F452761

General Info

Members Datasets Scaffolds Average Seq Length
483 203 966 350

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10080473|Ga0111539_100804732
Length 418
Sequence MGKMKFKAANPSGADADVKERTAARPPVAGTSTLSGHGEGRAHGRDSADRFAGAGDDSGAAGLPAVREKPASTVILDPKAAKAQAQALEFAIGQIKKKCGQGSIMFLGADFKANVQVIPTGVLSLDSALGVGGLPRGRIVEIFGPESSGKTTLTLHAIANAQRAGGNAAFVDAEHALDPNYAKRLGVNLDTLLVSQPDSGEQALEIAEMLISSNAMTVVVIDSVAALVPRAELEGEMGDSHVGLHARLMSQALRKLTAIVHKSNTCLIFINQIREKIGVMFGSPETTTGGRALKFYSSVRLDIRRVTAIKEGDEVKGNRTRVKVVKNKVAPPFRQAEFDVLFDRGISFCGDLLDLAGDQGVVQRSGTWHSFGEVRLGQGRDRAVQFLEENPDLTRQIEYLLRTKLGIADGVSGMRPEG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.04
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10080473 3300009094 Bacteria 3832
2 Ga0065712_10173505 3300005290 Bacteria 1201
3 Ga0070658_10002926 3300005327 Bacteria 14155
4 Ga0070658_10262265 3300005327 Bacteria 1468
5 Ga0070683_100000124 3300005329 Bacteria 50336
6 Ga0070683_100001975 3300005329 Bacteria 16064
7 Ga0070683_100011342 3300005329 Bacteria 7698
8 Ga0070683_100044400 3300005329 Bacteria 4098
9 Ga0070683_100101640 3300005329 Bacteria 2707
10 Ga0070683_100213429 3300005329 Bacteria 1834
11 Ga0070683_100238210 3300005329 Bacteria 1730
12 Ga0070690_100027535 3300005330 Bacteria 3514
13 Ga0070680_100009191 3300005336 Bacteria 7581
14 Ga0070680_100062515 3300005336 Bacteria 3049
15 Ga0070660_100056282 3300005339 Bacteria 3042
16 Ga0070689_100235916 3300005340 Bacteria 1505
17 Ga0070691_10014947 3300005341 Bacteria 3564
18 Ga0070661_100086995 3300005344 Bacteria 2311
19 Ga0070661_100190964 3300005344 Bacteria 1562
20 Ga0070661_100280796 3300005344 Bacteria 1292
21 Ga0070671_100141134 3300005355 Bacteria 2033
22 Ga0070671_100297861 3300005355 Bacteria 1373
23 Ga0070673_100054189 3300005364 Bacteria 3154
24 Ga0070667_100096117 3300005367 Bacteria 2555
25 Ga0070709_10142924 3300005434 Bacteria 1646
26 Ga0070713_100033447 3300005436 Bacteria 4119
27 Ga0070713_100036507 3300005436 Bacteria 3966
28 Ga0070713_100051598 3300005436 Bacteria 3402
29 Ga0070711_100000052 3300005439 Bacteria 73490
30 Ga0070711_100028390 3300005439 Bacteria 3682
31 Ga0070711_100038827 3300005439 Bacteria 3204
32 Ga0070705_100037419 3300005440 Bacteria 2737
33 Ga0070694_100075346 3300005444 Bacteria 2334
34 Ga0070681_10000333 3300005458 Bacteria 38332
35 Ga0070681_10003533 3300005458 Bacteria 14648
36 Ga0070681_10014554 3300005458 Bacteria 7828
37 Ga0070681_10076849 3300005458 Bacteria 3297
38 Ga0070681_10448555 3300005458 Bacteria 1202
39 Ga0070706_100106294 3300005467 Bacteria 2611
40 Ga0070699_100000011 3300005518 Bacteria 267738
41 Ga0070699_100019870 3300005518 Bacteria 5790
42 Ga0070679_100000177 3300005530 Bacteria 51360
43 Ga0070679_100013159 3300005530 Bacteria 7922
44 Ga0070679_100026327 3300005530 Bacteria 5713
45 Ga0070679_100093714 3300005530 Bacteria 2990
46 Ga0070679_100253968 3300005530 Bacteria 1714
47 Ga0070684_100005606 3300005535 Bacteria 9648
48 Ga0070684_100012164 3300005535 Bacteria 6883
49 Ga0070684_100013764 3300005535 Bacteria 6529
50 Ga0070684_100020349 3300005535 Bacteria 5505
51 Ga0068853_100006848 3300005539 Bacteria 9091
52 Ga0068853_100016256 3300005539 Bacteria 6123
53 Ga0068853_100282987 3300005539 Bacteria 1529
54 Ga0068853_100310869 3300005539 Bacteria 1459
55 Ga0070696_100000367 3300005546 Bacteria 27518
56 Ga0070696_100005261 3300005546 Bacteria 8636
