F452828

General Info

Members Datasets Scaffolds Average Seq Length
483 229 912 268

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0012266|Ga0495669_0012266_398_1333
Length 304
Sequence MHRIKYTRLTPAQISARLSAAANGPASATPLSEVFAALGAALAIAVLGAASLSAQWIRHPTEGIPRKDGKPDLTAPAPRLPGLWHATQTTRCENSRGEARPCGIEIGGSPLGGNLGRNLPGGKLPYQPWAEKLMDERHKAMSIDDPHVRCLPDNPPRHWTLPHLTKAVHTPKLLVLMYEVNAMYRQIFIDGRPFPQDMNPTWNGYSVGHWEGDTLVIETRGFRDDTWIDTWGSPMSDVAKMTEKIRRPNFGSIEIEVTVDDPKVYTKPFTVTLSEQFEADTELVDEFCAEGEKDYERLQRSRGK

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 2.07
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 19.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0012266 3300046684 Bacteria 3645
2 Ga0065712_10000622 3300005290 Bacteria 10548
3 Ga0065712_10027842 3300005290 Bacteria 1831
4 Ga0065712_10080820 3300005290 Unclassified 3067
5 Ga0065715_10094326 3300005293 Bacteria 4368
6 Ga0065707_10025902 3300005295 Bacteria 1569
7 Ga0070676_10006917 3300005328 Bacteria 6074
8 Ga0070683_100014850 3300005329 Bacteria 6827
9 Ga0070690_100035586 3300005330 Bacteria 3125
10 Ga0070670_100000626 3300005331 Bacteria 27664
11 Ga0070670_100138178 3300005331 Bacteria 2106
12 Ga0070670_100165936 3300005331 Bacteria 1914
13 Ga0070677_10012771 3300005333 Unclassified 2922
14 Ga0070677_10138202 3300005333 Bacteria 1120
15 Ga0068869_100001668 3300005334 Bacteria 13257
16 Ga0068869_100053434 3300005334 Bacteria 2937
17 Ga0068869_100322141 3300005334 Bacteria 1254
18 Ga0070666_10001605 3300005335 Bacteria 13755
19 Ga0070666_10084305 3300005335 Unclassified 2175
20 Ga0070666_10370457 3300005335 Bacteria 1027
21 Ga0070666_10399618 3300005335 Bacteria 988
22 Ga0070680_100071737 3300005336 Unclassified 2846
23 Ga0070682_100184445 3300005337 Bacteria 1460
24 Ga0068868_100001940 3300005338 Bacteria 14191
25 Ga0070660_100049237 3300005339 Unclassified 3239
26 Ga0070691_10000461 3300005341 Bacteria 15100
27 Ga0070687_100198749 3300005343 Bacteria 1213
28 Ga0070661_100085708 3300005344 Bacteria 2328
29 Ga0070668_100094553 3300005347 Bacteria 2360
30 Ga0070669_100035484 3300005353 Unclassified 3613
31 Ga0070669_100093146 3300005353 Bacteria 2262
32 Ga0070669_100174547 3300005353 Bacteria 1678
33 Ga0070669_100286751 3300005353 Bacteria 1321
34 Ga0070669_100419008 3300005353 Bacteria 1099
35 Ga0070675_100001484 3300005354 Bacteria 17311
36 Ga0070675_100012009 3300005354 Bacteria 6790
37 Ga0070675_100036432 3300005354 Unclassified 4003
38 Ga0070671_100059797 3300005355 Bacteria 3172
39 Ga0070671_100398166 3300005355 Bacteria 1178
40 Ga0070674_100000297 3300005356 Bacteria 24386
41 Ga0070674_100064318 3300005356 Bacteria 2570
42 Ga0070674_100094544 3300005356 Bacteria 2165
43 Ga0070674_100215913 3300005356 Bacteria 1489
44 Ga0070673_100002671 3300005364 Bacteria 10914
45 Ga0070673_100402672 3300005364 Bacteria 1224
46 Ga0070688_100036081 3300005365 Bacteria 3005
47 Ga0070688_100161433 3300005365 Bacteria 1540
48 Ga0070688_100183724 3300005365 Unclassified 1452
49 Ga0070667_100007130 3300005367 Bacteria 9291
50 Ga0070709_10030554 3300005434 Bacteria 3234
51 Ga0070713_100029060 3300005436 Bacteria 4372
52 Ga0070701_10074794 3300005438 Bacteria 1820
53 Ga0070711_100533271 3300005439 Bacteria 972
54 Ga0070700_100020355 3300005441 Bacteria 3842
55 Ga0070700_100132386 3300005441 Bacteria 1684
56 Ga0070678_100026318 3300005456 Bacteria 3931
57 Ga0070678_100076934 3300005456 Unclassified 2515
58 Ga0070678_100086035 3300005456 Bacteria 2397
59 Ga0070678_100384418 3300005456 Bacteria 1215
60 Ga0070662_100131124 3300005457 Bacteria 1933
61 Ga0070681_10038792 3300005458 Unclassified 4776
62 Ga0068867_100000332 3300005459 Bacteria 31236
63 Ga0070698_100236057 3300005471 Bacteria 1762
64 Ga0070679_100001188 3300005530 Bacteria 22870
65 Ga0070684_100010259 3300005535 Bacteria 7416
66 Ga0070684_100023432 3300005535 Bacteria 5164
67 Ga0070684_100162911 3300005535 Bacteria 2024
68 Ga0068853_100021030 3300005539 Bacteria 5432
69 Ga0068853_100055586 3300005539 Unclassified 3412
70 Ga0070672_100090151 3300005543 Bacteria 2472
71 Ga0070672_100224126 3300005543 Bacteria 1578
72 Ga0070686_100103339 3300005544 Bacteria 1928
73 Ga0070686_100252592 3300005544 Bacteria 1288
74 Ga0070686_100257769 3300005544 Bacteria 1277
75 Ga0070665_100089862 3300005548 Unclassified 3077
76 Ga0068855_100012045 3300005563 Bacteria 10455
77 Ga0070664_100001356 3300005564 Bacteria 19539
