F452852

General Info

Members Datasets Scaffolds Average Seq Length
483 335 341 225

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_000849|Ga0500618_000849_13301_13981
Length 205
Sequence MTHLLDRPAWNALVTVHADFAEGSALARRYDPSIVLFAAPADDTPESLAALAALPAASEVLLLVEAGPITVPPGLEITLESVLVQMLAEKTFLATLTKPGPFTLKAQALGTFWGIRVDGRIVAMCGQRMRQLGFSELSGLCVHPDFQGKGLGKLMLRFVAGEISARNEAVYLHAYKTNTGAIALYQSLGFAIRADMNMKVVKRAG

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
7 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
8 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
9 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
10 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
11 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
12 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
13 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
14 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
15 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
16 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
17 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
18 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
19 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
20 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
21 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
22 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
23 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
24 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
25 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
26 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
27 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
28 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
29 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
30 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
31 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
32 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
33 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
34 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
35 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
36 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
37 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
38 2718217882 Rhizobium sp. N741 Isolate Nodule
39 2718218009 Rhizobium sp. N561 Isolate Nodule
40 2718218363 Rhizobium sp. N113 Isolate Nodule
41 2718218365 Rhizobium sp. N731 Isolate Nodule
42 2718218366 Rhizobium sp. N621 Isolate Nodule
43 2721755514 Rhizobium sp. N6212 Isolate Nodule
44 2721755810 Rhizobium sp. N871 Isolate Nodule
45 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
46 2728369365 Rhizobium sp. N1341 Isolate Nodule
47 2728369397 Rhizobium sp. N1314 Isolate Nodule
48 2738541293 Rhizobium sp. GV031 Isolate Unclassified
49 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
50 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
51 2791355256 Rhizobium sp. M10 Isolate Nodule
52 2791355260 Rhizobium sp. L9 Isolate Nodule
53 2791355261 Rhizobium sp. J15 Isolate Nodule
54 2791355262 Rhizobium sp. M1 Isolate Nodule
55 2791355264 Rhizobium sp. S9 Isolate Nodule
56 2791355265 Rhizobium sp. H4 Isolate Nodule
57 2791355267 Rhizobium sp. L18 Isolate Nodule
58 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
59 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
60 2802429633 Rhizobium anhuiense J3 Isolate Nodule
61 2802429634 Rhizobium anhuiense S10 Isolate Nodule
62 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
63 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
64 2802429637 Rhizobium anhuiense C15 Isolate Nodule
65 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
66 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
67 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
68 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
69 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
70 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
71 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
72 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
73 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
74 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
75 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
76 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
77 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
78 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
79 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
80 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
81 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
82 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
83 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
84 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
85 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
86 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
87 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
88 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
89 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
90 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
91 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
92 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
93 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
94 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
95 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
96 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
97 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
98 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
99 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
100 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
101 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
102 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
103 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
104 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
105 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
106 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
107 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
108 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
109 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
110 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
111 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
112 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
113 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
114 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
115 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
116 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
117 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
118 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
119 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
120 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
121 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
122 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
123 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
124 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