57 Ga0070665_100015660 3300005548 Bacteria 7616
58 Ga0070665_100042754 3300005548 Bacteria 4555
59 Ga0070665_100235780 3300005548 Bacteria 1830
60 Ga0070704_100069804 3300005549 Bacteria 2547
61 Ga0070704_100087622 3300005549 Bacteria 2311
62 Ga0068855_100002803 3300005563 Bacteria 21449
63 Ga0068855_100005384 3300005563 Bacteria 15611
64 Ga0068855_100020268 3300005563 Bacteria 7980
65 Ga0068855_100062481 3300005563 Bacteria 4348
66 Ga0068855_100094196 3300005563 Bacteria 3453
67 Ga0068855_100164036 3300005563 Bacteria 2520
68 Ga0068855_100243931 3300005563 Bacteria 2006
69 Ga0068855_100340532 3300005563 Bacteria 1654
70 Ga0068855_100414966 3300005563 Bacteria 1473
71 Ga0068855_100457681 3300005563 Bacteria 1392
72 Ga0068857_100000804 3300005577 Bacteria 23487
73 Ga0068857_100008964 3300005577 Bacteria 8669
74 Ga0068857_100258917 3300005577 Bacteria 1596
75 Ga0068854_100056038 3300005578 Bacteria 2840
76 Ga0068854_100345605 3300005578 Bacteria 1216
77 Ga0068856_100001120 3300005614 Bacteria 28321
78 Ga0068856_100001203 3300005614 Bacteria 27199
79 Ga0068856_100027054 3300005614 Bacteria 5595
80 Ga0068856_100122193 3300005614 Bacteria 2606
81 Ga0068856_100268504 3300005614 Bacteria 1722
82 Ga0068856_100399603 3300005614 Bacteria 1394
83 Ga0068852_100004437 3300005616 Bacteria 9920
84 Ga0068852_100016443 3300005616 Bacteria 5770
85 Ga0068852_100273574 3300005616 Bacteria 1626
86 Ga0068859_100062030 3300005617 Bacteria 3768
87 Ga0068866_10142723 3300005718 Bacteria 1377
88 Ga0068863_100059508 3300005841 Bacteria 3614
89 Ga0068863_100061794 3300005841 Bacteria 3542
90 Ga0068858_100053881 3300005842 Bacteria 3720
91 Ga0068860_100064518 3300005843 Bacteria 3478
92 Ga0081455_10008583 3300005937 Bacteria 10604
93 Ga0081539_10016086 3300005985 Bacteria 5376
94 Ga0070712_100085176 3300006175 Bacteria 2300
95 Ga0097621_100001891 3300006237 Bacteria 14294
96 Ga0097621_100016689 3300006237 Bacteria 5559
97 Ga0097621_100034021 3300006237 Bacteria 4062
98 Ga0097621_100036411 3300006237 Bacteria 3938
99 Ga0097621_100081524 3300006237 Bacteria 2693
100 Ga0097621_100112337 3300006237 Bacteria 2303
101 Ga0097621_100120597 3300006237 Bacteria 2224
102 Ga0097621_100121770 3300006237 Bacteria 2213
103 Ga0068871_100012681 3300006358 Bacteria 6227
104 Ga0068871_100022577 3300006358 Bacteria 4853
105 Ga0068871_100075031 3300006358 Bacteria 2791
106 Ga0075428_100000100 3300006844 Bacteria 72697
107 Ga0075428_100004213 3300006844 Bacteria 15846
108 Ga0075428_100076098 3300006844 Bacteria 3665
109 Ga0075430_100072883 3300006846 Bacteria 2880
110 Ga0075431_100013665 3300006847 Bacteria 8205
111 Ga0075431_100205584 3300006847 Bacteria 2013
112 Ga0075434_100057598 3300006871 Bacteria 3862
113 Ga0075434_100360402 3300006871 Bacteria 1475
114 Ga0075429_100017707 3300006880 Bacteria 6160
115 Ga0075429_100196922 3300006880 Bacteria 1765
116 Ga0068865_100022420 3300006881 Bacteria 4119
117 Ga0075436_100001065 3300006914 Bacteria 18464
118 Ga0075436_100007653 3300006914 Bacteria 7381
119 Ga0097620_100062030 3300006931 Bacteria 3768
120 Ga0075435_100155943 3300007076 Bacteria 1921
121 Ga0105240_10000429 3300009093 Bacteria 77882
122 Ga0105240_10000682 3300009093 Bacteria 62492
123 Ga0105240_10000781 3300009093 Bacteria 57631
124 Ga0105240_10002359 3300009093 Bacteria 30448
125 Ga0105240_10005024 3300009093 Bacteria 19853
