3300025940 Bacteria 1426
225 Ga0207711_10328128 3300025941 Bacteria 1415
226 Ga0207689_10340289 3300025942 Bacteria 1246
227 Ga0207679_10018662 3300025945 Unclassified 4651
228 Ga0207679_10025480 3300025945 Bacteria 4069
229 Ga0207679_10066313 3300025945 Unclassified 2705
230 Ga0207679_10173572 3300025945 Bacteria 1777
231 Ga0207651_10004586 3300025960 Bacteria 6996
232 Ga0207651_10031369 3300025960 Bacteria 3396
233 Ga0207651_10037827 3300025960 Unclassified 3164
234 Ga0207712_10024276 3300025961 Unclassified 4013
235 Ga0207712_10107475 3300025961 Bacteria 2086
236 Ga0207668_10037523 3300025972 Bacteria 3244
237 Ga0207703_10119709 3300026035 Bacteria 2259
238 Ga0207708_10022097 3300026075 Bacteria 4804
239 Ga0207708_10136683 3300026075 Unclassified 1920
240 Ga0207708_10253725 3300026075 Bacteria 1418
241 Ga0207641_10025410 3300026088 Bacteria 4883
242 Ga0207641_10288252 3300026088 Bacteria 1547
243 Ga0207648_10200850 3300026089 Bacteria 1768
244 Ga0207648_10203856 3300026089 Bacteria 1755
245 Ga0207648_10263169 3300026089 Bacteria 1539
246 Ga0207676_10036935 3300026095 Bacteria 3719
247 Ga0207676_10083448 3300026095 Unclassified 2602
248 Ga0207676_10489748 3300026095 Bacteria 1166
249 Ga0207675_100126427 3300026118 Bacteria 2421
250 Ga0207675_100285854 3300026118 Bacteria 1603
251 Ga0209813_10087320 3300027866 Bacteria 1041
252 Ga0207428_10000359 3300027907 Bacteria 58826
253 Ga0207428_10002202 3300027907 Bacteria 19588
254 Ga0207428_10004851 3300027907 Bacteria 12684
255 Ga0207428_10013672 3300027907 Bacteria 7080
256 Ga0207428_10173573 3300027907 Bacteria 1631
257 Ga0268265_10089685 3300028380 Unclassified 2454
258 Ga0268265_10446090 3300028380 Bacteria 1207
259 Ga0268264_10317223 3300028381 Bacteria 1473
260 Ga0265338_10313153 3300028800 Unclassified 1138
261 Ga0265332_10006083 3300031238 Bacteria 5509
262 Ga0265325_10026757 3300031241 Unclassified 3122
263 Ga0307408_100002509 3300031548 Bacteria 12827
264 Ga0307408_100011657 3300031548 Bacteria 5811
265 Ga0307408_100025745 3300031548 Bacteria 4032
266 Ga0307408_100030707 3300031548 Bacteria 3734
267 Ga0307408_100040331 3300031548 Unclassified 3306
268 Ga0307408_100239158 3300031548 Bacteria 1491
269 Ga0307405_10002306 3300031731 Bacteria 8370
270 Ga0307405_10013861 3300031731 Bacteria 4313
271 Ga0307413_10379289 3300031824 Bacteria 1101
272 Ga0307406_10047767 3300031901 Unclassified 2699
273 Ga0307407_10125145 3300031903 Bacteria 1636
274 Ga0307409_100084225 3300031995 Bacteria 2581
275 Ga0307409_100117310 3300031995 Bacteria 2246
276 Ga0307409_100260868 3300031995 Bacteria 1590
277 Ga0307409_100313491 3300031995 Unclassified 1465
278 Ga0307416_100020094 3300032002 Bacteria 4756
279 Ga0307416_100024381 3300032002 Unclassified 4415
280 Ga0307416_100112444 3300032002 Unclassified 2403
281 Ga0307416_100212860 3300032002 Bacteria 1845
282 Ga0307416_100516033 3300032002 Unclassified 1262
283 Ga0307414_10035264 3300032004 Bacteria 3328
284 Ga0307411_10007293 3300032005 Bacteria 5614
285 Ga0307411_10058029 3300032005 Bacteria 2560
286 Ga0307411_10133980 3300032005 Bacteria 1815
287 Ga0307411_10143702 3300032005 Bacteria 1763
288 Ga0307415_100006460 3300032126 Bacteria 6327