125 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
126 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
127 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
128 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
129 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
130 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
131 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
132 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
133 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
134 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
135 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
136 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
137 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
138 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
139 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
140 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
141 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
142 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
145 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
146 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
147 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
148 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
149 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
150 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
151 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
161 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
162 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
171 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
172 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
173 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
205 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
206 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
207 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
208 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
301 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
304 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
308 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
313 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
314 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
315 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
316 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
317 8005382845 Rhizobium sp. R634 Isolate Nodule
318 8005395548 Rhizobium sp. R339 Isolate Nodule
319 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
320 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
321 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
322 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
323 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
324 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
325 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
326 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
327 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
328 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
329 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
330 8024501048 Rhizobium sp. H4 Isolate Nodule
331 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
332 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
333 8056382006 Rhizobium croatiense 13T Isolate Nodule
334 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
335 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.6
Metatranscriptomes 0
Isolates 29.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.67
Nodule 23.6
Rhizoplane 2.48
Rhizosphere 27.95
Stem 0
Stem Tuber 0
Unclassified 20.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000016 3300002704 Bacteria 163128
2 JGI25156J39149_1000018 3300002705 Bacteria 163121
3 JGI25156J39149_1000046 3300002705 Bacteria 102206
4 JGI25162J39368_1000804 3300002737 Bacteria 20830
5 JGI25154J39366_1000018 3300002738 Bacteria 251612
6 JGI25158J39367_1000499 3300002739 Bacteria 7922
7 JGI25157J39369_1000022 3300002741 Bacteria 163121
8 JGI25157J39369_1000215 3300002741 Bacteria 47335
9 JGI25152J39213_1002412 3300002773 Bacteria 7127
10 JGI25152J39213_1004429 3300002773 Bacteria 4424
11 JGI25152J39213_1012339 3300002773 Bacteria 1841
12 JGI25150J39212_1006674 3300002774 Bacteria 2364
13 JGI25159J45721_1004319 3300002987 Bacteria 4748
14 JGI25151J46595_10000146 3300003187 Bacteria 93373
15 JGI25151J46595_10000464 3300003187 Bacteria 38808
16 JGI25151J46595_10005849 3300003187 Bacteria 6291
17 JGI25151J46595_10056076 3300003187 Bacteria 1295
18 JGI25165J46597_1000416 3300003214 Bacteria 44195
19 JGI25165J46597_1005261 3300003214 Bacteria 2540
20 JGI25153J46596_10007382 3300003215 Bacteria 5419
21 JGI25153J46596_10007595 3300003215 Bacteria 5303
22 JGI25153J46596_10011015 3300003215 Bacteria 4033
23 JGI25153J46596_10030503 3300003215 Bacteria 1834
24 rootH1_10122008 3300003323 Bacteria 3238
25 rootH1_10326835 3300003323 Bacteria 2406
26 JGI25160J50197_1000053 3300003354 Bacteria 127632
27 JGI25160J50197_1001340 3300003354 Bacteria 12419
28 JGI25161J50226_1000039 3300003374 Bacteria 127632
29 JGI25161J50226_1000283 3300003374 Bacteria 28981
30 Ga0055526_1000946 3300003771 Bacteria 21518
31 Ga0055526_1028082 3300003771 Bacteria 1713
32 Ga0055524_1004489 3300003775 Bacteria 6431
33 Ga0055524_1008553 3300003775 Bacteria 4243
34 Ga0055524_1011912 3300003775 Bacteria 3367
35 Ga0055528_1000549 3300003790 Bacteria 28640
36 Ga0055528_1006146 3300003790 Bacteria 5481
37 Ga0055540_1000177 3300003792 Bacteria 62976
38 Ga0055540_1005952 3300003792 Bacteria 4961
39 Ga0055543_1000015 3300004625 Bacteria 177197
40 Ga0055543_1000060 3300004625 Bacteria 98330
41 Ga0055543_1000839 3300004625 Bacteria 14922
42 Ga0065165_1000361 3300005262 Bacteria 74514
43 Ga0065165_1015662 3300005262 Bacteria 2882
44 Ga0065165_1026792 3300005262 Bacteria 1890
45 Ga0070670_100041278 3300005331 Bacteria 3966
46 Ga0070667_100412650 3300005367 Bacteria 1230
47 Ga0070663_100157506 3300005455 Bacteria 1746
48 Ga0070665_100042163 3300005548 Bacteria 4587
49 Ga0070665_101084482 3300005548 Bacteria 812
50 Ga0068855_100157125 3300005563 Bacteria 2583
51 Ga0075365_10008623 3300006038 Bacteria 5805
52 Ga0075363_100048591 3300006048 Bacteria 2257
53 Ga0075362_10006188 3300006177 Bacteria 4444
54 Ga0075369_10027804 3300006186 Bacteria 2366
55 Ga0075366_10008373 3300006195 Bacteria 5745
56 Ga0075370_10085385 3300006353 Bacteria 1817
57 Ga0079104_1000884 3300006946 Bacteria 24591
58 Ga0105244_10156467 3300009036 Bacteria 1090
59 Ga0105240_10000013 3300009093 Bacteria 483458
60 Ga0105248_10386608 3300009177 Bacteria 1575
61 Ga0105237_10000949 3300009545 Bacteria 38978
62 Ga0105238_10082733 3300009551 Bacteria 3200
63 Ga0105239_10010104 3300010375 Bacteria 10579
64 Ga0157370_10004388 3300013104 Bacteria 16193
65 Ga0163162_10319833 3300013306 Bacteria 1684
66 Ga0182008_10008431 3300014497 Bacteria 5626
67 Ga0182007_10004002 3300015262 Bacteria 6800
68 Ga0209435_100017 3300025206 Bacteria 303699
69 Ga0209436_100061 3300025208 Bacteria 58629