78 Ga0070664_100124796 3300005564 Bacteria 2257
79 Ga0070664_100224360 3300005564 Bacteria 1682
80 Ga0068857_100004701 3300005577 Bacteria 11575
81 Ga0068857_100099701 3300005577 Bacteria 2606
82 Ga0068854_100120161 3300005578 Bacteria 1993
83 Ga0068854_100484839 3300005578 Bacteria 1038
84 Ga0068856_100007110 3300005614 Bacteria 10928
85 Ga0068852_100018175 3300005616 Bacteria 5535
86 Ga0068859_100116572 3300005617 Bacteria 2736
87 Ga0068859_100162500 3300005617 Unclassified 2312
88 Ga0068859_100519988 3300005617 Unclassified 1285
89 Ga0068864_100007421 3300005618 Bacteria 9027
90 Ga0068864_100127400 3300005618 Bacteria 2283
91 Ga0068864_100475172 3300005618 Unclassified 1199
92 Ga0068864_100570430 3300005618 Unclassified 1096
93 Ga0068864_100614640 3300005618 Bacteria 1056
94 Ga0068866_10040721 3300005718 Bacteria 2302
95 Ga0068861_100079120 3300005719 Unclassified 2569
96 Ga0068870_10054876 3300005840 Bacteria 2121
97 Ga0068870_10101179 3300005840 Bacteria 1629
98 Ga0068870_10280954 3300005840 Bacteria 1044
99 Ga0068870_10393303 3300005840 Unclassified 900
100 Ga0068863_100165547 3300005841 Unclassified 2120
101 Ga0068858_100065143 3300005842 Bacteria 3372
102 Ga0068858_100109033 3300005842 Bacteria 2584
103 Ga0068858_100314133 3300005842 Bacteria 1497
104 Ga0068858_100353835 3300005842 Bacteria 1407
105 Ga0068860_100038791 3300005843 Unclassified 4557
106 Ga0068860_100052765 3300005843 Unclassified 3867
107 Ga0068862_100141916 3300005844 Bacteria 2132
108 Ga0068862_100394406 3300005844 Unclassified 1294
109 Ga0070715_10031796 3300006163 Bacteria 2145
110 Ga0070712_100397792 3300006175 Unclassified 1137
111 Ga0097621_100018457 3300006237 Bacteria 5329
112 Ga0097621_100036904 3300006237 Bacteria 3912
113 Ga0097621_100064889 3300006237 Bacteria 3004
114 Ga0097621_100104839 3300006237 Bacteria 2383
115 Ga0097621_100129988 3300006237 Bacteria 2143
116 Ga0068871_100003355 3300006358 Bacteria 11006
117 Ga0068871_100147215 3300006358 Bacteria 2006
118 Ga0068871_100189134 3300006358 Unclassified 1773
119 Ga0075428_100225378 3300006844 Unclassified 2024
120 Ga0075428_100564996 3300006844 Bacteria 1216
121 Ga0075428_100854991 3300006844 Unclassified 966
122 Ga0075430_100177006 3300006846 Bacteria 1775
123 Ga0075431_100004639 3300006847 Bacteria 13491
124 Ga0075431_100016147 3300006847 Bacteria 7575
125 Ga0075431_100054439 3300006847 Bacteria 4126
126 Ga0075434_100007389 3300006871 Bacteria 10174
127 Ga0075434_100058084 3300006871 Unclassified 3846
128 Ga0075429_100151913 3300006880 Bacteria 2028
129 Ga0075429_100323367 3300006880 Bacteria 1350
130 Ga0075429_100414979 3300006880 Bacteria 1179
131 Ga0068865_100002755 3300006881 Bacteria 10444
132 Ga0068865_100022038 3300006881 Bacteria 4149
133 Ga0068865_100066143 3300006881 Bacteria 2550
134 Ga0097620_100116574 3300006931 Bacteria 2736
135 Ga0097620_100162501 3300006931 Unclassified 2312
136 Ga0097620_100520061 3300006931 Unclassified 1285
137 Ga0075435_100004716 3300007076 Bacteria 9405
138 Ga0105240_10018605 3300009093 Bacteria 9316
139 Ga0111539_10000473 3300009094 Bacteria 50688
140 Ga0111539_10016124 3300009094 Bacteria 9272
141 Ga0111539_10108809 3300009094 Unclassified 3253
142 Ga0111539_10448131 3300009094 Bacteria 1503
143 Ga0111539_10597746 3300009094 Bacteria 1285
144 Ga0111539_10943725 3300009094 Unclassified 1003
145 Ga0111539_11176572 3300009094 Bacteria 891
146 Ga0105245_10022325 3300009098 Bacteria 5554
147 Ga0105245_10123597 3300009098 Bacteria 2420
148 Ga0105245_10563892 3300009098 Bacteria 1162
149 Ga0105247_10030654 3300009101 Bacteria 3260
150 Ga0114129_10012056 3300009147 Bacteria 12298
151 Ga0114129_10015883 3300009147 Bacteria 10708
152 Ga0114129_10206981 3300009147 Bacteria 2654
153 Ga0114129_10570457 3300009147 Bacteria 1469
154 Ga0114129_10654624 3300009147 Unclassified 1355
155 Ga0114129_10771024 3300009147 Bacteria 1229
156 Ga0105243_10013061 3300009148 Bacteria 6275
157 Ga0105243_10046815 3300009148 Unclassified 3403
158 Ga0105243_10120965 3300009148 Bacteria 2207
159 Ga0105241_10002584 3300009174 Bacteria 13581
160 Ga0105241_10018874 3300009174 Bacteria 5081
161 Ga0105242_10001005 3300009176 Bacteria 22109
162 Ga0105242_10023034 3300009176 Unclassified 4907
163 Ga0105242_10041982 3300009176 Bacteria 3691
164 Ga0105242_10070795 3300009176 Bacteria 2892
165 Ga0105242_10080578 3300009176 Bacteria 2721