289 Ga0307415_100127844 3300032126 Bacteria 1918
290 Ga0373939_0056242 3300035114 Bacteria 1238
291 Ga0373931_0284117 3300035691 Unclassified 1017
292 Ga0373927_0171330 3300035695 Bacteria 1423
293 Ga0373937_0002419 3300036401 Bacteria 15519
294 Ga0373925_0216584 3300037068 Unclassified 1527
295 Ga0395900_0202250 3300037418 Unclassified 2009
296 Ga0395898_0155422 3300037466 Bacteria 2188
297 Ga0439433_0001690 3300041999 Bacteria 4603
298 Ga0439449_0096751 3300042007 Bacteria 1091
299 Ga0439450_021552 3300042008 Unclassified 1384
300 Ga0439450_025175 3300042008 Bacteria 1302
301 Ga0450923_005985 3300042125 Bacteria 1991
302 Ga0450897_011759 3300042128 Bacteria 857
303 Ga0439446_0079243 3300042156 Bacteria 1015
304 Ga0450908_023396 3300042184 Bacteria 1081
305 Ga0439434_0057299 3300042435 Unclassified 1215
306 Ga0439435_0001687 3300042436 Bacteria 4165
307 Ga0439435_0003456 3300042436 Unclassified 3289
308 Ga0439435_0008433 3300042436 Bacteria 2389
309 Ga0439464_0002681 3300042439 Bacteria 4414
310 Ga0450916_009862 3300042530 Unclassified 1185
311 Ga0451577_0094949 3300042876 Bacteria 2663
312 Ga0495592_0008565 3300046454 Bacteria 7678
313 Ga0495629_0006962 3300046459 Bacteria 8343
314 Ga0495651_0043794 3300046462 Bacteria 3471
315 Ga0495580_0000779 3300046472 Bacteria 27448
316 Ga0495580_0102107 3300046472 Bacteria 1994
317 Ga0495582_0057195 3300046473 Bacteria 2150
318 Ga0495639_0055307 3300046475 Unclassified 1810
319 Ga0495608_0029267 3300046511 Unclassified 3738
320 Ga0495608_0099541 3300046511 Bacteria 1875
321 Ga0495618_0145826 3300046514 Unclassified 1513
322 Ga0495628_0211861 3300046516 Unclassified 1457
323 Ga0495630_0033186 3300046517 Bacteria 3850
324 Ga0495643_0002072 3300046522 Bacteria 16603
325 Ga0495663_0002671 3300046525 Bacteria 5317
326 Ga0495642_0009590 3300046528 Bacteria 3705
327 Ga0495652_0260823 3300046529 Bacteria 1279
328 Ga0495652_0353609 3300046529 Bacteria 1052
329 Ga0495598_0008931 3300046537 Bacteria 2350
330 Ga0495598_0032272 3300046537 Unclassified 1479
331 Ga0495609_0046209 3300046538 Bacteria 1950
332 Ga0495621_0008304 3300046539 Bacteria 3108
333 Ga0495621_0010530 3300046539 Bacteria 2832
334 Ga0495645_0009433 3300046543 Bacteria 6816
335 Ga0495645_0079912 3300046543 Bacteria 2348
336 Ga0495667_0012142 3300046559 Bacteria 5836
337 Ga0495656_0090292 3300046615 Bacteria 1400
338 Ga0495635_0286628 3300046663 Bacteria 1106
339 Ga0495599_0087996 3300046678 Bacteria 1939
340 Ga0495599_0219303 3300046678 Bacteria 1164
341 Ga0495623_0078875 3300046679 Bacteria 2041
342 Ga0495646_0121682 3300046680 Bacteria 1476
343 Ga0495613_0172372 3300046689 Bacteria 1535
344 Ga0495613_0239730 3300046689 Unclassified 1268
345 Ga0495670_0179917 3300046691 Unclassified 1116
346 Ga0495600_0075400 3300046809 Unclassified 2203
347 Ga0495604_0285073 3300047317 Bacteria 1114
348 Ga0495604_0287800 3300047317 Bacteria 1108
349 Ga0495674_0007257 3300047319 Bacteria 10607
350 Ga0495674_0024479 3300047319 Bacteria 5546
351 Ga0495674_0107753 3300047319 Bacteria 2364
352 Ga0495674_0232816 3300047319 Bacteria 1520
353 Ga0495676_0153616 3300047321 Unclassified 1635
354 Ga0495680_0268117 3300047322 Bacteria 1206
355 Ga0495675_0005152 3300047444 Bacteria 7955