70 Ga0207427_109037 3300025231 Bacteria 1086
71 Ga0209437_100104 3300025233 Bacteria 220736
72 Ga0207425_1000046 3300025245 Bacteria 189433
73 Ga0207425_1003220 3300025245 Bacteria 5331
74 Ga0207425_1014621 3300025245 Bacteria 1778
75 Ga0209646_1000048 3300025246 Bacteria 303808
76 Ga0209026_1000035 3300025250 Bacteria 303808
77 Ga0209677_101582 3300025253 Bacteria 9653
78 Ga0209148_1015760 3300025254 Bacteria 1313
79 Ga0209759_1000027 3300025256 Bacteria 303808
80 Ga0209129_1000171 3300025258 Bacteria 95724
81 Ga0209129_1000307 3300025258 Bacteria 44447
82 Ga0209129_1001327 3300025258 Bacteria 13978
83 Ga0209129_1003217 3300025258 Bacteria 7286
84 Ga0209129_1009623 3300025258 Bacteria 2516
85 Ga0209233_1000054 3300025261 Bacteria 439669
86 Ga0209233_1000646 3300025261 Bacteria 17234
87 Ga0209673_1000010 3300025273 Bacteria 596656
88 Ga0209673_1002016 3300025273 Bacteria 15617
89 Ga0209673_1002085 3300025273 Bacteria 15030
90 Ga0209673_1006098 3300025273 Bacteria 5910
91 Ga0209130_1000020 3300025284 Bacteria 379297
92 Ga0209130_1000038 3300025284 Bacteria 264226
93 Ga0209675_1031225 3300025291 Bacteria 1261
94 Ga0209676_1022446 3300025292 Bacteria 2091
95 Ga0209025_1000137 3300025294 Bacteria 190136
96 Ga0209025_1000563 3300025294 Bacteria 68086
97 Ga0209025_1000927 3300025294 Bacteria 44856
98 Ga0209025_1002842 3300025294 Bacteria 17370
99 Ga0209025_1014918 3300025294 Bacteria 4733
100 Ga0209564_1000265 3300025295 Bacteria 110606
101 Ga0209564_1004995 3300025295 Bacteria 7800
102 Ga0209564_1008091 3300025295 Bacteria 5262
103 Ga0209758_1000123 3300025297 Bacteria 190136
104 Ga0209758_1000534 3300025297 Bacteria 60556
105 Ga0209758_1001457 3300025297 Bacteria 27782
106 Ga0209758_1012652 3300025297 Bacteria 4696
107 Ga0209758_1012944 3300025297 Bacteria 4607
108 Ga0209758_1013086 3300025297 Bacteria 4562
109 Ga0209758_1029593 3300025297 Bacteria 2285
110 Ga0209758_1045599 3300025297 Bacteria 1590
111 Ga0209050_1018608 3300025298 Bacteria 2687
112 Ga0209256_1000655 3300025299 Bacteria 47114
113 Ga0209256_1002077 3300025299 Bacteria 17609
114 Ga0209256_1009344 3300025299 Bacteria 4320
115 Ga0207426_1000008 3300025302 Bacteria 848730
116 Ga0207426_1000081 3300025302 Bacteria 304502
117 Ga0207426_1000408 3300025302 Bacteria 72326
118 Ga0209051_1000125 3300025303 Bacteria 142863
119 Ga0209051_1004790 3300025303 Bacteria 8163
120 Ga0209051_1031143 3300025303 Bacteria 2057
121 Ga0209051_1052492 3300025303 Bacteria 1346
122 Ga0209257_1003624 3300025304 Bacteria 12995
123 Ga0209257_1027402 3300025304 Bacteria 1897
124 Ga0207647_10151210 3300025904 Bacteria 1357
125 Ga0207695_10000044 3300025913 Bacteria 440819
126 Ga0207671_10000043 3300025914 Bacteria 206915
127 Ga0207694_10053250 3300025924 Bacteria 3137
128 Ga0207650_10000911 3300025925 Bacteria 22288
129 Ga0207711_10266675 3300025941 Bacteria 1575
130 Ga0207640_10204548 3300025981 Bacteria 1499
131 Ga0207658_10343890 3300025986 Bacteria 1297
132 Ga0209281_1000034 3300027111 Bacteria 382562
133 Ga0209371_1002516 3300027312 Bacteria 10152
134 Ga0268266_10029374 3300028379 Bacteria 4674
135 Ga0268266_10643208 3300028379 Bacteria 1020
136 Ga0307515_10010740 3300028794 Bacteria 17490
137 Ga0268256_1016462 3300030500 Bacteria 2118
138 Ga0307513_10036226 3300031456 Bacteria 5509
139 Ga0307405_10016982 3300031731 Bacteria 3984
140 Ga0307405_10195234 3300031731 Bacteria 1465
141 Ga0307406_10026280 3300031901 Bacteria 3494
142 Ga0307412_10039612 3300031911 Bacteria 3044
143 Ga0436365_0686133 3300039437 Bacteria 883
144 Ga0439465_0010315 3300041413 Bacteria 2937
145 Ga0439465_0193945 3300041413 Bacteria 738
146 Ga0451797_0254921 3300041453 Bacteria 1026
147 Ga0451798_0596649 3300041458 Bacteria 1982
148 Ga0451833_0190634 3300041491 Bacteria 2524
149 Ga0451837_0542867 3300041494 Bacteria 1363
150 Ga0451839_0259588 3300041496 Bacteria 4166
151 Ga0451839_0892333 3300041496 Bacteria 2403
152 Ga0451841_0098319 3300041498 Bacteria 5327
153 Ga0451841_0167886 3300041498 Bacteria 4373
154 Ga0451845_0002142 3300041501 Bacteria 3819
155 Ga0451845_0418311 3300041501 Bacteria 4918
156 Ga0451847_0106237 3300041503 Bacteria 3525
157 Ga0451847_0311569 3300041503 Bacteria 3654
158 Ga0451849_1037098 3300041505 Bacteria 4012
159 Ga0451851_0495644 3300041507 Bacteria 2824
160 Ga0451851_0598815 3300041507 Bacteria 3863
161 Ga0451843_0576612 3300041509 Bacteria 3756
162 Ga0451853_3429884 3300041512 Bacteria 1254
163 Ga0439462_0084994 3300042015 Bacteria 866
164 Ga0450906_025589 3300042145 Bacteria 1049
165 Ga0466965_0097330 3300044683 Bacteria 1502
166 Ga0466966_0031156 3300044684 Bacteria 3459
167 Ga0466963_0035063 3300044694 Bacteria 3267
168 Ga0466970_0000095 3300044765 Bacteria 37807
169 Ga0466958_0006038 3300045836 Bacteria 6564
170 Ga0466967_0015530 3300045976 Bacteria 5971
171 Ga0495592_0205476 3300046454 Bacteria 1326
172 Ga0495629_0020115 3300046459 Bacteria 4766
173 Ga0495638_0001134 3300046460 Bacteria 25773
174 Ga0495638_0073604 3300046460 Bacteria 2085
175 Ga0495605_0039934 3300046474 Bacteria 2347
176 Ga0495605_0088914 3300046474 Bacteria 1434
177 Ga0495662_0035439 3300046476 Bacteria 2407
178 Ga0495664_0263859 3300046477 Bacteria 1041
179 Ga0495583_0032746 3300046506 Bacteria 2507
180 Ga0495583_0098862 3300046506 Bacteria 1247
181 Ga0495606_0004697 3300046507 Bacteria 13488
182 Ga0495606_0011961 3300046507 Bacteria 7012
183 Ga0495606_0253404 3300046507 Bacteria 975
184 Ga0495606_0327092 3300046507 Bacteria 821
185 Ga0495606_0347973 3300046507 Bacteria 787
186 Ga0495610_0003664 3300046512 Bacteria 11821
187 Ga0495610_0060894 3300046512 Bacteria 1795
188 Ga0495610_0148904 3300046512 Bacteria 1001
189 Ga0495610_0164868 3300046512 Bacteria 934
190 Ga0495620_0055183 3300046515 Bacteria 1675
191 Ga0495620_0112557 3300046515 Bacteria 1077
192 Ga0495628_0413944 3300046516 Bacteria 983
193 Ga0495631_0001584 3300046518 Bacteria 13671
194 Ga0495632_0003362 3300046519 Bacteria 11400
195 Ga0495632_0031652 3300046519 Bacteria 2732
196 Ga0495632_0031708 3300046519 Bacteria 2729
197 Ga0495643_0004123 3300046522 Bacteria 10335
198 Ga0495643_0026735 3300046522 Bacteria 3251
199 Ga0495643_0054395 3300046522 Bacteria 2143
200 Ga0495648_0030039 3300046524 Bacteria 3600
201 Ga0495654_0001572 3300046530 Bacteria 15496
202 Ga0495654_0056018 3300046530 Bacteria 1907
203 Ga0495654_0070811 3300046530 Bacteria 1653
204 Ga0495640_0446461 3300046533 Bacteria 790
205 Ga0495609_0035524 3300046538 Bacteria 2256
206 Ga0495597_0051667 3300046542 Bacteria 1811
207 Ga0495656_0043153 3300046615 Bacteria 1892
208 Ga0495668_0009467 3300046616 Bacteria 5984
209 Ga0495668_0084573 3300046616 Bacteria 1740
210 Ga0495625_0002255 3300046660 Bacteria 21195
211 Ga0495625_0018027 3300046660 Bacteria 5517
212 Ga0495661_0209498 3300046665 Bacteria 1016
213 Ga0495661_0266090 3300046665 Bacteria 869
214 Ga0495658_0011233 3300046683 Bacteria 4498
215 Ga0495613_0319820 3300046689 Bacteria 1071
216 Ga0495624_0378285 3300046690 Bacteria 851
217 Ga0495670_0059899 3300046691 Bacteria 1912
218 Ga0495671_0101947 3300046692 Bacteria 1403