126 Ga0105240_10031811 3300009093 Bacteria 6836
127 Ga0105240_10047120 3300009093 Bacteria 5456
128 Ga0105240_10071264 3300009093 Bacteria 4299
129 Ga0105240_10090852 3300009093 Bacteria 3732
130 Ga0105240_10210576 3300009093 Bacteria 2272
131 Ga0105240_10251080 3300009093 Bacteria 2046
132 Ga0111539_10002662 3300009094 Bacteria 23672
133 Ga0111539_10003771 3300009094 Bacteria 19940
134 Ga0105245_10003727 3300009098 Bacteria 13582
135 Ga0105245_10010083 3300009098 Bacteria 8231
136 Ga0105245_10012049 3300009098 Bacteria 7518
137 Ga0105245_10015669 3300009098 Bacteria 6611
138 Ga0105245_10044670 3300009098 Bacteria 3956
139 Ga0105245_10086757 3300009098 Bacteria 2871
140 Ga0105245_10091740 3300009098 Bacteria 2796
141 Ga0105245_10330237 3300009098 Bacteria 1505
142 Ga0105245_10459770 3300009098 Bacteria 1283
143 Ga0114129_10367873 3300009147 Bacteria 1901
144 Ga0114129_10389728 3300009147 Bacteria 1838
145 Ga0105243_10045188 3300009148 Bacteria 3459
146 Ga0105243_10132443 3300009148 Bacteria 2117
147 Ga0105243_10177521 3300009148 Bacteria 1849
148 Ga0105241_10004635 3300009174 Bacteria 10163
149 Ga0105241_10007385 3300009174 Bacteria 8086
150 Ga0105241_10007784 3300009174 Bacteria 7879
151 Ga0105241_10020682 3300009174 Bacteria 4863
152 Ga0105241_10085613 3300009174 Bacteria 2477
153 Ga0105241_10476786 3300009174 Bacteria 1108
154 Ga0105242_10021860 3300009176 Bacteria 5027
155 Ga0105242_10066871 3300009176 Bacteria 2969
156 Ga0105248_10004128 3300009177 Bacteria 16068
157 Ga0105248_10095298 3300009177 Bacteria 3351
158 Ga0105248_10331469 3300009177 Bacteria 1714
159 Ga0105237_10011226 3300009545 Bacteria 9488
160 Ga0105237_10017997 3300009545 Bacteria 7321
161 Ga0105237_10035941 3300009545 Bacteria 5011
162 Ga0105237_10105500 3300009545 Bacteria 2809
163 Ga0105237_10255337 3300009545 Bacteria 1755
164 Ga0105238_10001639 3300009551 Bacteria 22436
165 Ga0105238_10008172 3300009551 Bacteria 10467
166 Ga0105238_10014478 3300009551 Bacteria 7976
167 Ga0105238_10015211 3300009551 Bacteria 7790
168 Ga0105238_10021250 3300009551 Bacteria 6614
169 Ga0105238_10025564 3300009551 Bacteria 6020
170 Ga0105238_10032171 3300009551 Bacteria 5337
171 Ga0105238_10034360 3300009551 Bacteria 5159
172 Ga0105238_10204584 3300009551 Bacteria 1950
173 Ga0105249_10063506 3300009553 Bacteria 3393
174 Ga0105249_10464589 3300009553 Bacteria 1306
175 Ga0105249_10535367 3300009553 Bacteria 1220
176 Ga0105239_10002614 3300010375 Bacteria 22789
177 Ga0105239_10014347 3300010375 Bacteria 8790
178 Ga0105239_10026440 3300010375 Bacteria 6387
179 Ga0105239_10051400 3300010375 Bacteria 4518
180 Ga0105239_10138590 3300010375 Bacteria 2710
181 Ga0105239_10138706 3300010375 Bacteria 2709
182 Ga0105239_10186874 3300010375 Bacteria 2319
183 Ga0105246_10015476 3300011119 Bacteria 4821
184 Ga0105246_10019075 3300011119 Bacteria 4377
185 Ga0105246_10038905 3300011119 Bacteria 3201
186 Ga0105246_10058401 3300011119 Bacteria 2672
187 Ga0157370_10001437 3300013104 Bacteria 29538
188 Ga0157370_10002842 3300013104 Bacteria 20686
189 Ga0157370_10022760 3300013104 Bacteria 6234
190 Ga0157370_10031068 3300013104 Bacteria 5228
191 Ga0157369_10002996 3300013105 Bacteria 20214
192 Ga0157369_10003435 3300013105 Bacteria 18792
193 Ga0157369_10005797 3300013105 Bacteria 14361
194 Ga0157369_10015805 3300013105 Bacteria 8502
195 Ga0157369_10106385 3300013105 Bacteria 2986