166 Ga0105242_10165750 3300009176 Bacteria 1938
167 Ga0105242_10562471 3300009176 Bacteria 1095
168 Ga0105248_10002803 3300009177 Bacteria 19379
169 Ga0105248_10020314 3300009177 Bacteria 7359
170 Ga0105248_10033319 3300009177 Bacteria 5754
171 Ga0105248_10034775 3300009177 Bacteria 5638
172 Ga0105248_10241575 3300009177 Bacteria 2033
173 Ga0105248_10391302 3300009177 Bacteria 1565
174 Ga0105248_10452695 3300009177 Bacteria 1446
175 Ga0105248_10655472 3300009177 Bacteria 1184
176 Ga0105237_10002911 3300009545 Bacteria 20738
177 Ga0105238_10040920 3300009551 Unclassified 4695
178 Ga0105238_10055041 3300009551 Bacteria 3995
179 Ga0105249_10816114 3300009553 Unclassified 997
180 Ga0105239_10003103 3300010375 Bacteria 20606
181 Ga0105239_10017360 3300010375 Bacteria 7960
182 Ga0105239_10058815 3300010375 Bacteria 4218
183 Ga0105246_10454263 3300011119 Unclassified 1077
184 Ga0157370_10016223 3300013104 Bacteria 7550
185 Ga0157369_10014635 3300013105 Bacteria 8850
186 Ga0157369_10052069 3300013105 Unclassified 4430
187 Ga0157369_10140840 3300013105 Unclassified 2552
188 Ga0157369_10187108 3300013105 Bacteria 2177
189 Ga0157374_10004623 3300013296 Bacteria 11549
190 Ga0157374_10639398 3300013296 Unclassified 1075
191 Ga0157378_10098207 3300013297 Unclassified 2670
192 Ga0163162_10000713 3300013306 Bacteria 30827
193 Ga0163162_10060020 3300013306 Bacteria 3836
194 Ga0157372_10003294 3300013307 Bacteria 17440
195 Ga0157372_10004833 3300013307 Bacteria 14326
196 Ga0157372_10014948 3300013307 Bacteria 8309
197 Ga0157372_10020218 3300013307 Bacteria 7179
198 Ga0157375_10008685 3300013308 Bacteria 8904
199 Ga0157375_10014476 3300013308 Bacteria 7037
200 Ga0157375_10510601 3300013308 Bacteria 1366
201 Ga0157375_10879655 3300013308 Bacteria 1041
202 Ga0163163_10013131 3300014325 Bacteria 7568
203 Ga0163163_10091434 3300014325 Bacteria 3058
204 Ga0163163_10246726 3300014325 Bacteria 1836
205 Ga0163163_10268821 3300014325 Bacteria 1756
206 Ga0163163_10278766 3300014325 Bacteria 1723
207 Ga0157380_10007704 3300014326 Bacteria 7662
208 Ga0157380_10012779 3300014326 Bacteria 6099
209 Ga0157380_10050075 3300014326 Bacteria 3298
210 Ga0157380_10093414 3300014326 Unclassified 2487
211 Ga0157380_10133314 3300014326 Bacteria 2123
212 Ga0157377_10022272 3300014745 Bacteria 3343
213 Ga0157377_10046250 3300014745 Bacteria 2433
214 Ga0157377_10208635 3300014745 Bacteria 1244
215 Ga0157379_10065560 3300014968 Bacteria 3246
216 Ga0157376_10054017 3300014969 Unclassified 3347
217 Ga0157376_10411087 3300014969 Bacteria 1311
218 Ga0207682_10016221 3300025893 Bacteria 2903
219 Ga0207682_10018861 3300025893 Bacteria 2698
220 Ga0207642_10011072 3300025899 Unclassified 3205
221 Ga0207710_10035661 3300025900 Archaea 2189
222 Ga0207685_10052657 3300025905 Bacteria 1578
223 Ga0207699_10036186 3300025906 Bacteria 2813
224 Ga0207645_10004076 3300025907 Bacteria 10881
225 Ga0207645_10204651 3300025907 Bacteria 1299
226 Ga0207643_10045736 3300025908 Bacteria 2472
227 Ga0207643_10054391 3300025908 Unclassified 2275
228 Ga0207643_10103235 3300025908 Bacteria 1673
229 Ga0207643_10342196 3300025908 Unclassified 938
230 Ga0207643_10360745 3300025908 Unclassified 913
231 Ga0207654_10002411 3300025911 Bacteria 9551
232 Ga0207654_10004960 3300025911 Bacteria 6729
233 Ga0207707_10000635 3300025912 Bacteria 34780
234 Ga0207695_10005994 3300025913 Bacteria 15896
235 Ga0207695_10269454 3300025913 Bacteria 1599
236 Ga0207671_10027866 3300025914 Unclassified 4222
237 Ga0207660_10018851 3300025917 Unclassified 4607
238 Ga0207657_10059382 3300025919 Unclassified 3286
239 Ga0207652_10004226 3300025921 Bacteria 11716
240 Ga0207681_10120929 3300025923 Bacteria 1920
241 Ga0207681_10294137 3300025923 Bacteria 1283
242 Ga0207694_10006183 3300025924 Bacteria 9144
243 Ga0207650_10015184 3300025925 Bacteria 5360
244 Ga0207650_10026497 3300025925 Unclassified 4136
245 Ga0207659_10001111 3300025926 Bacteria 15946
246 Ga0207659_10005059 3300025926 Bacteria 7996
247 Ga0207659_10020164 3300025926 Unclassified 4401
248 Ga0207659_10199127 3300025926 Bacteria 1598
249 Ga0207659_10208997 3300025926 Bacteria 1563
250 Ga0207687_10011953 3300025927 Bacteria 5678
251 Ga0207687_10029653 3300025927 Bacteria 3682
252 Ga0207700_10118778 3300025928 Bacteria 2140
253 Ga0207644_10045485 3300025931 Bacteria 3123
254 Ga0207690_10089392 3300025932 Bacteria 2172
255 Ga0207706_10084642 3300025933 Bacteria 2788