219 Ga0495671_0136282 3300046692 Bacteria 1197
220 Ga0495649_0091785 3300046694 Bacteria 1618
221 Ga0495649_0130693 3300046694 Bacteria 1325
222 Ga0495600_0026997 3300046809 Bacteria 3709
223 Ga0495660_0047145 3300046810 Bacteria 2361
224 Ga0495660_0076627 3300046810 Bacteria 1761
225 Ga0495672_0005525 3300047320 Bacteria 10005
226 Ga0495683_0072067 3300047323 Bacteria 1695
227 Ga0495686_0001486 3300047472 Bacteria 25489
228 Ga0495686_0007917 3300047472 Bacteria 7892
229 Ga0495686_0010881 3300047472 Bacteria 6442
230 Ga0495686_0112203 3300047472 Bacteria 1633
231 Ga0495686_0128317 3300047472 Bacteria 1506
232 Ga0495686_0141523 3300047472 Bacteria 1419
233 Ga0495602_0597879 3300048088 Bacteria 759
234 Ga0496100_0013013 3300048903 Bacteria 4787
235 Ga0496101_0061362 3300048904 Bacteria 2730
236 Ga0496102_0010779 3300048905 Bacteria 7873
237 Ga0496103_0005838 3300048906 Bacteria 7349
238 Ga0496105_0452896 3300048908 Bacteria 1013
239 Ga0496106_0006078 3300048909 Bacteria 8935
240 Ga0496110_0055542 3300048913 Bacteria 3485
241 Ga0496111_0061856 3300048914 Bacteria 2714
242 Ga0496113_0040164 3300048916 Bacteria 3447
243 Ga0496116_0004457 3300048919 Bacteria 13343
244 Ga0496116_0008842 3300048919 Bacteria 8671
245 Ga0496116_0015899 3300048919 Bacteria 5919
246 Ga0496116_0020164 3300048919 Bacteria 5072
247 Ga0496116_0023490 3300048919 Bacteria 4589
248 Ga0496116_0052473 3300048919 Bacteria 2701
249 Ga0496116_0052554 3300048919 Bacteria 2698
250 Ga0496116_0199364 3300048919 Bacteria 1049
251 Ga0496116_0254635 3300048919 Unclassified 871
252 Ga0496117_0003614 3300048920 Bacteria 17814
253 Ga0496117_0010221 3300048920 Bacteria 8599
254 Ga0496117_0030997 3300048920 Bacteria 4091
255 Ga0496117_0033189 3300048920 Bacteria 3907
256 Ga0496118_0004165 3300048921 Bacteria 17449
257 Ga0496118_0031163 3300048921 Bacteria 4429
258 Ga0496118_0086457 3300048921 Bacteria 2178
259 Ga0496119_0012204 3300048922 Bacteria 7008
260 Ga0496119_0019452 3300048922 Bacteria 5000
261 Ga0496120_0007611 3300048923 Bacteria 8028
262 Ga0496120_0159058 3300048923 Bacteria 1128
263 Ga0496121_0003229 3300048924 Bacteria 23446
264 Ga0496121_0006258 3300048924 Bacteria 14896
265 Ga0496121_0019047 3300048924 Bacteria 6886
266 Ga0496121_0026147 3300048924 Bacteria 5512
267 Ga0496121_0028214 3300048924 Bacteria 5230
268 Ga0496121_0033896 3300048924 Bacteria 4608
269 Ga0496121_0150838 3300048924 Bacteria 1710
270 Ga0496121_0180278 3300048924 Bacteria 1525
271 Ga0496121_0197188 3300048924 Bacteria 1438
272 Ga0496121_0329968 3300048924 Bacteria 1024
273 Ga0496121_0389473 3300048924 Unclassified 916
274 Ga0496122_0010069 3300048925 Bacteria 9817
275 Ga0496122_0014317 3300048925 Bacteria 7678
276 Ga0496122_0022687 3300048925 Bacteria 5571
277 Ga0496122_0047979 3300048925 Bacteria 3290
278 Ga0496122_0195074 3300048925 Bacteria 1190
279 Ga0496122_0284097 3300048925 Bacteria 902
280 Ga0496123_0008910 3300048926 Bacteria 9124
281 Ga0496123_0014316 3300048926 Bacteria 6584
282 Ga0496123_0024054 3300048926 Bacteria 4642
283 Ga0496123_0048132 3300048926 Bacteria 2871
284 Ga0496123_0058181 3300048926 Bacteria 2510
285 Ga0496123_0059301 3300048926 Bacteria 2475
286 Ga0496123_0186543 3300048926 Bacteria 1077
287 Ga0496124_0002089 3300048927 Bacteria 26962
288 Ga0496124_0015523 3300048927 Bacteria 7292
289 Ga0496124_0018624 3300048927 Bacteria 6496
290 Ga0496124_0048384 3300048927 Bacteria 3634
291 Ga0496124_0091403 3300048927 Bacteria 2480
292 Ga0496125_0014106 3300048928 Bacteria 7803
293 Ga0496125_0015361 3300048928 Bacteria 7412
294 Ga0496125_0021913 3300048928 Bacteria 5944
295 Ga0496126_0062814 3300048929 Bacteria 3331
296 Ga0496126_0523397 3300048929 Unclassified 945
297 Ga0495678_002029 3300049459 Bacteria 14513
298 Ga0495678_025749 3300049459 Bacteria 2522
299 Ga0501032_0122522 3300049569 Bacteria 1718
300 Ga0501036_0158754 3300049572 Bacteria 1907
301 Ga0501039_0070439 3300049575 Bacteria 2717
302 Ga0501043_0090628 3300049579 Bacteria 2404
303 Ga0501046_0421503 3300049580 Bacteria 962
304 Ga0501047_0110528 3300049581 Bacteria 2631
305 Ga0501047_0279300 3300049581 Bacteria 1515
306 Ga0501067_0002286 3300049583 Bacteria 10584
307 Ga0501035_0134686 3300049822 Bacteria 2152
308 Ga0501044_0323965 3300049823 Bacteria 1465
309 nmdc:mga03683_18149_c3 3300050489 Bacteria 1285
310 nmdc:mga0k408_7049_c1 3300050493 Bacteria 6001
311 nmdc:mga06z11_498181_c1 3300050494 Bacteria 738
312 nmdc:mga0sz30_11965_c2 3300050516 Bacteria 2347
313 Ga0500610_0183196 3300053079 Bacteria 1023
314 Ga0495619_0289471 3300053085 Bacteria 1135
315 Ga0500651_0054028 3300053093 Bacteria 2519
316 Ga0500651_0127637 3300053093 Bacteria 1540
317 Ga0500557_000501 3300053105 Bacteria 5231
318 Ga0500562_033737 3300053108 Bacteria 1353
319 Ga0500569_025601 3300053109 Bacteria 1608
320 Ga0500569_027736 3300053109 Bacteria 1563
321 Ga0500594_0003894 3300053118 Bacteria 3288
322 Ga0500618_000849 3300053125 Bacteria 16428
323 Ga0500618_000875 3300053125 Bacteria 16083
324 Ga0500618_033550 3300053125 Bacteria 1197
325 Ga0500658_0000638 3300053134 Bacteria 14548
326 Ga0500658_0154991 3300053134 Bacteria 1034
327 Ga0500568_0001714 3300053139 Bacteria 13653
328 Ga0500568_0003195 3300053139 Bacteria 9316
329 Ga0500568_0041065 3300053139 Bacteria 1860
330 Ga0500577_0219671 3300053142 Bacteria 822
331 Ga0500590_005712 3300053148 Bacteria 6004
332 Ga0500616_0000576 3300053153 Bacteria 44650
333 Ga0500616_0005531 3300053153 Bacteria 8558
334 Ga0500616_0017972 3300053153 Bacteria 4003
335 Ga0500622_0003878 3300053156 Bacteria 9707
336 Ga0500622_0051610 3300053156 Bacteria 2116
337 Ga0500627_0050362 3300053158 Bacteria 1814
338 Ga0500636_0163711 3300053177 Bacteria 1210
339 Ga0500645_045941 3300053730 Bacteria 1282
340 Ga0501084_0052322 3300054114 Bacteria 3417
341 Ga0501082_0259561 3300060353 Bacteria 1511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0001486 Ga0495686_0001486_13489_14067 192
2 iso_pu_bacteria 2802429605 2805927756 199
3 3300025245 Ga0207425_1003220 Ga0207425_10032207 202
4 3300025258 Ga0209129_1003217 Ga0209129_10032176 202
5 3300025294 Ga0209025_1014918 Ga0209025_10149186 202
6 3300025297 Ga0209758_1013086 Ga0209758_10130866 202
7 3300053125 Ga0500618_000849 Ga0500618_000849_13301_13981 205
8 iso_pu_bacteria 8018127388 8018129696 212
9 3300053153 Ga0500616_0017972 Ga0500616_0017972_2789_3469 215
10 3300003187 JGI25151J46595_10000464 JGI25151J46595_1000046426 218
11 3300006353 Ga0075370_10085385 Ga0075370_100853852 218
12 3300025245 Ga0207425_1014621 Ga0207425_10146212 218
13 3300025258 Ga0209129_1001327 Ga0209129_10013273 218
14 3300025294 Ga0209025_1000563 Ga0209025_100056329 218
15 3300025297 Ga0209758_1000534 Ga0209758_100053437 218
16 3300003215 JGI25153J46596_10011015 JGI25153J46596_100110153 220
17 3300002739 JGI25158J39367_1000499 JGI25158J39367_10004993 221
18 3300002773 JGI25152J39213_1004429 JGI25152J39213_10044295 221
19 3300002987 JGI25159J45721_1004319 JGI25159J45721_10043192 221
20 3300003215 JGI25153J46596_10007382 JGI25153J46596_100073826 221