356 Ga0495675_0029199 3300047444 Bacteria 3516
357 Ga0495677_0042891 3300047445 Unclassified 1658
358 Ga0495684_0012203 3300047471 Bacteria 6628
359 Ga0495684_0015242 3300047471 Bacteria 5921
360 Ga0495684_0051652 3300047471 Bacteria 3137
361 Ga0495684_0097805 3300047471 Bacteria 2220
362 Ga0495684_0290870 3300047471 Bacteria 1176
363 Ga0495602_0073387 3300048088 Bacteria 2913
364 Ga0495602_0104874 3300048088 Bacteria 2312
365 Ga0495602_0106025 3300048088 Unclassified 2295
366 Ga0496109_0011381 3300048912 Bacteria 7645
367 Ga0496109_0256272 3300048912 Bacteria 1648
368 Ga0496110_0317176 3300048913 Unclassified 1420
369 Ga0496112_0040025 3300048915 Bacteria 4582
370 Ga0496112_0539479 3300048915 Unclassified 1101
371 Ga0496113_0487260 3300048916 Bacteria 990
372 Ga0496114_0444707 3300048917 Bacteria 1148
373 Ga0501291_008829 3300049514 Bacteria 1401
374 Ga0501299_000361 3300049522 Bacteria 5340
375 Ga0501033_0030806 3300049570 Unclassified 4032
376 Ga0501034_0020858 3300049571 Bacteria 6687
377 Ga0501036_0068832 3300049572 Bacteria 2995
378 Ga0501036_0147028 3300049572 Unclassified 1988
379 Ga0501038_0106314 3300049574 Bacteria 2329
380 Ga0501039_0002646 3300049575 Bacteria 13379
381 Ga0501039_0042849 3300049575 Bacteria 3497
382 Ga0501039_0120959 3300049575 Unclassified 2052
383 Ga0501040_0017127 3300049576 Bacteria 4809
384 Ga0501040_0066390 3300049576 Unclassified 2486
385 Ga0501041_0025527 3300049577 Bacteria 3551
386 Ga0501042_0002643 3300049578 Bacteria 11018
387 Ga0501042_0094632 3300049578 Unclassified 2146
388 Ga0501043_0014041 3300049579 Bacteria 6268
389 Ga0501047_0355177 3300049581 Bacteria 1302
390 Ga0501048_0131106 3300049582 Bacteria 1772
391 Ga0501068_0007856 3300049584 Bacteria 5911
392 Ga0501071_0008591 3300049587 Bacteria 6750
393 Ga0501071_0448035 3300049587 Unclassified 988
394 Ga0501072_0014654 3300049588 Bacteria 6010
395 Ga0501072_0039807 3300049588 Bacteria 3690
396 Ga0501073_0065266 3300049589 Bacteria 2539
397 Ga0501074_0069633 3300049590 Bacteria 2530
398 Ga0501075_0000973 3300049591 Bacteria 18253
399 Ga0501075_0026354 3300049591 Unclassified 4279
400 Ga0501076_0000463 3300049592 Bacteria 25756
401 Ga0501076_0062070 3300049592 Bacteria 2976
402 Ga0501077_0031464 3300049593 Unclassified 3376
403 Ga0501222_014787 3300049662 Bacteria 1030
404 Ga0501079_0023781 3300049741 Bacteria 4701
405 Ga0501079_0052153 3300049741 Bacteria 3158
406 Ga0501079_0141861 3300049741 Unclassified 1871
407 Ga0501080_0038361 3300049742 Bacteria 4473
408 Ga0501081_0000186 3300049743 Bacteria 29811
409 Ga0501081_0032605 3300049743 Bacteria 3535
410 Ga0501081_0186112 3300049743 Bacteria 1503
411 Ga0501083_0163098 3300049744 Unclassified 1458
412 Ga0501045_0012283 3300049824 Bacteria 6032
413 Ga0501045_0078813 3300049824 Unclassified 2429
414 nmdc:mga03683_8722_c1 3300050489 Bacteria 3576
415 nmdc:mga00v17_131251_c1 3300050491 Bacteria 1601
416 nmdc:mga00v17_180600_c1 3300050491 Bacteria 1362
417 nmdc:mga00v17_266941_c1 3300050491 Bacteria 1111
418 nmdc:mga06z11_239766_c1 3300050494 Bacteria 1065
419 nmdc:mga04h51_79862_c1 3300050495 Bacteria 1159
420 nmdc:mga07m45_29090_c1 3300050496 Bacteria 3053
421 nmdc:mga05p37_122492_c1 3300050507 Bacteria 3194