256 Ga0207686_10006123 3300025934 Bacteria 6461
257 Ga0207686_10234474 3300025934 Bacteria 1332
258 Ga0207686_10301391 3300025934 Bacteria 1190
259 Ga0207709_10007722 3300025935 Bacteria 5965
260 Ga0207709_10073723 3300025935 Bacteria 2176
261 Ga0207670_10182847 3300025936 Bacteria 1580
262 Ga0207669_10005140 3300025937 Bacteria 5836
263 Ga0207669_10025621 3300025937 Bacteria 3192
264 Ga0207669_10093195 3300025937 Bacteria 1967
265 Ga0207704_10073281 3300025938 Bacteria 2180
266 Ga0207704_10137678 3300025938 Bacteria 1702
267 Ga0207704_10175385 3300025938 Bacteria 1543
268 Ga0207665_10205451 3300025939 Bacteria 1437
269 Ga0207691_10009151 3300025940 Bacteria 9504
270 Ga0207691_10041363 3300025940 Bacteria 4255
271 Ga0207691_10052374 3300025940 Bacteria 3728
272 Ga0207691_10083603 3300025940 Bacteria 2866
273 Ga0207711_10012912 3300025941 Bacteria 6937
274 Ga0207711_10041336 3300025941 Unclassified 3926
275 Ga0207711_10076466 3300025941 Bacteria 2915
276 Ga0207689_10000785 3300025942 Bacteria 30458
277 Ga0207689_10058748 3300025942 Bacteria 3163
278 Ga0207689_10143085 3300025942 Bacteria 1970
279 Ga0207689_10227181 3300025942 Bacteria 1543
280 Ga0207689_10255876 3300025942 Bacteria 1448
281 Ga0207661_10005767 3300025944 Bacteria 8730
282 Ga0207679_10093792 3300025945 Bacteria 2329
283 Ga0207679_10152613 3300025945 Bacteria 1882
284 Ga0207679_10478040 3300025945 Bacteria 1109
285 Ga0207667_10002906 3300025949 Bacteria 21279
286 Ga0207651_10034564 3300025960 Bacteria 3275
287 Ga0207651_10151812 3300025960 Bacteria 1804
288 Ga0207651_10327129 3300025960 Bacteria 1283
289 Ga0207712_10018007 3300025961 Bacteria 4596
290 Ga0207712_10203840 3300025961 Bacteria 1570
291 Ga0207668_10029674 3300025972 Bacteria 3587
292 Ga0207668_10118835 3300025972 Bacteria 1998
293 Ga0207640_10099042 3300025981 Bacteria 2040
294 Ga0207640_10173061 3300025981 Bacteria 1611
295 Ga0207658_10014915 3300025986 Bacteria 5326
296 Ga0207677_10003388 3300026023 Bacteria 8438
297 Ga0207677_10112691 3300026023 Bacteria 2029
298 Ga0207703_10018353 3300026035 Bacteria 5462
299 Ga0207703_10053727 3300026035 Bacteria 3274
300 Ga0207703_10072513 3300026035 Bacteria 2847
301 Ga0207703_10095640 3300026035 Bacteria 2506
302 Ga0207703_10233661 3300026035 Bacteria 1650
303 Ga0207639_10023802 3300026041 Unclassified 4425
304 Ga0207639_10296747 3300026041 Bacteria 1427
305 Ga0207708_10012976 3300026075 Bacteria 6214
306 Ga0207708_10018218 3300026075 Bacteria 5286
307 Ga0207708_10582647 3300026075 Unclassified 946
308 Ga0207702_10008257 3300026078 Bacteria 8799
309 Ga0207641_10129544 3300026088 Unclassified 2264
310 Ga0207641_10145609 3300026088 Unclassified 2142
311 Ga0207641_10306153 3300026088 Bacteria 1503
312 Ga0207648_10000093 3300026089 Bacteria 84666
313 Ga0207648_10040548 3300026089 Bacteria 4091
314 Ga0207648_10243269 3300026089 Bacteria 1602
315 Ga0207648_10244213 3300026089 Bacteria 1599
316 Ga0207676_10005040 3300026095 Bacteria 9346
317 Ga0207676_10454994 3300026095 Unclassified 1207
318 Ga0207676_10487752 3300026095 Bacteria 1168
319 Ga0207674_10021150 3300026116 Bacteria 7013
320 Ga0207674_10174896 3300026116 Bacteria 2099
321 Ga0207674_10215086 3300026116 Bacteria 1871
322 Ga0207674_10242712 3300026116 Bacteria 1749
323 Ga0207675_100006078 3300026118 Bacteria 11490
324 Ga0207675_100208757 3300026118 Bacteria 1878
325 Ga0207675_100297317 3300026118 Bacteria 1572
326 Ga0207683_10020724 3300026121 Bacteria 5625
327 Ga0207683_10037179 3300026121 Bacteria 4239
328 Ga0207683_10070625 3300026121 Bacteria 3085
329 Ga0207683_10144178 3300026121 Bacteria 2147
330 Ga0207698_10048812 3300026142 Unclassified 3216
331 Ga0207428_10006467 3300027907 Bacteria 10819
332 Ga0268266_10080259 3300028379 Unclassified 2842
333 Ga0268265_10168193 3300028380 Bacteria 1871
334 Ga0268265_10392646 3300028380 Unclassified 1280
335 Ga0268264_10031958 3300028381 Bacteria 4318
336 Ga0268264_10066621 3300028381 Bacteria 3037
337 Ga0268264_10167096 3300028381 Bacteria 1987
338 Ga0265340_10029711 3300031247 Bacteria 2745
339 Ga0265313_10001183 3300031595 Bacteria 24958
340 Ga0265314_10000823 3300031711 Bacteria 36914
341 Ga0373923_0017128 3300035111 Unclassified 2766
342 Ga0373953_0027744 3300035117 Bacteria 2178
343 Ga0373953_0059390 3300035117 Bacteria 1561
344 Ga0373943_0007390 3300035170 Bacteria 4934
345 Ga0373943_0102591 3300035170 Unclassified 1498