196 Ga0157369_10112890 3300013105 Bacteria 2887
197 Ga0157369_10176816 3300013105 Bacteria 2247
198 Ga0157374_10022916 3300013296 Bacteria 5577
199 Ga0157374_10121006 3300013296 Bacteria 2526
200 Ga0157374_10193400 3300013296 Bacteria 1990
201 Ga0157378_10002561 3300013297 Bacteria 16171
202 Ga0157378_10024555 3300013297 Bacteria 5306
203 Ga0163162_10011793 3300013306 Bacteria 8524
204 Ga0157372_10006323 3300013307 Bacteria 12602
205 Ga0157372_10006624 3300013307 Bacteria 12329
206 Ga0157372_10013994 3300013307 Bacteria 8571
207 Ga0157372_10050727 3300013307 Bacteria 4615
208 Ga0157372_10162703 3300013307 Bacteria 2580
209 Ga0157372_10243655 3300013307 Bacteria 2086
210 Ga0157375_10147282 3300013308 Bacteria 2486
211 Ga0157375_10379139 3300013308 Bacteria 1581
212 Ga0163163_10005151 3300014325 Bacteria 11269
213 Ga0163163_10019911 3300014325 Bacteria 6311
214 Ga0163163_10022339 3300014325 Bacteria 5987
215 Ga0163163_10028731 3300014325 Bacteria 5344
216 Ga0163163_10193824 3300014325 Bacteria 2080
217 Ga0157380_10058609 3300014326 Bacteria 3070
218 Ga0157379_10054143 3300014968 Bacteria 3585
219 Ga0157379_10186063 3300014968 Bacteria 1877
220 Ga0157376_10173085 3300014969 Bacteria 1967
221 Ga0157376_10262977 3300014969 Bacteria 1617
222 Ga0206355_1025311 3300020076 Bacteria 3269
223 Ga0213874_10002379 3300021377 Bacteria 4041
224 Ga0213875_10003280 3300021388 Bacteria 9269
225 Ga0213875_10008620 3300021388 Bacteria 5209
226 Ga0207642_10054903 3300025899 Bacteria 1819
227 Ga0207680_10034328 3300025903 Bacteria 2902
228 Ga0207699_10036540 3300025906 Bacteria 2801
229 Ga0207705_10062532 3300025909 Bacteria 2689
230 Ga0207705_10213977 3300025909 Bacteria 1462
231 Ga0207684_10118355 3300025910 Bacteria 2270
232 Ga0207654_10015825 3300025911 Bacteria 3920
233 Ga0207654_10023691 3300025911 Bacteria 3292
234 Ga0207654_10042845 3300025911 Bacteria 2563
235 Ga0207654_10125863 3300025911 Bacteria 1615
236 Ga0207654_10273285 3300025911 Bacteria 1141
237 Ga0207707_10006756 3300025912 Bacteria 10016
238 Ga0207707_10010025 3300025912 Bacteria 8222
239 Ga0207707_10019785 3300025912 Bacteria 5878
240 Ga0207707_10036433 3300025912 Bacteria 4301
241 Ga0207707_10073642 3300025912 Bacteria 2978
242 Ga0207707_10102658 3300025912 Bacteria 2500
243 Ga0207707_10417098 3300025912 Bacteria 1151
244 Ga0207695_10000504 3300025913 Bacteria 83019
245 Ga0207695_10000843 3300025913 Bacteria 56294
246 Ga0207695_10003331 3300025913 Bacteria 22765
247 Ga0207695_10008327 3300025913 Bacteria 12993
248 Ga0207695_10050498 3300025913 Bacteria 4375
249 Ga0207695_10050566 3300025913 Bacteria 4371
250 Ga0207695_10070418 3300025913 Bacteria 3575
251 Ga0207695_10092405 3300025913 Bacteria 3037
252 Ga0207695_10121882 3300025913 Bacteria 2574
253 Ga0207671_10010407 3300025914 Bacteria 7677
254 Ga0207671_10012376 3300025914 Bacteria 6864
255 Ga0207671_10022640 3300025914 Bacteria 4747
256 Ga0207663_10000074 3300025916 Bacteria 47918
257 Ga0207663_10015223 3300025916 Bacteria 4238
258 Ga0207663_10096458 3300025916 Bacteria 1975
259 Ga0207663_10149520 3300025916 Bacteria 1637
260 Ga0207660_10095139 3300025917 Bacteria 2216
261 Ga0207657_10071303 3300025919 Bacteria 2942
262 Ga0207657_10072910 3300025919 Bacteria 2903
263 Ga0207649_10150349 3300025920 Bacteria 1603
264 Ga0207649_10150703 3300025920 Bacteria 1601
265 Ga0207649_10193344 3300025920 Bacteria 1432