21 3300003323 rootH1_10326835 rootH1_103268352 221
22 3300003374 JGI25161J50226_1000283 JGI25161J50226_100028320 221
23 3300003792 Ga0055540_1005952 Ga0055540_10059522 221
24 3300004625 Ga0055543_1000060 Ga0055543_100006089 221
25 3300005262 Ga0065165_1026792 Ga0065165_10267923 221
26 3300005455 Ga0070663_100157506 Ga0070663_1001575062 221
27 3300025208 Ga0209436_100061 Ga0209436_10006134 221
28 3300025258 Ga0209129_1009623 Ga0209129_10096233 221
29 3300025284 Ga0209130_1000020 Ga0209130_100002034 221
30 3300025297 Ga0209758_1012652 Ga0209758_10126524 221
31 3300025302 Ga0207426_1000008 Ga0207426_1000008103 221
32 3300025303 Ga0209051_1031143 Ga0209051_10311433 221
33 3300025304 Ga0209257_1027402 Ga0209257_10274024 221
34 iso_pu_bacteria 2837678835 2837680538 221
35 iso_pu_bacteria 2510065019 2510133070 222
36 iso_pu_bacteria 2510461076 2510894434 222
37 iso_pu_bacteria 2510461076 2510899460 222
38 iso_pu_bacteria 2510917030 2511199243 222
39 iso_pu_bacteria 2513237084 2513569850 222
40 iso_pu_bacteria 2513237093 2513635584 222
41 iso_pu_bacteria 2513237103 2513713472 222
42 iso_pu_bacteria 2513237146 2513925190 222
43 iso_pu_bacteria 2513237162 2514021875 222
44 iso_pu_bacteria 2515154113 2515635506 222
45 iso_pu_bacteria 2515154114 2515645015 222
46 iso_pu_bacteria 2515154116 2515660160 222
47 iso_pu_bacteria 2516653077 2517035757 222
48 iso_pu_bacteria 2529292951 2530645324 222
49 iso_pu_bacteria 2582581298 2585223073 222
50 iso_pu_bacteria 2582581304 2585258276 222
51 iso_pu_bacteria 2585427528 2585540512 222
52 iso_pu_bacteria 2585427529 2585545656 222
53 iso_pu_bacteria 2585427593 2585838728 222
54 iso_pu_bacteria 2585427594 2585843464 222
55 iso_pu_bacteria 2599185170 2599417097 222
56 iso_pu_bacteria 2615840624 2616292670 222
57 iso_pu_bacteria 2718217882 2719180976 222
58 iso_pu_bacteria 2718218009 2719731725 222
59 iso_pu_bacteria 2718218363 2721147070 222
60 iso_pu_bacteria 2718218365 2721158598 222
61 iso_pu_bacteria 2718218366 2721163988 222
62 iso_pu_bacteria 2721755514 2722840158 222
63 iso_pu_bacteria 2721755810 2724044481 222
64 iso_pu_bacteria 2724679232 2725948717 222
65 iso_pu_bacteria 2728369365 2730164213 222
66 iso_pu_bacteria 2728369397 2730298230 222
67 iso_pu_bacteria 2738541293 2738800315 222
68 iso_pu_bacteria 2738541333 2739038008 222
69 iso_pu_bacteria 2791355256 2793298236 222
70 iso_pu_bacteria 2791355261 2793326476 222
71 iso_pu_bacteria 2791355262 2793337072 222
72 iso_pu_bacteria 2791355264 2793347507 222
73 iso_pu_bacteria 2791355265 2793352427 222
74 iso_pu_bacteria 2791355267 2793369640 222
75 iso_pu_bacteria 2802429606 2805935664 222
76 iso_pu_bacteria 2802429633 2806045367 222
77 iso_pu_bacteria 2802429634 2806055440 222
78 iso_pu_bacteria 2802429635 2806061483 222
79 iso_pu_bacteria 2802429636 2806068057 222
80 iso_pu_bacteria 2802429637 2806072595 222
81 iso_pu_bacteria 2821123053 2821125725 222
82 iso_pu_bacteria 2838035591 2838038696 222
83 iso_pu_bacteria 2838661181 2838661382 222
84 iso_pu_bacteria 2838668709 2838670203 222
85 iso_pu_bacteria 2838686498 2838689248 222
86 iso_pu_bacteria 2838701080 2838702574 222
87 iso_pu_bacteria 2838736955 2838737824 222
88 iso_pu_bacteria 2838742623 2838743537 222
89 iso_pu_bacteria 2841840854 2841841807 222
90 iso_pu_bacteria 2842140634 2842141585 222
91 iso_pu_bacteria 2842146304 2842146881 222
92 iso_pu_bacteria 2842180545 2842180765 222
93 iso_pu_bacteria 2842192696 2842196864 222
94 iso_pu_bacteria 2842205361 2842206259 222
95 iso_pu_bacteria 2842217011 2842222949 222
96 iso_pu_bacteria 2842250916 2842251946 222
97 iso_pu_bacteria 2842271015 2842273268 222
98 iso_pu_bacteria 2842278818 2842279716 222
99 iso_pu_bacteria 2842285085 2842287362 222
100 iso_pu_bacteria 2842304105 2842310070 222
101 iso_pu_bacteria 2842317721 2842318130 222
102 iso_pu_bacteria 2842402390 2842405108 222
103 iso_pu_bacteria 2842409023 2842411691 222
104 iso_pu_bacteria 2842415677 2842417859 222
105 iso_pu_bacteria 2842482326 2842485382 222
106 iso_pu_bacteria 2842489311 2842492905 222
107 iso_pu_bacteria 2842495871 2842496400 222
108 iso_pu_bacteria 2844454524 2844459397 222
109 iso_pu_bacteria 2857531043 2857532286 222
110 iso_pu_bacteria 2919100787 2919106241 222
111 iso_pu_bacteria 2933016740 2933018201 222
112 iso_pu_bacteria 2936367885 2936372966 222
113 iso_pu_bacteria 2936375103 2936381118 222
114 iso_pu_bacteria 3005409236 3005414346 222
115 iso_pu_bacteria 3005445848 3005448666 222
116 iso_pu_bacteria 639633055 639648305 222
117 iso_pu_bacteria 8005289223 8005294927 222
118 iso_pu_bacteria 8005301065 8005306908 222
119 iso_pu_bacteria 8005376324 8005378954 222
120 iso_pu_bacteria 8005382845 8005388135 222
121 iso_pu_bacteria 8005556819 8005557964 222
122 iso_pu_bacteria 8005563573 8005569137 222
123 iso_pu_bacteria 8005570704 8005575580 222
124 iso_pu_bacteria 8005688590 8005694826 222
125 iso_pu_bacteria 8018163183 8018168256 222
126 iso_pu_bacteria 8024479707 8024485909 222
127 iso_pu_bacteria 8024501048 8024505367 222
128 iso_pu_bacteria 8056375014 8056377215 222
129 iso_pu_bacteria 8056382006 8056388291 222
130 iso_pu_bacteria 8057874678 8057875322 222
131 iso_pu_bacteria 2513237085 2513575117 223
132 iso_pu_bacteria 2515075009 2515112020 223
133 iso_pu_bacteria 2515154134 2515738803 223
134 iso_pu_bacteria 2516653085 2517076175 223
135 iso_pu_bacteria 2517093000 2517094920 223
136 iso_pu_bacteria 2517287029 2517406553 223
137 iso_pu_bacteria 2524023209 2524457726 223
138 iso_pu_bacteria 2582581308 2585279744 223
139 iso_pu_bacteria 2582581315 2585326717 223
140 iso_pu_bacteria 2582581316 2585334931 223
141 iso_pu_bacteria 2585427526 2585528331 223
142 iso_pu_bacteria 2585427527 2585531853 223
143 iso_pu_bacteria 2585427530 2585551200 223
144 iso_pu_bacteria 2599185236 2599718758 223
145 iso_pu_bacteria 2615840626 2616306534 223
146 iso_pu_bacteria 2615840698 2616552844 223
147 iso_pu_bacteria 2765235942 2766062950 223
148 iso_pu_bacteria 2791355260 2793324311 223
149 iso_pu_bacteria 2818991453 2819638631 223
150 iso_pu_bacteria 2818991461 2819685150 223
151 iso_pu_bacteria 2838729681 2838730596 223
152 iso_pu_bacteria 2841851746 2841854787 223
153 iso_pu_bacteria 2842110456 2842110725 223
154 iso_pu_bacteria 2842156927 2842157650 223
155 iso_pu_bacteria 2842163707 2842164848 223
156 iso_pu_bacteria 2842229732 2842231177 223
157 iso_pu_bacteria 2842243621 2842244716 223
158 iso_pu_bacteria 2842257432 2842258529 223
159 iso_pu_bacteria 2842298080 2842300659 223
160 iso_pu_bacteria 2842357229 2842358223 223
161 iso_pu_bacteria 2842509118 2842509413 223
162 iso_pu_bacteria 2857516855 2857518488 223
163 iso_pu_bacteria 2933570622 2933576569 223
164 iso_pu_bacteria 2933586486 2933586751 223
165 iso_pu_bacteria 2935901341 2935904506 223
166 iso_pu_bacteria 8005307578 8005314293 223
167 iso_pu_bacteria 8005395548 8005396908 223
168 iso_pu_bacteria 8005460587 8005462679 223
169 iso_pu_bacteria 8005484373 8005485928 223
170 iso_pu_bacteria 8023680758 8023681113 223
171 iso_pu_bacteria 8046767195 8046769768 223
172 iso_pu_bacteria 8057575449 8057577385 223