346 Ga0373946_0030980 3300035171 Unclassified 2138
347 Ga0373946_0038265 3300035171 Bacteria 1953
348 Ga0373946_0235324 3300035171 Bacteria 889
349 Ga0373955_0014624 3300035172 Unclassified 3823
350 Ga0373955_0164482 3300035172 Bacteria 1311
351 Ga0373955_0225333 3300035172 Unclassified 1121
352 Ga0373924_0012901 3300035410 Bacteria 3131
353 Ga0373935_0025297 3300035692 Bacteria 3658
354 Ga0373935_0102613 3300035692 Bacteria 1888
355 Ga0373927_0029409 3300035695 Bacteria 3581
356 Ga0373933_0145040 3300035724 Bacteria 1501
357 Ga0373947_0010446 3300035725 Bacteria 5328
358 Ga0373947_0107965 3300035725 Bacteria 1756
359 Ga0373937_0037937 3300036401 Bacteria 4391
360 Ga0373937_0166293 3300036401 Bacteria 2068
361 Ga0373925_0009146 3300037068 Bacteria 7209
362 Ga0436364_0942679 3300037853 Bacteria 1393
363 Ga0436365_1744724 3300039437 Unclassified 1842
364 Ga0439435_0002315 3300042436 Unclassified 3753
365 Ga0439435_0015573 3300042436 Unclassified 1894
366 Ga0439435_0021325 3300042436 Unclassified 1681
367 Ga0451577_0205610 3300042876 Bacteria 1778
368 Ga0495592_0081981 3300046454 Bacteria 2332
369 Ga0495629_0257909 3300046459 Unclassified 1199
370 Ga0495651_0261316 3300046462 Bacteria 1178
371 Ga0495653_0208083 3300046463 Unclassified 1323
372 Ga0495580_0026351 3300046472 Bacteria 4239
373 Ga0495580_0144601 3300046472 Unclassified 1648
374 Ga0495664_0168004 3300046477 Bacteria 1331
375 Ga0495608_0003803 3300046511 Bacteria 10845
376 Ga0495630_0027385 3300046517 Bacteria 4228
377 Ga0495652_0062426 3300046529 Unclassified 3142
378 Ga0495586_0243593 3300046535 Bacteria 1025
379 Ga0495586_0263786 3300046535 Unclassified 984
380 Ga0495645_0059303 3300046543 Unclassified 2776
381 Ga0495667_0004721 3300046559 Bacteria 9213
382 Ga0495656_0125082 3300046615 Bacteria 1218
383 Ga0495634_0018124 3300046642 Bacteria 5016
384 Ga0495634_0065281 3300046642 Unclassified 2413
385 Ga0495657_0006183 3300046675 Bacteria 9388
386 Ga0495623_0144178 3300046679 Bacteria 1414
387 Ga0495613_0002409 3300046689 Bacteria 14145
388 Ga0495613_0014373 3300046689 Bacteria 5876
389 Ga0495604_0087244 3300047317 Unclassified 2325
390 Ga0495674_0115736 3300047319 Bacteria 2269
391 Ga0495675_0230453 3300047444 Bacteria 1118
392 Ga0495684_0001957 3300047471 Bacteria 16543
393 Ga0495684_0144017 3300047471 Unclassified 1786
394 Ga0496100_0105311 3300048903 Bacteria 1950
395 Ga0496101_0003064 3300048904 Bacteria 10323
396 Ga0496104_0152732 3300048907 Bacteria 2216
397 Ga0496104_0192183 3300048907 Bacteria 1953
398 Ga0496105_0348991 3300048908 Bacteria 1182
399 Ga0496106_0054007 3300048909 Bacteria 3035
400 Ga0496109_0021016 3300048912 Bacteria 5771
401 Ga0496113_0076557 3300048916 Bacteria 2556
402 Ga0496114_0000710 3300048917 Bacteria 24771
403 Ga0496114_0290007 3300048917 Bacteria 1444
404 Ga0501033_0084849 3300049570 Unclassified 2321
405 Ga0501037_0298095 3300049573 Bacteria 1120
406 Ga0501038_0086529 3300049574 Unclassified 2633
407 Ga0501040_0008893 3300049576 Bacteria 6530
408 Ga0501041_0002793 3300049577 Bacteria 9971
409 Ga0501041_0019851 3300049577 Bacteria 4014
410 Ga0501042_0141403 3300049578 Unclassified 1735
411 Ga0501042_0449644 3300049578 Unclassified 934
412 Ga0501043_0214195 3300049579 Unclassified 1492
413 Ga0501046_0012021 3300049580 Bacteria 7384
414 Ga0501046_0043312 3300049580 Unclassified 3584
415 Ga0501072_0083321 3300049588 Unclassified 2535
416 Ga0501072_0262420 3300049588 Bacteria 1375
417 Ga0501074_0095306 3300049590 Unclassified 2131
418 Ga0501075_0047597 3300049591 Bacteria 3222
419 Ga0501076_0005594 3300049592 Bacteria 9051
420 Ga0501076_0017647 3300049592 Bacteria 5426
421 Ga0501077_0006916 3300049593 Bacteria 6986
422 Ga0501079_0003575 3300049741 Bacteria 11433
423 Ga0501080_0022379 3300049742 Bacteria 5856
424 Ga0501081_0000648 3300049743 Bacteria 19891
425 Ga0501081_0004929 3300049743 Bacteria 8583
426 Ga0501045_0001699 3300049824 Bacteria 14822
427 Ga0501045_0031807 3300049824 Bacteria 3822
428 nmdc:mga05p37_177345_c1 3300050507 Unclassified 2595
429 nmdc:mga05p37_294397_c1 3300050507 Bacteria 1931
430 nmdc:mga05p37_380566_c1 3300050507 Bacteria 1654
431 nmdc:mga05p37_432639_c1 3300050507 Unclassified 1528
432 nmdc:mga05p37_447247_c1 3300050507 Bacteria 1497
433 nmdc:mga05p37_7159_c1 3300050507 Bacteria 13155
434 nmdc:mga09592_260333_c1 3300050508 Bacteria 1504
435 nmdc:mga09592_51835_c1 3300050508 Bacteria 3462