266 Ga0207652_10007839 3300025921 Bacteria 8573
267 Ga0207652_10008232 3300025921 Bacteria 8375
268 Ga0207652_10038894 3300025921 Bacteria 4035
269 Ga0207652_10095735 3300025921 Bacteria 2615
270 Ga0207652_10315187 3300025921 Bacteria 1412
271 Ga0207681_10006945 3300025923 Bacteria 6943
272 Ga0207694_10011422 3300025924 Bacteria 6703
273 Ga0207694_10025118 3300025924 Bacteria 4527
274 Ga0207694_10028460 3300025924 Bacteria 4260
275 Ga0207694_10037802 3300025924 Bacteria 3710
276 Ga0207694_10094711 3300025924 Bacteria 2360
277 Ga0207694_10118683 3300025924 Bacteria 2110
278 Ga0207694_10138655 3300025924 Bacteria 1955
279 Ga0207694_10171936 3300025924 Bacteria 1755
280 Ga0207687_10001902 3300025927 Bacteria 14362
281 Ga0207687_10008830 3300025927 Bacteria 6586
282 Ga0207687_10012119 3300025927 Bacteria 5638
283 Ga0207687_10015869 3300025927 Bacteria 4943
284 Ga0207700_10001844 3300025928 Bacteria 12012
285 Ga0207700_10005539 3300025928 Bacteria 7572
286 Ga0207700_10040757 3300025928 Bacteria 3392
287 Ga0207664_10000970 3300025929 Bacteria 19337
288 Ga0207664_10079960 3300025929 Bacteria 2656
289 Ga0207644_10134181 3300025931 Bacteria 1899
290 Ga0207686_10038429 3300025934 Bacteria 2896
291 Ga0207709_10024154 3300025935 Bacteria 3467
292 Ga0207670_10083410 3300025936 Bacteria 2242
293 Ga0207704_10075496 3300025938 Bacteria 2156
294 Ga0207704_10194466 3300025938 Bacteria 1478
295 Ga0207711_10006942 3300025941 Bacteria 9504
296 Ga0207711_10042080 3300025941 Bacteria 3891
297 Ga0207711_10082265 3300025941 Bacteria 2814
298 Ga0207689_10008482 3300025942 Bacteria 8954
299 Ga0207689_10009761 3300025942 Bacteria 8269
300 Ga0207661_10012216 3300025944 Bacteria 6237
301 Ga0207661_10029284 3300025944 Bacteria 4227
302 Ga0207661_10042398 3300025944 Bacteria 3587
303 Ga0207661_10070854 3300025944 Bacteria 2847
304 Ga0207661_10172086 3300025944 Bacteria 1885
305 Ga0207661_10255137 3300025944 Bacteria 1560
306 Ga0207679_10060693 3300025945 Bacteria 2811
307 Ga0207667_10000189 3300025949 Bacteria 90535
308 Ga0207667_10001704 3300025949 Bacteria 27654
309 Ga0207667_10002671 3300025949 Bacteria 22051
310 Ga0207667_10032013 3300025949 Bacteria 5671
311 Ga0207667_10086740 3300025949 Bacteria 3239
312 Ga0207667_10175599 3300025949 Bacteria 2201
313 Ga0207712_10063715 3300025961 Bacteria 2625
314 Ga0207677_10011682 3300026023 Bacteria 5014
315 Ga0207677_10247430 3300026023 Bacteria 1446
316 Ga0207703_10038329 3300026035 Bacteria 3824
317 Ga0207703_10043375 3300026035 Bacteria 3610
318 Ga0207703_10067285 3300026035 Bacteria 2948
319 Ga0207703_10071992 3300026035 Bacteria 2857
320 Ga0207703_10341319 3300026035 Bacteria 1377
321 Ga0207639_10019984 3300026041 Bacteria 4787
322 Ga0207639_10231857 3300026041 Bacteria 1601
323 Ga0207702_10016621 3300026078 Bacteria 6089
324 Ga0207702_10019172 3300026078 Bacteria 5660
325 Ga0207702_10037201 3300026078 Bacteria 4073
326 Ga0207702_10056702 3300026078 Bacteria 3327
327 Ga0207702_10073848 3300026078 Bacteria 2942
328 Ga0207702_10074562 3300026078 Bacteria 2929
329 Ga0207702_10178649 3300026078 Bacteria 1953
330 Ga0207702_10180395 3300026078 Bacteria 1944
331 Ga0207702_10351750 3300026078 Bacteria 1410
332 Ga0207641_10043144 3300026088 Bacteria 3786
333 Ga0207641_10049778 3300026088 Bacteria 3542
334 Ga0207641_10208050 3300026088 Bacteria 1808
335 Ga0207648_10036719 3300026089 Bacteria 4317