173 3300025981 Ga0207640_10204548 Ga0207640_102045482 224
174 3300048919 Ga0496116_0052473 Ga0496116_0052473_413_1087 224
175 iso_pu_bacteria 8005682033 8005683727 224
176 3300002773 JGI25152J39213_1002412 JGI25152J39213_10024122 225
177 3300003187 JGI25151J46595_10005849 JGI25151J46595_100058497 225
178 3300025258 Ga0209129_1000307 Ga0209129_100030750 225
179 3300025294 Ga0209025_1000927 Ga0209025_100092711 225
180 3300025303 Ga0209051_1052492 Ga0209051_10524922 225
181 3300049572 Ga0501036_0158754 Ga0501036_0158754_72_749 225
182 3300002737 JGI25162J39368_1000804 JGI25162J39368_100080418 226
183 3300002773 JGI25152J39213_1012339 JGI25152J39213_10123393 226
184 3300002774 JGI25150J39212_1006674 JGI25150J39212_10066741 226
185 3300003187 JGI25151J46595_10000146 JGI25151J46595_100001464 226
186 3300003187 JGI25151J46595_10056076 JGI25151J46595_100560762 226
187 3300003214 JGI25165J46597_1000416 JGI25165J46597_100041635 226
188 3300003215 JGI25153J46596_10007595 JGI25153J46596_100075953 226
189 3300003215 JGI25153J46596_10030503 JGI25153J46596_100305033 226
190 3300003354 JGI25160J50197_1001340 JGI25160J50197_100134012 226
191 3300003771 Ga0055526_1000946 Ga0055526_10009466 226
192 3300003771 Ga0055526_1028082 Ga0055526_10280821 226
193 3300003775 Ga0055524_1004489 Ga0055524_10044892 226
194 3300003775 Ga0055524_1008553 Ga0055524_10085534 226
195 3300003775 Ga0055524_1011912 Ga0055524_10119122 226
196 3300003790 Ga0055528_1000549 Ga0055528_10005498 226
197 3300003790 Ga0055528_1006146 Ga0055528_10061462 226
198 3300003792 Ga0055540_1000177 Ga0055540_100017732 226
199 3300004625 Ga0055543_1000839 Ga0055543_10008398 226
200 3300005262 Ga0065165_1015662 Ga0065165_10156623 226
201 3300005331 Ga0070670_100041278 Ga0070670_1000412783 226
202 3300005548 Ga0070665_101084482 Ga0070665_1010844821 226
203 3300006038 Ga0075365_10008623 Ga0075365_100086236 226
204 3300006048 Ga0075363_100048591 Ga0075363_1000485912 226
205 3300006177 Ga0075362_10006188 Ga0075362_100061884 226
206 3300006186 Ga0075369_10027804 Ga0075369_100278042 226
207 3300006195 Ga0075366_10008373 Ga0075366_100083736 226
208 3300006946 Ga0079104_1000884 Ga0079104_10008848 226
209 3300013306 Ga0163162_10319833 Ga0163162_103198332 226
210 3300025231 Ga0207427_109037 Ga0207427_1090372 226
211 3300025233 Ga0209437_100104 Ga0209437_100104100 226
212 3300025245 Ga0207425_1000046 Ga0207425_10000462 226
213 3300025258 Ga0209129_1000171 Ga0209129_100017199 226
214 3300025261 Ga0209233_1000054 Ga0209233_100005435 226
215 3300025273 Ga0209673_1000010 Ga0209673_1000010474 226
216 3300025273 Ga0209673_1002016 Ga0209673_100201610 226
217 3300025273 Ga0209673_1002085 Ga0209673_100208512 226
218 3300025273 Ga0209673_1006098 Ga0209673_10060988 226
219 3300025291 Ga0209675_1031225 Ga0209675_10312252 226
220 3300025292 Ga0209676_1022446 Ga0209676_10224463 226
221 3300025294 Ga0209025_1000137 Ga0209025_1000137188 226
222 3300025294 Ga0209025_1002842 Ga0209025_100284211 226
223 3300025295 Ga0209564_1000265 Ga0209564_100026551 226
224 3300025295 Ga0209564_1004995 Ga0209564_10049952 226
225 3300025295 Ga0209564_1008091 Ga0209564_10080915 226
226 3300025297 Ga0209758_1000123 Ga0209758_1000123188 226
227 3300025297 Ga0209758_1001457 Ga0209758_10014578 226
228 3300025297 Ga0209758_1012944 Ga0209758_10129446 226
229 3300025297 Ga0209758_1029593 Ga0209758_10295932 226
230 3300025297 Ga0209758_1045599 Ga0209758_10455992 226
231 3300025298 Ga0209050_1018608 Ga0209050_10186081 226
232 3300025299 Ga0209256_1000655 Ga0209256_100065548 226
233 3300025299 Ga0209256_1002077 Ga0209256_100207716 226
234 3300025299 Ga0209256_1009344 Ga0209256_10093443 226
235 3300025302 Ga0207426_1000408 Ga0207426_100040824 226
236 3300025303 Ga0209051_1000125 Ga0209051_100012542 226
237 3300025303 Ga0209051_1004790 Ga0209051_10047909 226
238 3300025304 Ga0209257_1003624 Ga0209257_100362410 226
239 3300025925 Ga0207650_10000911 Ga0207650_1000091119 226
240 3300027111 Ga0209281_1000034 Ga0209281_1000034260 226
241 3300028379 Ga0268266_10643208 Ga0268266_106432081 226
242 3300028794 Ga0307515_10010740 Ga0307515_1001074010 226
243 3300031456 Ga0307513_10036226 Ga0307513_100362263 226
244 3300031731 Ga0307405_10016982 Ga0307405_100169824 226
245 3300031731 Ga0307405_10195234 Ga0307405_101952342 226
246 3300031901 Ga0307406_10026280 Ga0307406_100262802 226
247 3300031911 Ga0307412_10039612 Ga0307412_100396121 226
248 3300039437 Ga0436365_0686133 Ga0436365_0686133_129_809 226
249 3300041413 Ga0439465_0010315 Ga0439465_0010315_1343_2023 226
250 3300041413 Ga0439465_0193945 Ga0439465_0193945_19_699 226
251 3300041453 Ga0451797_0254921 Ga0451797_0254921_327_1010 226
252 3300041458 Ga0451798_0596649 Ga0451798_0596649_628_1308 226
253 3300041491 Ga0451833_0190634 Ga0451833_0190634_119_799 226
254 3300041494 Ga0451837_0542867 Ga0451837_0542867_275_955 226
255 3300041496 Ga0451839_0259588 Ga0451839_0259588_2856_3536 226
256 3300041496 Ga0451839_0892333 Ga0451839_0892333_1591_2274 226
257 3300041498 Ga0451841_0098319 Ga0451841_0098319_2121_2804 226
258 3300041498 Ga0451841_0167886 Ga0451841_0167886_838_1518 226
259 3300041501 Ga0451845_0002142 Ga0451845_0002142_1878_2561 226
260 3300041501 Ga0451845_0418311 Ga0451845_0418311_2205_2885 226
261 3300041503 Ga0451847_0106237 Ga0451847_0106237_663_1346 226
262 3300041503 Ga0451847_0311569 Ga0451847_0311569_455_1135 226
263 3300041505 Ga0451849_1037098 Ga0451849_1037098_976_1656 226
264 3300041507 Ga0451851_0495644 Ga0451851_0495644_237_917 226
265 3300041507 Ga0451851_0598815 Ga0451851_0598815_1303_1986 226
266 3300041509 Ga0451843_0576612 Ga0451843_0576612_145_825 226
267 3300041512 Ga0451853_3429884 Ga0451853_3429884_294_974 226
268 3300042015 Ga0439462_0084994 Ga0439462_0084994_31_711 226
269 3300042145 Ga0450906_025589 Ga0450906_025589_264_944 226
270 3300044683 Ga0466965_0097330 Ga0466965_0097330_512_1204 226
271 3300046454 Ga0495592_0205476 Ga0495592_0205476_436_1116 226
272 3300046459 Ga0495629_0020115 Ga0495629_0020115_221_901 226
273 3300046460 Ga0495638_0001134 Ga0495638_0001134_1361_2041 226
274 3300046460 Ga0495638_0073604 Ga0495638_0073604_1229_1912 226
275 3300046474 Ga0495605_0039934 Ga0495605_0039934_1245_1925 226
276 3300046474 Ga0495605_0088914 Ga0495605_0088914_736_1419 226
277 3300046476 Ga0495662_0035439 Ga0495662_0035439_878_1558 226
278 3300046477 Ga0495664_0263859 Ga0495664_0263859_200_880 226
279 3300046506 Ga0495583_0032746 Ga0495583_0032746_1036_1716 226
280 3300046506 Ga0495583_0098862 Ga0495583_0098862_496_1176 226
281 3300046507 Ga0495606_0011961 Ga0495606_0011961_5448_6131 226
282 3300046507 Ga0495606_0253404 Ga0495606_0253404_283_963 226
283 3300046507 Ga0495606_0327092 Ga0495606_0327092_68_748 226
284 3300046512 Ga0495610_0003664 Ga0495610_0003664_3445_4125 226
285 3300046512 Ga0495610_0060894 Ga0495610_0060894_235_918 226
286 3300046512 Ga0495610_0148904 Ga0495610_0148904_153_833 226
287 3300046515 Ga0495620_0055183 Ga0495620_0055183_176_856 226
288 3300046515 Ga0495620_0112557 Ga0495620_0112557_280_963 226