422 nmdc:mga05p37_223866_c1 3300050507 Bacteria 2269
423 nmdc:mga05p37_32789_c1 3300050507 Bacteria 6355
424 nmdc:mga05p37_415_c1 3300050507 Bacteria 46056
425 nmdc:mga05p37_509243_c1 3300050507 Bacteria 1379
426 nmdc:mga05p37_76836_c1 3300050507 Unclassified 4110
427 nmdc:mga05p37_77375_c1 3300050507 Bacteria 4095
428 nmdc:mga05p37_92809_c1 3300050507 Bacteria 3720
429 nmdc:mga05p37_9656_c1 3300050507 Bacteria 11433
430 nmdc:mga09592_161848_c1 3300050508 Unclassified 1934
431 nmdc:mga09592_1775_c1 3300050508 Bacteria 17335
432 nmdc:mga09592_20746_c1 3300050508 Bacteria 5407
433 nmdc:mga09592_494651_c1 3300050508 Unclassified 1053
434 nmdc:mga09592_6907_c1 3300050508 Bacteria 9231
435 nmdc:mga09592_9255_c1 3300050508 Bacteria 8012
436 nmdc:mga0qj67_206389_c1 3300050509 Bacteria 1596
437 nmdc:mga0qj67_43301_c1 3300050509 Unclassified 3545
438 nmdc:mga0qj67_61504_c1 3300050509 Unclassified 2982
439 nmdc:mga0qj67_9272_c1 3300050509 Bacteria 7318
440 nmdc:mga06r32_151467_c1 3300050510 Unclassified 2298
441 nmdc:mga06r32_169402_c1 3300050510 Unclassified 2167
442 nmdc:mga06r32_2407_c2 3300050510 Bacteria 11658
443 nmdc:mga06r32_262603_c1 3300050510 Bacteria 1714
444 nmdc:mga06r32_4389_c1 3300050510 Bacteria 12612
445 nmdc:mga06r32_507745_c1 3300050510 Unclassified 1182
446 nmdc:mga08y16_121182_c1 3300050511 Bacteria 2722
447 nmdc:mga08y16_24387_c1 3300050511 Bacteria 6384
448 nmdc:mga08y16_24851_c1 3300050511 Bacteria 6320
449 nmdc:mga08y16_256752_c1 3300050511 Bacteria 1117
450 nmdc:mga08y16_4049_c1 3300050511 Bacteria 15295
451 nmdc:mga08y16_442464_c1 3300050511 Bacteria 1326
452 nmdc:mga08y16_45069_c1 3300050511 Unclassified 4621
453 nmdc:mga08y16_632203_c1 3300050511 Bacteria 1076
454 nmdc:mga08y16_644076_c1 3300050511 Bacteria 1064
455 nmdc:mga08y16_712_c1 3300050511 Bacteria 31560
456 nmdc:mga0n895_135343_c1 3300050512 Bacteria 2491
457 nmdc:mga0n895_288341_c1 3300050512 Unclassified 1664
458 nmdc:mga0n895_58737_c1 3300050512 Bacteria 3793
459 nmdc:mga0n895_62441_c1 3300050512 Bacteria 3682
460 nmdc:mga0n895_68571_c1 3300050512 Bacteria 3514
461 nmdc:mga0rr50_63259_c1 3300050513 Bacteria 2794
462 nmdc:mga0rr50_7203_c1 3300050513 Bacteria 6836
463 nmdc:mga0rr50_89763_c1 3300050513 Bacteria 2390
464 nmdc:mga08x19_12022_c1 3300050514 Bacteria 5210
465 nmdc:mga0a205_12873_c1 3300050515 Bacteria 7761
466 nmdc:mga0a205_1550_c1 3300050515 Bacteria 19665
467 nmdc:mga0a205_157080_c1 3300050515 Bacteria 2173
468 nmdc:mga0a205_18366_c1 3300050515 Bacteria 6574
469 nmdc:mga0a205_206168_c1 3300050515 Unclassified 1855
470 nmdc:mga0a205_6079_c1 3300050515 Bacteria 10888
471 nmdc:mga0a205_65439_c1 3300050515 Bacteria 3512
472 nmdc:mga0a205_75993_c1 3300050515 Bacteria 3245
473 Ga0495601_0068753 3300053077 Bacteria 2258
474 Ga0495619_0289462 3300053085 Unclassified 1135
475 Ga0500628_001888 3300053129 Bacteria 3533
476 Ga0500568_0002689 3300053139 Bacteria 10306
477 Ga0501084_0001783 3300054114 Bacteria 17125
478 Ga0501084_0085544 3300054114 Unclassified 2647
479 Ga0501082_0002935 3300060353 Bacteria 14884
480 Ga0501082_0060819 3300060353 Bacteria 3252
481 Ga0501082_0074888 3300060353 Bacteria 2916
482 Ga0501082_0138164 3300060353 Bacteria 2115