436 nmdc:mga06r32_118687_c1 3300050510 Unclassified 2608
437 nmdc:mga06r32_18359_c1 3300050510 Bacteria 6403
438 nmdc:mga06r32_64672_c1 3300050510 Bacteria 3527
439 nmdc:mga08y16_129330_c1 3300050511 Bacteria 2627
440 nmdc:mga08y16_249671_c1 3300050511 Bacteria 1833
441 nmdc:mga08y16_2633_c1 3300050511 Bacteria 18444
442 nmdc:mga08y16_293282_c1 3300050511 Bacteria 1677
443 nmdc:mga08y16_639002_c1 3300050511 Bacteria 1069
444 nmdc:mga0n895_114056_c1 3300050512 Bacteria 2720
445 nmdc:mga0n895_114166_c1 3300050512 Bacteria 2719
446 nmdc:mga0n895_124269_c1 3300050512 Bacteria 2603
447 nmdc:mga0a205_1098_c1 3300050515 Bacteria 22481
448 Ga0495601_0030404 3300053077 Unclassified 3353
449 Ga0495595_0042577 3300053084 Bacteria 2080
450 Ga0495619_0008271 3300053085 Bacteria 6580
451 Ga0495619_0051161 3300053085 Bacteria 2730
452 Ga0500568_0000387 3300053139 Bacteria 33530
453 Ga0501084_0006442 3300054114 Bacteria 9649
454 Ga0501084_0084947 3300054114 Bacteria 2658
455 Ga0501082_0011193 3300060353 Bacteria 7708
456 Ga0530510_0002900 3300061734 Bacteria 11758
457 Ga0495669_0012266
458 Ga0065712_10000622
459 Ga0065712_10027842
460 Ga0065712_10080820
461 Ga0065715_10094326
462 Ga0065707_10025902
463 Ga0070676_10006917
464 Ga0070683_100014850
465 Ga0070690_100035586
466 Ga0070670_100000626
467 Ga0070670_100138178
468 Ga0070670_100165936
469 Ga0070677_10012771
470 Ga0070677_10138202
471 Ga0068869_100001668
472 Ga0068869_100053434
473 Ga0068869_100322141
474 Ga0070666_10001605
475 Ga0070666_10084305
476 Ga0070666_10370457
477 Ga0070666_10399618
478 Ga0070680_100071737
479 Ga0070682_100184445
480 Ga0068868_100001940
481 Ga0070660_100049237
482 Ga0070691_10000461
483 Ga0070687_100198749
484 Ga0070661_100085708
485 Ga0070668_100094553
486 Ga0070669_100035484
487 Ga0070669_100093146
488 Ga0070669_100174547
489 Ga0070669_100286751
490 Ga0070669_100419008
491 Ga0070675_100001484
492 Ga0070675_100012009
493 Ga0070675_100036432
494 Ga0070671_100059797
495 Ga0070671_100398166
496 Ga0070674_100000297
497 Ga0070674_100064318
498 Ga0070674_100094544
499 Ga0070674_100215913
500 Ga0070673_100002671
501 Ga0070673_100402672
502 Ga0070688_100036081
503 Ga0070688_100161433
504 Ga0070688_100183724
505 Ga0070667_100007130
506 Ga0070709_10030554
507 Ga0070713_100029060
508 Ga0070701_10074794
509 Ga0070711_100533271
510 Ga0070700_100020355
511 Ga0070700_100132386
512 Ga0070678_100026318
513 Ga0070678_100076934
514 Ga0070678_100086035
515 Ga0070678_100384418
516 Ga0070662_100131124
517 Ga0070681_10038792
518 Ga0068867_100000332
519 Ga0070698_100236057
520 Ga0070679_100001188
521 Ga0070684_100010259
522 Ga0070684_100023432
523 Ga0070684_100162911
524 Ga0068853_100021030
525 Ga0068853_100055586
526 Ga0070672_100090151
527 Ga0070672_100224126
528 Ga0070686_100103339
529 Ga0070686_100252592
530 Ga0070686_100257769
531 Ga0070665_100089862
532 Ga0068855_100012045
533 Ga0070664_100001356
534 Ga0070664_100124796
535 Ga0070664_100224360
536 Ga0068857_100004701
537 Ga0068857_100099701
538 Ga0068854_100120161
539 Ga0068854_100484839
540 Ga0068856_100007110
541 Ga0068852_100018175
542 Ga0068859_100116572
543 Ga0068859_100162500
544 Ga0068859_100519988
545 Ga0068864_100007421
546 Ga0068864_100127400
547 Ga0068864_100475172
548 Ga0068864_100570430
549 Ga0068864_100614640
550 Ga0068866_10040721
551 Ga0068861_100079120
552 Ga0068870_10054876
553 Ga0068870_10101179
554 Ga0068870_10280954
555 Ga0068870_10393303
556 Ga0068863_100165547
557 Ga0068858_100065143
558 Ga0068858_100109033
559 Ga0068858_100314133
560 Ga0068858_100353835
561 Ga0068860_100038791
562 Ga0068860_100052765
563 Ga0068862_100141916
564 Ga0068862_100394406
565 Ga0070715_10031796
566 Ga0070712_100397792
567 Ga0097621_100018457
568 Ga0097621_100036904
569 Ga0097621_100064889
570 Ga0097621_100104839
571 Ga0097621_100129988
572 Ga0068871_100003355
573 Ga0068871_100147215
574 Ga0068871_100189134
575 Ga0075428_100225378
576 Ga0075428_100564996
577 Ga0075428_100854991
578 Ga0075430_100177006
579 Ga0075431_100004639
580 Ga0075431_100016147
581 Ga0075431_100054439
582 Ga0075434_100007389
583 Ga0075434_100058084
584 Ga0075429_100151913
585 Ga0075429_100323367
586 Ga0075429_100414979
587 Ga0068865_100002755
588 Ga0068865_100022038
589 Ga0068865_100066143
590 Ga0097620_100116574
591 Ga0097620_100162501
592 Ga0097620_100520061
593 Ga0075435_100004716
594 Ga0105240_10018605
595 Ga0111539_10000473
596 Ga0111539_10016124