336 Ga0207674_10000110 3300026116 Bacteria 94822
337 Ga0207674_10000967 3300026116 Bacteria 37590
338 Ga0207674_10001825 3300026116 Bacteria 27177
339 Ga0207674_10058111 3300026116 Bacteria 3920
340 Ga0207674_10113757 3300026116 Bacteria 2679
341 Ga0207674_10113965 3300026116 Bacteria 2676
342 Ga0207674_10115144 3300026116 Bacteria 2660
343 Ga0207698_10006003 3300026142 Bacteria 7552
344 Ga0207698_10239894 3300026142 Bacteria 1651
345 Ga0207428_10005059 3300027907 Bacteria 12390
346 Ga0207428_10091734 3300027907 Bacteria 2358
347 Ga0268266_10036181 3300028379 Bacteria 4201
348 Ga0268266_10048641 3300028379 Bacteria 3635
349 Ga0268264_10007180 3300028381 Bacteria 9331
350 Ga0268264_10033461 3300028381 Bacteria 4223
351 Ga0265338_10058894 3300028800 Bacteria 3387
352 Ga0265338_10067374 3300028800 Bacteria 3092
353 Ga0265338_10229251 3300028800 Bacteria 1382
354 Ga0265332_10009292 3300031238 Bacteria 4393
355 Ga0265328_10086174 3300031239 Bacteria 1159
356 Ga0265320_10004869 3300031240 Bacteria 8717
357 Ga0265331_10003700 3300031250 Bacteria 9727
358 Ga0265316_10013482 3300031344 Bacteria 7255
359 Ga0265316_10024522 3300031344 Bacteria 5051
360 Ga0265313_10000402 3300031595 Bacteria 46531
361 Ga0265313_10005660 3300031595 Bacteria 9132
362 Ga0265314_10002275 3300031711 Bacteria 19888
363 Ga0265314_10005761 3300031711 Bacteria 11116
364 Ga0265314_10006035 3300031711 Bacteria 10787
365 Ga0265314_10024723 3300031711 Bacteria 4547
366 Ga0265314_10169832 3300031711 Bacteria 1318
367 Ga0316576_10003760 3300031727 Bacteria 8962
368 Ga0373926_0057635 3300035083 Bacteria 1411
369 Ga0373934_0014905 3300035086 Bacteria 2945
370 Ga0373945_0019487 3300035116 Bacteria 2317
371 Ga0373953_0046989 3300035117 Bacteria 1735
372 Ga0373954_0003966 3300035118 Bacteria 6331
373 Ga0373954_0011529 3300035118 Bacteria 3919
374 Ga0373954_0028763 3300035118 Bacteria 2556
375 Ga0373943_0075660 3300035170 Bacteria 1715
376 Ga0373946_0015854 3300035171 Bacteria 2864
377 Ga0373955_0005971 3300035172 Bacteria 5519
378 Ga0373955_0048367 3300035172 Bacteria 2306
379 Ga0373955_0198175 3300035172 Bacteria 1195
380 Ga0373931_0097443 3300035691 Bacteria 1649
381 Ga0373935_0108435 3300035692 Bacteria 1840
382 Ga0373947_0005096 3300035725 Bacteria 7696
383 Ga0373947_0059676 3300035725 Bacteria 2313
384 Ga0373937_0003053 3300036401 Bacteria 14017
385 Ga0373937_0004454 3300036401 Bacteria 11906
386 Ga0373937_0006692 3300036401 Bacteria 9944
387 Ga0373937_0011045 3300036401 Bacteria 7917
388 Ga0373937_0012710 3300036401 Bacteria 7409
389 Ga0373937_0019614 3300036401 Bacteria 6053
390 Ga0373937_0020786 3300036401 Bacteria 5888
391 Ga0373937_0069003 3300036401 Bacteria 3259
392 Ga0373937_0195123 3300036401 Bacteria 1903
393 Ga0316584_0032680 3300036712 Bacteria 3852
394 Ga0373925_0053711 3300037068 Bacteria 3013
395 Ga0373925_0070106 3300037068 Bacteria 2649
396 Ga0373925_0085555 3300037068 Bacteria 2404
397 Ga0373925_0135594 3300037068 Bacteria 1923
398 Ga0373925_0253915 3300037068 Bacteria 1410
399 Ga0436364_0031928 3300037853 Bacteria 1207
400 Ga0436364_0219654 3300037853 Bacteria 5218
401 Ga0436364_0353578 3300037853 Bacteria 9269
402 Ga0436364_0800414 3300037853 Bacteria 1331
403 Ga0436364_0919643 3300037853 Bacteria 6543
404 Ga0436364_1027385 3300037853 Bacteria 3529
405 Ga0436365_0206992 3300039437 Bacteria 8037
406 Ga0436365_0593040 3300039437 Bacteria 2654