483 Ga0530510_0148422 3300061734 Bacteria 1730
484 Ga0530510_0389664 3300061734 Bacteria 1049
485 Ga0065712_10004202
486 Ga0065712_10072026
487 Ga0065715_10014776
488 Ga0065715_10137557
489 Ga0070676_10124829
490 Ga0070676_10324400
491 Ga0070683_100007718
492 Ga0070690_100037968
493 Ga0070670_100031073
494 Ga0070670_100135248
495 Ga0070670_100342437
496 Ga0070666_10028003
497 Ga0070680_100109317
498 Ga0070680_100422702
499 Ga0070689_100157253
500 Ga0070689_100212729
501 Ga0070687_100013688
502 Ga0070661_100018058
503 Ga0070668_100269041
504 Ga0070669_100068910
505 Ga0070669_100387668
506 Ga0070675_100031139
507 Ga0070675_100054359
508 Ga0070675_100064606
509 Ga0070675_100076829
510 Ga0070675_100168194
511 Ga0070671_100089939
512 Ga0070671_100314937
513 Ga0070673_100013745
514 Ga0070673_100045496
515 Ga0070673_100097189
516 Ga0070688_100040162
517 Ga0070667_100026029
518 Ga0070705_100000875
519 Ga0070705_100008870
520 Ga0070705_100021655
521 Ga0070705_100026956
522 Ga0070694_100000297
523 Ga0070694_100001463
524 Ga0070681_10011814
525 Ga0070681_10091359
526 Ga0070681_10200160
527 Ga0068867_100125288
528 Ga0070706_100128693
529 Ga0070707_100148562
530 Ga0070707_100186934
531 Ga0070707_100303007
532 Ga0070698_100001159
533 Ga0070698_100628197
534 Ga0070699_100001593
535 Ga0070699_100003379
536 Ga0070699_100003786
537 Ga0070699_100006927
538 Ga0070699_100269003
539 Ga0070699_100304825
540 Ga0070679_100201967
541 Ga0070684_100013651
542 Ga0070684_100142207
543 Ga0070697_100054491
544 Ga0070697_100156329
545 Ga0070672_100062902
546 Ga0070686_100031702
547 Ga0070686_100252159
548 Ga0070686_100280227
549 Ga0070695_100005395
550 Ga0070695_100143730
551 Ga0070695_100222314
552 Ga0070696_100000257
553 Ga0070696_100000653
554 Ga0070696_100002220
555 Ga0070696_100018530
556 Ga0070696_100048716
557 Ga0070704_100005995
558 Ga0070704_100168516
559 Ga0070704_100182729
560 Ga0070664_100001479
561 Ga0070664_100032720
562 Ga0070664_100048008
563 Ga0070664_100107780
564 Ga0068857_100565426
565 Ga0068856_100344299
566 Ga0068859_100049160
567 Ga0068859_100126166
568 Ga0068859_100166996
569 Ga0068859_100659613
570 Ga0068859_100751365
571 Ga0068864_100066834
572 Ga0068864_100300336
573 Ga0068864_100383784
574 Ga0068861_100023947
575 Ga0068861_100120928
576 Ga0068863_100008244
577 Ga0068858_100035135
578 Ga0068860_100127855
579 Ga0068860_100129119
580 Ga0068862_100093522
581 Ga0068862_100100592
582 Ga0068862_100474016
583 Ga0081539_10017057
584 Ga0075365_10001445
585 Ga0075368_10079182
586 Ga0075364_10017822
587 Ga0075364_10038249
588 Ga0075364_10152613
589 Ga0097621_100196008
590 Ga0075370_10272500
591 Ga0068871_100257251
592 Ga0075428_100002608
593 Ga0075428_100018028
594 Ga0075428_100118329
595 Ga0075428_100163159
596 Ga0075428_100708532
597 Ga0075430_100007616
598 Ga0075430_100018754
599 Ga0075430_100160444
600 Ga0075430_100323279
601 Ga0075431_100002033
602 Ga0075431_100010586
603 Ga0075431_100032191
604 Ga0075431_100067207
605 Ga0075431_100136871
606 Ga0075431_100330037
607 Ga0075433_10000731
608 Ga0075433_10002682
609 Ga0075433_10035015
610 Ga0075433_10123773
611 Ga0075433_10184349
612 Ga0075434_100004498
613 Ga0075434_100049665
614 Ga0075434_100056856