289 3300046516 Ga0495628_0413944 Ga0495628_0413944_252_932 226
290 3300046518 Ga0495631_0001584 Ga0495631_0001584_6535_7215 226
291 3300046519 Ga0495632_0003362 Ga0495632_0003362_8850_9530 226
292 3300046519 Ga0495632_0031652 Ga0495632_0031652_1485_2165 226
293 3300046519 Ga0495632_0031708 Ga0495632_0031708_1061_1744 226
294 3300046522 Ga0495643_0004123 Ga0495643_0004123_3373_4056 226
295 3300046522 Ga0495643_0026735 Ga0495643_0026735_2342_3022 226
296 3300046524 Ga0495648_0030039 Ga0495648_0030039_547_1227 226
297 3300046530 Ga0495654_0001572 Ga0495654_0001572_4435_5115 226
298 3300046530 Ga0495654_0056018 Ga0495654_0056018_307_987 226
299 3300046530 Ga0495654_0070811 Ga0495654_0070811_74_757 226
300 3300046533 Ga0495640_0446461 Ga0495640_0446461_77_757 226
301 3300046538 Ga0495609_0035524 Ga0495609_0035524_1218_1898 226
302 3300046542 Ga0495597_0051667 Ga0495597_0051667_385_1068 226
303 3300046615 Ga0495656_0043153 Ga0495656_0043153_772_1452 226
304 3300046616 Ga0495668_0009467 Ga0495668_0009467_1176_1856 226
305 3300046616 Ga0495668_0084573 Ga0495668_0084573_753_1433 226
306 3300046660 Ga0495625_0002255 Ga0495625_0002255_5970_6650 226
307 3300046660 Ga0495625_0018027 Ga0495625_0018027_4531_5214 226
308 3300046665 Ga0495661_0209498 Ga0495661_0209498_48_728 226
309 3300046665 Ga0495661_0266090 Ga0495661_0266090_155_838 226
310 3300046683 Ga0495658_0011233 Ga0495658_0011233_663_1343 226
311 3300046689 Ga0495613_0319820 Ga0495613_0319820_188_868 226
312 3300046690 Ga0495624_0378285 Ga0495624_0378285_50_730 226
313 3300046691 Ga0495670_0059899 Ga0495670_0059899_863_1543 226
314 3300046692 Ga0495671_0101947 Ga0495671_0101947_216_896 226
315 3300046692 Ga0495671_0136282 Ga0495671_0136282_298_978 226
316 3300046694 Ga0495649_0091785 Ga0495649_0091785_612_1295 226
317 3300046694 Ga0495649_0130693 Ga0495649_0130693_530_1210 226
318 3300046809 Ga0495600_0026997 Ga0495600_0026997_990_1670 226
319 3300046810 Ga0495660_0047145 Ga0495660_0047145_509_1189 226
320 3300046810 Ga0495660_0076627 Ga0495660_0076627_592_1275 226
321 3300047320 Ga0495672_0005525 Ga0495672_0005525_6571_7251 226
322 3300047323 Ga0495683_0072067 Ga0495683_0072067_304_987 226
323 3300047472 Ga0495686_0007917 Ga0495686_0007917_4001_4681 226
324 3300047472 Ga0495686_0010881 Ga0495686_0010881_1243_1923 226
325 3300047472 Ga0495686_0112203 Ga0495686_0112203_884_1567 226
326 3300048088 Ga0495602_0597879 Ga0495602_0597879_56_736 226
327 3300048909 Ga0496106_0006078 Ga0496106_0006078_4722_5402 226
328 3300048919 Ga0496116_0004457 Ga0496116_0004457_12626_13306 226
329 3300048919 Ga0496116_0008842 Ga0496116_0008842_837_1517 226
330 3300048919 Ga0496116_0015899 Ga0496116_0015899_983_1663 226
331 3300048919 Ga0496116_0020164 Ga0496116_0020164_3436_4116 226
332 3300048919 Ga0496116_0052554 Ga0496116_0052554_374_1117 226
333 3300048919 Ga0496116_0199364 Ga0496116_0199364_257_937 226
334 3300048919 Ga0496116_0254635 Ga0496116_0254635_129_809 226
335 3300048920 Ga0496117_0010221 Ga0496117_0010221_7155_7835 226
336 3300048920 Ga0496117_0030997 Ga0496117_0030997_1493_2173 226
337 3300048920 Ga0496117_0033189 Ga0496117_0033189_1582_2325 226
338 3300048921 Ga0496118_0031163 Ga0496118_0031163_327_1007 226
339 3300048921 Ga0496118_0086457 Ga0496118_0086457_74_754 226
340 3300048922 Ga0496119_0012204 Ga0496119_0012204_1294_1974 226
341 3300048924 Ga0496121_0006258 Ga0496121_0006258_12572_13315 226
342 3300048924 Ga0496121_0019047 Ga0496121_0019047_1841_2521 226
343 3300048924 Ga0496121_0028214 Ga0496121_0028214_3876_4556 226
344 3300048924 Ga0496121_0150838 Ga0496121_0150838_448_1128 226
345 3300048924 Ga0496121_0180278 Ga0496121_0180278_276_956 226
346 3300048924 Ga0496121_0197188 Ga0496121_0197188_56_736 226
347 3300048924 Ga0496121_0329968 Ga0496121_0329968_312_992 226
348 3300048924 Ga0496121_0389473 Ga0496121_0389473_209_889 226
349 3300048925 Ga0496122_0010069 Ga0496122_0010069_2632_3312 226
350 3300048925 Ga0496122_0014317 Ga0496122_0014317_1582_2325 226
351 3300048925 Ga0496122_0047979 Ga0496122_0047979_777_1457 226
352 3300048925 Ga0496122_0195074 Ga0496122_0195074_493_1173 226
353 3300048925 Ga0496122_0284097 Ga0496122_0284097_128_808 226
354 3300048926 Ga0496123_0008910 Ga0496123_0008910_8355_9035 226
355 3300048926 Ga0496123_0048132 Ga0496123_0048132_301_981 226
356 3300048926 Ga0496123_0058181 Ga0496123_0058181_854_1534 226
357 3300048926 Ga0496123_0059301 Ga0496123_0059301_167_910 226
358 3300048926 Ga0496123_0186543 Ga0496123_0186543_292_972 226
359 3300048927 Ga0496124_0002089 Ga0496124_0002089_10779_11459 226
360 3300048927 Ga0496124_0015523 Ga0496124_0015523_4968_5711 226
361 3300048927 Ga0496124_0048384 Ga0496124_0048384_1905_2585 226
362 3300048927 Ga0496124_0091403 Ga0496124_0091403_1135_1815 226
363 3300048928 Ga0496125_0014106 Ga0496125_0014106_1389_2069 226
364 3300048928 Ga0496125_0021913 Ga0496125_0021913_219_962 226
365 3300048929 Ga0496126_0062814 Ga0496126_0062814_518_1198 226
366 3300048929 Ga0496126_0523397 Ga0496126_0523397_154_897 226
367 3300049459 Ga0495678_002029 Ga0495678_002029_12783_13463 226
368 3300049459 Ga0495678_025749 Ga0495678_025749_1700_2380 226
369 3300049569 Ga0501032_0122522 Ga0501032_0122522_672_1352 226
370 3300049575 Ga0501039_0070439 Ga0501039_0070439_793_1473 226
371 3300049579 Ga0501043_0090628 Ga0501043_0090628_278_958 226
372 3300049580 Ga0501046_0421503 Ga0501046_0421503_230_910 226
373 3300049581 Ga0501047_0110528 Ga0501047_0110528_366_1046 226
374 3300049581 Ga0501047_0279300 Ga0501047_0279300_140_820 226
375 3300049822 Ga0501035_0134686 Ga0501035_0134686_137_817 226
376 3300049823 Ga0501044_0323965 Ga0501044_0323965_147_827 226
377 3300050489 nmdc:mga03683_18149_c3 nmdc:mga03683_18149_c3_13_693 226
378 3300050493 nmdc:mga0k408_7049_c1 nmdc:mga0k408_7049_c1_886_1566 226
379 3300050494 nmdc:mga06z11_498181_c1 nmdc:mga06z11_498181_c1_19_699 226
380 3300050516 nmdc:mga0sz30_11965_c2 nmdc:mga0sz30_11965_c2_266_946 226
381 3300053079 Ga0500610_0183196 Ga0500610_0183196_61_741 226
382 3300053085 Ga0495619_0289471 Ga0495619_0289471_191_871 226
383 3300053093 Ga0500651_0054028 Ga0500651_0054028_218_898 226
384 3300053093 Ga0500651_0127637 Ga0500651_0127637_260_943 226
385 3300053105 Ga0500557_000501 Ga0500557_000501_545_1225 226
386 3300053108 Ga0500562_033737 Ga0500562_033737_632_1312 226
387 3300053109 Ga0500569_025601 Ga0500569_025601_718_1401 226
388 3300053109 Ga0500569_027736 Ga0500569_027736_299_979 226
389 3300053118 Ga0500594_0003894 Ga0500594_0003894_311_991 226
390 3300053125 Ga0500618_000875 Ga0500618_000875_2874_3557 226
391 3300053125 Ga0500618_033550 Ga0500618_033550_489_1169 226
392 3300053134 Ga0500658_0000638 Ga0500658_0000638_3631_4314 226
393 3300053134 Ga0500658_0154991 Ga0500658_0154991_332_1012 226
394 3300053139 Ga0500568_0001714 Ga0500568_0001714_6386_7066 226
395 3300053139 Ga0500568_0003195 Ga0500568_0003195_6815_7495 226
396 3300053139 Ga0500568_0041065 Ga0500568_0041065_1064_1744 226
397 3300053142 Ga0500577_0219671 Ga0500577_0219671_70_750 226
398 3300053148 Ga0500590_005712 Ga0500590_005712_1248_1928 226