407 Ga0436360_0158638 3300039438 Bacteria 1520
408 Ga0436363_0084857 3300039450 Bacteria 1716
409 Ga0436363_0691483 3300039450 Bacteria 10419
410 Ga0436363_0780336 3300039450 Bacteria 3581
411 Ga0436363_1600200 3300039450 Bacteria 4967
412 Ga0436362_0797954 3300039453 Bacteria 4102
413 Ga0451577_0220507 3300042876 Bacteria 1714
414 Ga0451577_0238747 3300042876 Bacteria 1644
415 Ga0453684_0012977 3300044712 Bacteria 13628
416 Ga0453684_0191893 3300044712 Bacteria 2389
417 Ga0495592_0069218 3300046454 Bacteria 2574
418 Ga0495580_0005528 3300046472 Bacteria 10433
419 Ga0495580_0015674 3300046472 Bacteria 5712
420 Ga0495580_0021093 3300046472 Bacteria 4811
421 Ga0495580_0111797 3300046472 Bacteria 1897
422 Ga0495582_0170530 3300046473 Bacteria 1239
423 Ga0495664_0087312 3300046477 Bacteria 1874
424 Ga0495594_0124910 3300046499 Bacteria 1456
425 Ga0495608_0100919 3300046511 Bacteria 1861
426 Ga0495652_0046467 3300046529 Bacteria 3728
427 Ga0495652_0173201 3300046529 Bacteria 1664
428 Ga0495665_0047960 3300046531 Bacteria 2266
429 Ga0495587_0001933 3300046536 Bacteria 13790
430 Ga0495667_0225872 3300046559 Bacteria 1194
431 Ga0495623_0122999 3300046679 Bacteria 1560
432 Ga0495613_0212795 3300046689 Bacteria 1359
433 Ga0495600_0175241 3300046809 Bacteria 1383
434 Ga0495581_0113740 3300047315 Bacteria 1574
435 Ga0495674_0146329 3300047319 Bacteria 1983
436 Ga0495674_0190520 3300047319 Bacteria 1704
437 Ga0495675_0042195 3300047444 Bacteria 2906
438 Ga0495684_0009330 3300047471 Bacteria 7574
439 Ga0495684_0224526 3300047471 Bacteria 1376
440 Ga0495602_0014747 3300048088 Bacteria 7923
441 Ga0495602_0015494 3300048088 Bacteria 7692
442 Ga0496102_0143117 3300048905 Bacteria 2243
443 Ga0496104_0290986 3300048907 Bacteria 1546
444 Ga0496112_0118067 3300048915 Bacteria 2623
445 Ga0496115_0091310 3300048918 Bacteria 2489
446 Ga0496115_0212775 3300048918 Bacteria 1596
447 Ga0501031_0002906 3300049568 Bacteria 10949
448 Ga0501032_0000945 3300049569 Bacteria 23470
449 Ga0501033_0002915 3300049570 Bacteria 14311
450 Ga0501034_0023391 3300049571 Bacteria 6296
451 Ga0501036_0000212 3300049572 Bacteria 38924
452 Ga0501037_0057818 3300049573 Bacteria 2830
453 Ga0501039_0060522 3300049575 Bacteria 2933
454 Ga0501043_0001008 3300049579 Bacteria 24717
455 Ga0501046_0000898 3300049580 Bacteria 29010
456 Ga0501047_0026090 3300049581 Bacteria 5619
457 Ga0501048_0023971 3300049582 Bacteria 4456
458 Ga0501067_0006820 3300049583 Bacteria 6333
459 Ga0501068_0000243 3300049584 Bacteria 26734
460 Ga0501069_0000255 3300049585 Bacteria 24108
461 Ga0501070_0055970 3300049586 Bacteria 3269
462 Ga0501070_0162687 3300049586 Bacteria 1840
463 Ga0501072_0004802 3300049588 Bacteria 10291
464 Ga0501073_0000231 3300049589 Bacteria 36774
465 Ga0501076_0098960 3300049592 Bacteria 2349
466 Ga0501077_0002913 3300049593 Bacteria 10265
467 Ga0501079_0024317 3300049741 Bacteria 4647
468 Ga0501080_0000304 3300049742 Bacteria 37532
469 Ga0501035_0055022 3300049822 Bacteria 3553
470 Ga0501044_0000495 3300049823 Bacteria 47801
471 Ga0501044_0003780 3300049823 Bacteria 17007
472 Ga0501045_0094919 3300049824 Bacteria 2206
473 nmdc:mga05p37_493935_c1 3300050507 Bacteria 1406
474 nmdc:mga0qj67_44660_c1 3300050509 Bacteria 3493
475 nmdc:mga06r32_15791_c1 3300050510 Bacteria 6864
476 nmdc:mga06r32_99732_c1 3300050510 Bacteria 2849
477 nmdc:mga08y16_4691_c1 3300050511 Bacteria 14244