615 Ga0075434_100064301
616 Ga0075429_100001379
617 Ga0075429_100002165
618 Ga0075429_100046150
619 Ga0075429_100082682
620 Ga0075429_100324732
621 Ga0068865_100220650
622 Ga0075436_100010238
623 Ga0097620_100049159
624 Ga0097620_100126165
625 Ga0097620_100166987
626 Ga0097620_100399332
627 Ga0097620_100659514
628 Ga0097620_100751273
629 Ga0075435_100010083
630 Ga0075435_100022705
631 Ga0075435_100061781
632 Ga0075435_100139539
633 Ga0075435_100365051
634 Ga0105240_10310763
635 Ga0111539_10000475
636 Ga0111539_10004707
637 Ga0111539_10028410
638 Ga0111539_10047588
639 Ga0111539_10070306
640 Ga0111539_10073680
641 Ga0111539_10353795
642 Ga0114129_10000362
643 Ga0114129_10005238
644 Ga0114129_10005513
645 Ga0114129_10033257
646 Ga0114129_10039747
647 Ga0114129_10045559
648 Ga0114129_10045789
649 Ga0114129_10079802
650 Ga0114129_10102015
651 Ga0114129_10155800
652 Ga0114129_10292347
653 Ga0114129_10644497
654 Ga0105243_10115240
655 Ga0105242_10420746
656 Ga0105248_10348905
657 Ga0105248_10546651
658 Ga0105248_10588398
659 Ga0105248_10619543
660 Ga0105249_10054734
661 Ga0105239_10391525
662 Ga0157370_10020631
663 Ga0157374_10135992
664 Ga0157378_10320922
665 Ga0157378_10663091
666 Ga0163162_10023297
667 Ga0157372_10255890
668 Ga0157375_10227239
669 Ga0163163_10030535
670 Ga0163163_10061059
671 Ga0163163_10071106
672 Ga0163163_10081949
673 Ga0163163_10150142
674 Ga0157380_10100847
675 Ga0157380_10112986
676 Ga0157380_10356637
677 Ga0157377_10033258
678 Ga0157379_10431752
679 Ga0163161_10137346
680 Ga0207697_10000326
681 Ga0207682_10000570
682 Ga0207688_10003776
683 Ga0207680_10135709
684 Ga0207645_10187277
685 Ga0207643_10104663
686 Ga0207684_10114653
687 Ga0207707_10124473
688 Ga0207649_10026777
689 Ga0207652_10256160
690 Ga0207652_10481552
691 Ga0207646_10039357
692 Ga0207646_10073063
693 Ga0207646_10315412
694 Ga0207681_10024604
695 Ga0207681_10099177
696 Ga0207681_10153103
697 Ga0207659_10009533
698 Ga0207659_10011655
699 Ga0207659_10025974
700 Ga0207659_10042065
701 Ga0207659_10113202
702 Ga0207644_10059558
703 Ga0207706_10105281
704 Ga0207709_10070335
705 Ga0207691_10008335
706 Ga0207691_10030331
707 Ga0207691_10097074
708 Ga0207691_10283350
709 Ga0207711_10328128
710 Ga0207689_10340289
711 Ga0207679_10018662
712 Ga0207679_10025480
713 Ga0207679_10066313
714 Ga0207679_10173572
715 Ga0207651_10004586
716 Ga0207651_10031369
717 Ga0207651_10037827
718 Ga0207712_10024276
719 Ga0207712_10107475
720 Ga0207668_10037523
721 Ga0207703_10119709
722 Ga0207708_10022097
723 Ga0207708_10136683
724 Ga0207708_10253725
725 Ga0207641_10025410
726 Ga0207641_10288252
727 Ga0207648_10200850
728 Ga0207648_10203856
729 Ga0207648_10263169
730 Ga0207676_10036935
731 Ga0207676_10083448
732 Ga0207676_10489748
733 Ga0207675_100126427
734 Ga0207675_100285854
735 Ga0209813_10087320
736 Ga0207428_10000359
737 Ga0207428_10002202
738 Ga0207428_10004851
739 Ga0207428_10013672
740 Ga0207428_10173573
741 Ga0268265_10089685
742 Ga0268265_10446090
743 Ga0268264_10317223
744 Ga0265338_10313153
745 Ga0265332_10006083
746 Ga0265325_10026757
747 Ga0307408_100002509
748 Ga0307408_100011657
749 Ga0307408_100025745
750 Ga0307408_100030707
751 Ga0307408_100040331
752 Ga0307408_100239158