597 Ga0111539_10108809
598 Ga0111539_10448131
599 Ga0111539_10597746
600 Ga0111539_10943725
601 Ga0111539_11176572
602 Ga0105245_10022325
603 Ga0105245_10123597
604 Ga0105245_10563892
605 Ga0105247_10030654
606 Ga0114129_10012056
607 Ga0114129_10015883
608 Ga0114129_10206981
609 Ga0114129_10570457
610 Ga0114129_10654624
611 Ga0114129_10771024
612 Ga0105243_10013061
613 Ga0105243_10046815
614 Ga0105243_10120965
615 Ga0105241_10002584
616 Ga0105241_10018874
617 Ga0105242_10001005
618 Ga0105242_10023034
619 Ga0105242_10041982
620 Ga0105242_10070795
621 Ga0105242_10080578
622 Ga0105242_10165750
623 Ga0105242_10562471
624 Ga0105248_10002803
625 Ga0105248_10020314
626 Ga0105248_10033319
627 Ga0105248_10034775
628 Ga0105248_10241575
629 Ga0105248_10391302
630 Ga0105248_10452695
631 Ga0105248_10655472
632 Ga0105237_10002911
633 Ga0105238_10040920
634 Ga0105238_10055041
635 Ga0105249_10816114
636 Ga0105239_10003103
637 Ga0105239_10017360
638 Ga0105239_10058815
639 Ga0105246_10454263
640 Ga0157370_10016223
641 Ga0157369_10014635
642 Ga0157369_10052069
643 Ga0157369_10140840
644 Ga0157369_10187108
645 Ga0157374_10004623
646 Ga0157374_10639398
647 Ga0157378_10098207
648 Ga0163162_10000713
649 Ga0163162_10060020
650 Ga0157372_10003294
651 Ga0157372_10004833
652 Ga0157372_10014948
653 Ga0157372_10020218
654 Ga0157375_10008685
655 Ga0157375_10014476
656 Ga0157375_10510601
657 Ga0157375_10879655
658 Ga0163163_10013131
659 Ga0163163_10091434
660 Ga0163163_10246726
661 Ga0163163_10268821
662 Ga0163163_10278766
663 Ga0157380_10007704
664 Ga0157380_10012779
665 Ga0157380_10050075
666 Ga0157380_10093414
667 Ga0157380_10133314
668 Ga0157377_10022272
669 Ga0157377_10046250
670 Ga0157377_10208635
671 Ga0157379_10065560
672 Ga0157376_10054017
673 Ga0157376_10411087
674 Ga0207682_10016221
675 Ga0207682_10018861
676 Ga0207642_10011072
677 Ga0207710_10035661
678 Ga0207685_10052657
679 Ga0207699_10036186
680 Ga0207645_10004076
681 Ga0207645_10204651
682 Ga0207643_10045736
683 Ga0207643_10054391
684 Ga0207643_10103235
685 Ga0207643_10342196
686 Ga0207643_10360745
687 Ga0207654_10002411
688 Ga0207654_10004960
689 Ga0207707_10000635
690 Ga0207695_10005994
691 Ga0207695_10269454
692 Ga0207671_10027866
693 Ga0207660_10018851
694 Ga0207657_10059382
695 Ga0207652_10004226
696 Ga0207681_10120929
697 Ga0207681_10294137
698 Ga0207694_10006183
699 Ga0207650_10015184
700 Ga0207650_10026497
701 Ga0207659_10001111
702 Ga0207659_10005059
703 Ga0207659_10020164
704 Ga0207659_10199127
705 Ga0207659_10208997
706 Ga0207687_10011953
707 Ga0207687_10029653
708 Ga0207700_10118778
709 Ga0207644_10045485
710 Ga0207690_10089392
711 Ga0207706_10084642
712 Ga0207686_10006123
713 Ga0207686_10234474
714 Ga0207686_10301391
715 Ga0207709_10007722
716 Ga0207709_10073723
717 Ga0207670_10182847
718 Ga0207669_10005140
719 Ga0207669_10025621
720 Ga0207669_10093195
721 Ga0207704_10073281
722 Ga0207704_10137678
723 Ga0207704_10175385
724 Ga0207665_10205451
725 Ga0207691_10009151
726 Ga0207691_10041363
727 Ga0207691_10052374
728 Ga0207691_10083603
729 Ga0207711_10012912
730 Ga0207711_10041336
731 Ga0207711_10076466
732 Ga0207689_10000785
733 Ga0207689_10058748
734 Ga0207689_10143085
735 Ga0207689_10227181
736 Ga0207689_10255876
737 Ga0207661_10005767
738 Ga0207679_10093792
739 Ga0207679_10152613
740 Ga0207679_10478040
741 Ga0207667_10002906
742 Ga0207651_10034564
743 Ga0207651_10151812
744 Ga0207651_10327129
745 Ga0207712_10018007
746 Ga0207712_10203840
747 Ga0207668_10029674
748 Ga0207668_10118835
749 Ga0207640_10099042
750 Ga0207640_10173061
751 Ga0207658_10014915
752 Ga0207677_10003388
753 Ga0207677_10112691
754 Ga0207703_10018353
755 Ga0207703_10053727
756 Ga0207703_10072513
757 Ga0207703_10095640
758 Ga0207703_10233661
759 Ga0207639_10023802
760 Ga0207639_10296747
761 Ga0207708_10012976
762 Ga0207708_10018218
763 Ga0207708_10582647
764 Ga0207702_10008257
765 Ga0207641_10129544
766 Ga0207641_10145609
767 Ga0207641_10306153
768 Ga0207648_10000093
769 Ga0207648_10040548
770 Ga0207648_10243269
771 Ga0207648_10244213
772 Ga0207676_10005040
773 Ga0207676_10454994
774 Ga0207676_10487752
775 Ga0207674_10021150
776 Ga0207674_10174896
777 Ga0207674_10215086
778 Ga0207674_10242712
779 Ga0207675_100006078
780 Ga0207675_100208757
781 Ga0207675_100297317
782 Ga0207683_10020724
783 Ga0207683_10037179
784 Ga0207683_10070625
785 Ga0207683_10144178
786 Ga0207698_10048812