399 3300053153 Ga0500616_0000576 Ga0500616_0000576_5796_6476 226
400 3300053153 Ga0500616_0005531 Ga0500616_0005531_5017_5700 226
401 3300053156 Ga0500622_0003878 Ga0500622_0003878_1618_2298 226
402 3300053156 Ga0500622_0051610 Ga0500622_0051610_282_962 226
403 3300053158 Ga0500627_0050362 Ga0500627_0050362_294_974 226
404 3300053177 Ga0500636_0163711 Ga0500636_0163711_83_766 226
405 3300053730 Ga0500645_045941 Ga0500645_045941_31_711 226
406 3300060353 Ga0501082_0259561 Ga0501082_0259561_454_1134 226
407 3300002704 JGI25155J39150_1000016 JGI25155J39150_1000016130 227
408 3300002705 JGI25156J39149_1000018 JGI25156J39149_1000018130 227
409 3300002705 JGI25156J39149_1000046 JGI25156J39149_100004658 227
410 3300002738 JGI25154J39366_1000018 JGI25154J39366_100001842 227
411 3300002741 JGI25157J39369_1000022 JGI25157J39369_100002241 227
412 3300002741 JGI25157J39369_1000215 JGI25157J39369_100021547 227
413 3300003214 JGI25165J46597_1005261 JGI25165J46597_10052613 227
414 3300003323 rootH1_10122008 rootH1_101220082 227
415 3300003354 JGI25160J50197_1000053 JGI25160J50197_100005388 227
416 3300003374 JGI25161J50226_1000039 JGI25161J50226_100003988 227
417 3300004625 Ga0055543_1000015 Ga0055543_1000015100 227
418 3300005262 Ga0065165_1000361 Ga0065165_100036130 227
419 3300005367 Ga0070667_100412650 Ga0070667_1004126502 227
420 3300005548 Ga0070665_100042163 Ga0070665_1000421633 227
421 3300005563 Ga0068855_100157125 Ga0068855_1001571254 227
422 3300009036 Ga0105244_10156467 Ga0105244_101564672 227
423 3300009093 Ga0105240_10000013 Ga0105240_10000013415 227
424 3300009177 Ga0105248_10386608 Ga0105248_103866082 227
425 3300009545 Ga0105237_10000949 Ga0105237_1000094932 227
426 3300009551 Ga0105238_10082733 Ga0105238_100827332 227
427 3300010375 Ga0105239_10010104 Ga0105239_100101048 227
428 3300013104 Ga0157370_10004388 Ga0157370_1000438812 227
429 3300014497 Ga0182008_10008431 Ga0182008_100084313 227
430 3300015262 Ga0182007_10004002 Ga0182007_100040025 227
431 3300025206 Ga0209435_100017 Ga0209435_10001759 227
432 3300025246 Ga0209646_1000048 Ga0209646_1000048262 227
433 3300025250 Ga0209026_1000035 Ga0209026_1000035262 227
434 3300025253 Ga0209677_101582 Ga0209677_1015827 227
435 3300025254 Ga0209148_1015760 Ga0209148_10157602 227
436 3300025256 Ga0209759_1000027 Ga0209759_100002759 227
437 3300025261 Ga0209233_1000646 Ga0209233_100064612 227
438 3300025284 Ga0209130_1000038 Ga0209130_100003888 227
439 3300025302 Ga0207426_1000081 Ga0207426_1000081128 227
440 3300025904 Ga0207647_10151210 Ga0207647_101512101 227
441 3300025913 Ga0207695_10000044 Ga0207695_10000044372 227
442 3300025914 Ga0207671_10000043 Ga0207671_10000043116 227
443 3300025924 Ga0207694_10053250 Ga0207694_100532502 227
444 3300025941 Ga0207711_10266675 Ga0207711_102666752 227
445 3300025986 Ga0207658_10343890 Ga0207658_103438902 227
446 3300027312 Ga0209371_1002516 Ga0209371_10025163 227
447 3300028379 Ga0268266_10029374 Ga0268266_100293744 227
448 3300030500 Ga0268256_1016462 Ga0268256_10164623 227
449 3300044684 Ga0466966_0031156 Ga0466966_0031156_842_1528 227
450 3300044694 Ga0466963_0035063 Ga0466963_0035063_643_1329 227
451 3300044765 Ga0466970_0000095 Ga0466970_0000095_26932_27618 227
452 3300045836 Ga0466958_0006038 Ga0466958_0006038_5408_6094 227
453 3300045976 Ga0466967_0015530 Ga0466967_0015530_1049_1735 227
454 3300046507 Ga0495606_0004697 Ga0495606_0004697_9496_10179 227
455 3300046507 Ga0495606_0347973 Ga0495606_0347973_64_750 227
456 3300046512 Ga0495610_0164868 Ga0495610_0164868_186_872 227
457 3300046522 Ga0495643_0054395 Ga0495643_0054395_750_1436 227
458 3300047472 Ga0495686_0128317 Ga0495686_0128317_679_1365 227
459 3300047472 Ga0495686_0141523 Ga0495686_0141523_45_728 227
460 3300048903 Ga0496100_0013013 Ga0496100_0013013_580_1266 227
461 3300048904 Ga0496101_0061362 Ga0496101_0061362_1411_2097 227
462 3300048905 Ga0496102_0010779 Ga0496102_0010779_3848_4534 227
463 3300048906 Ga0496103_0005838 Ga0496103_0005838_3778_4464 227
464 3300048908 Ga0496105_0452896 Ga0496105_0452896_132_818 227
465 3300048913 Ga0496110_0055542 Ga0496110_0055542_824_1510 227
466 3300048914 Ga0496111_0061856 Ga0496111_0061856_468_1154 227
467 3300048916 Ga0496113_0040164 Ga0496113_0040164_267_953 227
468 3300048919 Ga0496116_0023490 Ga0496116_0023490_3841_4527 227
469 3300048920 Ga0496117_0003614 Ga0496117_0003614_4663_5349 227
470 3300048921 Ga0496118_0004165 Ga0496118_0004165_12467_13153 227
471 3300048922 Ga0496119_0019452 Ga0496119_0019452_373_1059 227
472 3300048923 Ga0496120_0007611 Ga0496120_0007611_2722_3408 227
473 3300048923 Ga0496120_0159058 Ga0496120_0159058_336_1019 227
474 3300048924 Ga0496121_0003229 Ga0496121_0003229_18052_18738 227
475 3300048924 Ga0496121_0026147 Ga0496121_0026147_3452_4138 227
476 3300048924 Ga0496121_0033896 Ga0496121_0033896_1007_1690 227
477 3300048925 Ga0496122_0022687 Ga0496122_0022687_2387_3073 227
478 3300048926 Ga0496123_0014316 Ga0496123_0014316_2161_2847 227
479 3300048926 Ga0496123_0024054 Ga0496123_0024054_1809_2495 227
480 3300048927 Ga0496124_0018624 Ga0496124_0018624_3777_4463 227
481 3300048928 Ga0496125_0015361 Ga0496125_0015361_3247_3933 227
482 3300049583 Ga0501067_0002286 Ga0501067_0002286_3768_4463 227
483 3300054114 Ga0501084_0052322 Ga0501084_0052322_1072_1767 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

112

199

0.92

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

82

199

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

83

190

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

108

192

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ec4-assembly2.cif.gz_B crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9466 2 226
3ec4-assembly1.cif.gz_A crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9445 2 226
3ec4-assembly2.cif.gz_B crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9425 2 226
3ec4-assembly1.cif.gz_A crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9405 2 226
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8981 133 193
ID Description Score Start End Superfamily
3ec4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9354 2 226 3.40.630.30
3ec4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9312 2 226 3.40.630.30
af_P76539_1_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8703 100 212 3.40.630.30
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8661 129 215 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8641 154 215 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4R9PBR3-F1-model_v4 GNAT family N-acetyltransferase 0.9976 95 189 GO:0016747
AF-A0A1E3GYP8-F1-model_v4 FR47-like protein 0.9942 1 225 GO:0003700
GO:0006950
GO:0016747
AF-A0A4R9PBR3-F1-model_v4 GNAT family N-acetyltransferase 0.9872 95 189 GO:0016747
AF-A0A6S6QRW0-F1-model_v4 GNAT family N-acetyltransferase 0.9843 1 225 GO:0016747
AF-A0A846MUL6-F1-model_v4 Putative GNAT family acetyltransferase 0.9838 2 225 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.04 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map