753 Ga0307405_10002306
754 Ga0307405_10013861
755 Ga0307413_10379289
756 Ga0307406_10047767
757 Ga0307407_10125145
758 Ga0307409_100084225
759 Ga0307409_100117310
760 Ga0307409_100260868
761 Ga0307409_100313491
762 Ga0307416_100020094
763 Ga0307416_100024381
764 Ga0307416_100112444
765 Ga0307416_100212860
766 Ga0307416_100516033
767 Ga0307414_10035264
768 Ga0307411_10007293
769 Ga0307411_10058029
770 Ga0307411_10133980
771 Ga0307411_10143702
772 Ga0307415_100006460
773 Ga0307415_100127844
774 Ga0373939_0056242
775 Ga0373931_0284117
776 Ga0373927_0171330
777 Ga0373937_0002419
778 Ga0373925_0216584
779 Ga0395900_0202250
780 Ga0395898_0155422
781 Ga0439433_0001690
782 Ga0439449_0096751
783 Ga0439450_021552
784 Ga0439450_025175
785 Ga0450923_005985
786 Ga0450897_011759
787 Ga0439446_0079243
788 Ga0450908_023396
789 Ga0439434_0057299
790 Ga0439435_0001687
791 Ga0439435_0003456
792 Ga0439435_0008433
793 Ga0439464_0002681
794 Ga0450916_009862
795 Ga0451577_0094949
796 Ga0495592_0008565
797 Ga0495629_0006962
798 Ga0495651_0043794
799 Ga0495580_0000779
800 Ga0495580_0102107
801 Ga0495582_0057195
802 Ga0495639_0055307
803 Ga0495608_0029267
804 Ga0495608_0099541
805 Ga0495618_0145826
806 Ga0495628_0211861
807 Ga0495630_0033186
808 Ga0495643_0002072
809 Ga0495663_0002671
810 Ga0495642_0009590
811 Ga0495652_0260823
812 Ga0495652_0353609
813 Ga0495598_0008931
814 Ga0495598_0032272
815 Ga0495609_0046209
816 Ga0495621_0008304
817 Ga0495621_0010530
818 Ga0495645_0009433
819 Ga0495645_0079912
820 Ga0495667_0012142
821 Ga0495656_0090292
822 Ga0495635_0286628
823 Ga0495599_0087996
824 Ga0495599_0219303
825 Ga0495623_0078875
826 Ga0495646_0121682
827 Ga0495613_0172372
828 Ga0495613_0239730
829 Ga0495670_0179917
830 Ga0495600_0075400
831 Ga0495604_0285073
832 Ga0495604_0287800
833 Ga0495674_0007257
834 Ga0495674_0024479
835 Ga0495674_0107753
836 Ga0495674_0232816
837 Ga0495676_0153616
838 Ga0495680_0268117
839 Ga0495675_0005152
840 Ga0495675_0029199
841 Ga0495677_0042891
842 Ga0495684_0012203
843 Ga0495684_0015242
844 Ga0495684_0051652
845 Ga0495684_0097805
846 Ga0495684_0290870
847 Ga0495602_0073387
848 Ga0495602_0104874
849 Ga0495602_0106025
850 Ga0496109_0011381
851 Ga0496109_0256272
852 Ga0496110_0317176
853 Ga0496112_0040025
854 Ga0496112_0539479
855 Ga0496113_0487260
856 Ga0496114_0444707
857 Ga0501291_008829
858 Ga0501299_000361
859 Ga0501033_0030806
860 Ga0501034_0020858
861 Ga0501036_0068832
862 Ga0501036_0147028
863 Ga0501038_0106314
864 Ga0501039_0002646
865 Ga0501039_0042849
866 Ga0501039_0120959
867 Ga0501040_0017127
868 Ga0501040_0066390
869 Ga0501041_0025527
870 Ga0501042_0002643
871 Ga0501042_0094632
872 Ga0501043_0014041
873 Ga0501047_0355177
874 Ga0501048_0131106
875 Ga0501068_0007856
876 Ga0501071_0008591
877 Ga0501071_0448035
878 Ga0501072_0014654
879 Ga0501072_0039807
880 Ga0501073_0065266
881 Ga0501074_0069633
882 Ga0501075_0000973
883 Ga0501075_0026354
884 Ga0501076_0000463
885 Ga0501076_0062070
886 Ga0501077_0031464
887 Ga0501222_014787
888 Ga0501079_0023781
889 Ga0501079_0052153
890 Ga0501079_0141861
891 Ga0501080_0038361
892 Ga0501081_0000186
893 Ga0501081_0032605
894 Ga0501081_0186112
895 Ga0501083_0163098
896 Ga0501045_0012283