787 Ga0207428_10006467
788 Ga0268266_10080259
789 Ga0268265_10168193
790 Ga0268265_10392646
791 Ga0268264_10031958
792 Ga0268264_10066621
793 Ga0268264_10167096
794 Ga0265340_10029711
795 Ga0265313_10001183
796 Ga0265314_10000823
797 Ga0373923_0017128
798 Ga0373953_0027744
799 Ga0373953_0059390
800 Ga0373943_0007390
801 Ga0373943_0102591
802 Ga0373946_0030980
803 Ga0373946_0038265
804 Ga0373946_0235324
805 Ga0373955_0014624
806 Ga0373955_0164482
807 Ga0373955_0225333
808 Ga0373924_0012901
809 Ga0373935_0025297
810 Ga0373935_0102613
811 Ga0373927_0029409
812 Ga0373933_0145040
813 Ga0373947_0010446
814 Ga0373947_0107965
815 Ga0373937_0037937
816 Ga0373937_0166293
817 Ga0373925_0009146
818 Ga0436364_0942679
819 Ga0436365_1744724
820 Ga0439435_0002315
821 Ga0439435_0015573
822 Ga0439435_0021325
823 Ga0451577_0205610
824 Ga0495592_0081981
825 Ga0495629_0257909
826 Ga0495651_0261316
827 Ga0495653_0208083
828 Ga0495580_0026351
829 Ga0495580_0144601
830 Ga0495664_0168004
831 Ga0495608_0003803
832 Ga0495630_0027385
833 Ga0495652_0062426
834 Ga0495586_0243593
835 Ga0495586_0263786
836 Ga0495645_0059303
837 Ga0495667_0004721
838 Ga0495656_0125082
839 Ga0495634_0018124
840 Ga0495634_0065281
841 Ga0495657_0006183
842 Ga0495623_0144178
843 Ga0495613_0002409
844 Ga0495613_0014373
845 Ga0495604_0087244
846 Ga0495674_0115736
847 Ga0495675_0230453
848 Ga0495684_0001957
849 Ga0495684_0144017
850 Ga0496100_0105311
851 Ga0496101_0003064
852 Ga0496104_0152732
853 Ga0496104_0192183
854 Ga0496105_0348991
855 Ga0496106_0054007
856 Ga0496109_0021016
857 Ga0496113_0076557
858 Ga0496114_0000710
859 Ga0496114_0290007
860 Ga0501033_0084849
861 Ga0501037_0298095
862 Ga0501038_0086529
863 Ga0501040_0008893
864 Ga0501041_0002793
865 Ga0501041_0019851
866 Ga0501042_0141403
867 Ga0501042_0449644
868 Ga0501043_0214195
869 Ga0501046_0012021
870 Ga0501046_0043312
871 Ga0501072_0083321
872 Ga0501072_0262420
873 Ga0501074_0095306
874 Ga0501075_0047597
875 Ga0501076_0005594
876 Ga0501076_0017647
877 Ga0501077_0006916
878 Ga0501079_0003575
879 Ga0501080_0022379
880 Ga0501081_0000648
881 Ga0501081_0004929
882 Ga0501045_0001699
883 Ga0501045_0031807
884 nmdc:mga05p37_177345_c1
885 nmdc:mga05p37_294397_c1
886 nmdc:mga05p37_380566_c1
887 nmdc:mga05p37_432639_c1
888 nmdc:mga05p37_447247_c1
889 nmdc:mga05p37_7159_c1
890 nmdc:mga09592_260333_c1
891 nmdc:mga09592_51835_c1
892 nmdc:mga06r32_118687_c1
893 nmdc:mga06r32_18359_c1
894 nmdc:mga06r32_64672_c1
895 nmdc:mga08y16_129330_c1
896 nmdc:mga08y16_249671_c1
897 nmdc:mga08y16_2633_c1
898 nmdc:mga08y16_293282_c1
899 nmdc:mga08y16_639002_c1
900 nmdc:mga0n895_114056_c1
901 nmdc:mga0n895_114166_c1
902 nmdc:mga0n895_124269_c1
903 nmdc:mga0a205_1098_c1
904 Ga0495601_0030404
905 Ga0495595_0042577
906 Ga0495619_0008271
907 Ga0495619_0051161
908 Ga0500568_0000387
909 Ga0501084_0006442
910 Ga0501084_0084947
911 Ga0501082_0011193
912 Ga0530510_0002900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ceo-assembly1.cif.gz_d yeast rna polymerase ii transcription pre-initiation complex with core mediator and the +1 nucleosome 0.7605 171 229
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.7512 195 242
3s0p-assembly1.cif.gz_B copper-reconstituted tomato chloroplast superoxide dismutase 0.7468 195 216
3o4t-assembly1.cif.gz_A crystal structure of heptp with an open wpd loop and partially depleted active site 0.73 196 231
5hw3-assembly1.cif.gz_A crystal structure of a beta lactamase from burkholderia vietnamiensis 0.7205 192 233
ID Description Score Start End Superfamily
af_E9PTR6_25_177_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8224 197 231 2.40.128.20
af_P08372_33_104_3.30.1300.30 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.8024 196 231 3.30.1300.30
af_Q59027_354_466_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7969 162 178 3.10.310.30
3gvzB00 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A 0.7618 198 231 3.60.60.10
af_Q9US26_1_351_3.40.50.12050 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7581 196 238 3.40.50.12050
ID Description Score Start End GO Terms
AF-A0A2V8N442-F1-model_v4 Uncharacterized protein 0.9559 125 242
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.9359 122 239
AF-A0A2V8I2K0-F1-model_v4 Uncharacterized protein 0.9351 84 240
AF-A0A349KJ84-F1-model_v4 Uncharacterized protein 0.9311 91 250
AF-A0A4Q6CY62-F1-model_v4 deleted 0.9264 78 244

Map