897 Ga0501045_0078813
898 nmdc:mga03683_8722_c1
899 nmdc:mga00v17_131251_c1
900 nmdc:mga00v17_180600_c1
901 nmdc:mga00v17_266941_c1
902 nmdc:mga06z11_239766_c1
903 nmdc:mga04h51_79862_c1
904 nmdc:mga07m45_29090_c1
905 nmdc:mga05p37_122492_c1
906 nmdc:mga05p37_223866_c1
907 nmdc:mga05p37_32789_c1
908 nmdc:mga05p37_415_c1
909 nmdc:mga05p37_509243_c1
910 nmdc:mga05p37_76836_c1
911 nmdc:mga05p37_77375_c1
912 nmdc:mga05p37_92809_c1
913 nmdc:mga05p37_9656_c1
914 nmdc:mga09592_161848_c1
915 nmdc:mga09592_1775_c1
916 nmdc:mga09592_20746_c1
917 nmdc:mga09592_494651_c1
918 nmdc:mga09592_6907_c1
919 nmdc:mga09592_9255_c1
920 nmdc:mga0qj67_206389_c1
921 nmdc:mga0qj67_43301_c1
922 nmdc:mga0qj67_61504_c1
923 nmdc:mga0qj67_9272_c1
924 nmdc:mga06r32_151467_c1
925 nmdc:mga06r32_169402_c1
926 nmdc:mga06r32_2407_c2
927 nmdc:mga06r32_262603_c1
928 nmdc:mga06r32_4389_c1
929 nmdc:mga06r32_507745_c1
930 nmdc:mga08y16_121182_c1
931 nmdc:mga08y16_24387_c1
932 nmdc:mga08y16_24851_c1
933 nmdc:mga08y16_256752_c1
934 nmdc:mga08y16_4049_c1
935 nmdc:mga08y16_442464_c1
936 nmdc:mga08y16_45069_c1
937 nmdc:mga08y16_632203_c1
938 nmdc:mga08y16_644076_c1
939 nmdc:mga08y16_712_c1
940 nmdc:mga0n895_135343_c1
941 nmdc:mga0n895_288341_c1
942 nmdc:mga0n895_58737_c1
943 nmdc:mga0n895_62441_c1
944 nmdc:mga0n895_68571_c1
945 nmdc:mga0rr50_63259_c1
946 nmdc:mga0rr50_7203_c1
947 nmdc:mga0rr50_89763_c1
948 nmdc:mga08x19_12022_c1
949 nmdc:mga0a205_12873_c1
950 nmdc:mga0a205_1550_c1
951 nmdc:mga0a205_157080_c1
952 nmdc:mga0a205_18366_c1
953 nmdc:mga0a205_206168_c1
954 nmdc:mga0a205_6079_c1
955 nmdc:mga0a205_65439_c1
956 nmdc:mga0a205_75993_c1
957 Ga0495601_0068753
958 Ga0495619_0289462
959 Ga0500628_001888
960 Ga0500568_0002689
961 Ga0501084_0001783
962 Ga0501084_0085544
963 Ga0501082_0002935
964 Ga0501082_0060819
965 Ga0501082_0074888
966 Ga0501082_0138164
967 Ga0530510_0148422
968 Ga0530510_0389664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

5

316

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7275 1 310
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.7207 1 311
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.7135 1 311
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7111 1 310
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.6971 3 311
ID Description Score Start End Superfamily
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7831 93 299 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7686 20 310 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7648 93 299 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7555 20 310 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.754 4 311 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7V8XZB6-F1-model_v4 Amidohydrolase family protein 0.9812 46 314 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8EV86-F1-model_v4 Amidohydrolase 0.9795 3 312 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8FE32-F1-model_v4 Amidohydrolase 0.9759 2 270 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2D9M1G3-F1-model_v4 Amidohydrolase 0.9752 2 312 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8EV86-F1-model_v4 Amidohydrolase 0.9728 3 312 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map