478 nmdc:mga08x19_1068_c1 3300050514 Bacteria 17092
479 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
480 nmdc:mga0a205_157131_c1 3300050515 Bacteria 2172
481 Ga0500568_0000420 3300053139 Bacteria 32093
482 Ga0501084_0007353 3300054114 Bacteria 9074
483 Ga0501082_0007120 3300060353 Bacteria 9650
484 Ga0111539_10080473
485 Ga0065712_10173505
486 Ga0070658_10002926
487 Ga0070658_10262265
488 Ga0070683_100000124
489 Ga0070683_100001975
490 Ga0070683_100011342
491 Ga0070683_100044400
492 Ga0070683_100101640
493 Ga0070683_100213429
494 Ga0070683_100238210
495 Ga0070690_100027535
496 Ga0070680_100009191
497 Ga0070680_100062515
498 Ga0070660_100056282
499 Ga0070689_100235916
500 Ga0070691_10014947
501 Ga0070661_100086995
502 Ga0070661_100190964
503 Ga0070661_100280796
504 Ga0070671_100141134
505 Ga0070671_100297861
506 Ga0070673_100054189
507 Ga0070667_100096117
508 Ga0070709_10142924
509 Ga0070713_100033447
510 Ga0070713_100036507
511 Ga0070713_100051598
512 Ga0070711_100000052
513 Ga0070711_100028390
514 Ga0070711_100038827
515 Ga0070705_100037419
516 Ga0070694_100075346
517 Ga0070681_10000333
518 Ga0070681_10003533
519 Ga0070681_10014554
520 Ga0070681_10076849
521 Ga0070681_10448555
522 Ga0070706_100106294
523 Ga0070699_100000011
524 Ga0070699_100019870
525 Ga0070679_100000177
526 Ga0070679_100013159
527 Ga0070679_100026327
528 Ga0070679_100093714
529 Ga0070679_100253968
530 Ga0070684_100005606
531 Ga0070684_100012164
532 Ga0070684_100013764
533 Ga0070684_100020349
534 Ga0068853_100006848
535 Ga0068853_100016256
536 Ga0068853_100282987
537 Ga0068853_100310869
538 Ga0070696_100000367
539 Ga0070696_100005261
540 Ga0070665_100015660
541 Ga0070665_100042754
542 Ga0070665_100235780
543 Ga0070704_100069804
544 Ga0070704_100087622
545 Ga0068855_100002803
546 Ga0068855_100005384
547 Ga0068855_100020268
548 Ga0068855_100062481
549 Ga0068855_100094196
550 Ga0068855_100164036
551 Ga0068855_100243931
552 Ga0068855_100340532
553 Ga0068855_100414966
554 Ga0068855_100457681
555 Ga0068857_100000804
556 Ga0068857_100008964
557 Ga0068857_100258917
558 Ga0068854_100056038
559 Ga0068854_100345605
560 Ga0068856_100001120
561 Ga0068856_100001203
562 Ga0068856_100027054
563 Ga0068856_100122193
564 Ga0068856_100268504
565 Ga0068856_100399603
566 Ga0068852_100004437
567 Ga0068852_100016443
568 Ga0068852_100273574
569 Ga0068859_100062030
570 Ga0068866_10142723
571 Ga0068863_100059508
572 Ga0068863_100061794
573 Ga0068858_100053881
574 Ga0068860_100064518
575 Ga0081455_10008583
576 Ga0081539_10016086
577 Ga0070712_100085176
578 Ga0097621_100001891
579 Ga0097621_100016689
580 Ga0097621_100034021
581 Ga0097621_100036411
582 Ga0097621_100081524
583 Ga0097621_100112337
584 Ga0097621_100120597
585 Ga0097621_100121770
586 Ga0068871_100012681
587 Ga0068871_100022577
588 Ga0068871_100075031
589 Ga0075428_100000100
590 Ga0075428_100004213
591 Ga0075428_100076098
592 Ga0075430_100072883
593 Ga0075431_100013665
594 Ga0075431_100205584
595 Ga0075434_100057598
596 Ga0075434_100360402
597 Ga0075429_100017707
598 Ga0075429_100196922
599 Ga0068865_100022420
600 Ga0075436_100001065
601 Ga0075436_100007653
602 Ga0097620_100062030
603 Ga0075435_100155943
604 Ga0105240_10000429
605 Ga0105240_10000682
606 Ga0105240_10000781
607 Ga0105240_10002359
608 Ga0105240_10005024
609 Ga0105240_10031811
610 Ga0105240_10047120
611 Ga0105240_10071264
612 Ga0105240_10090852
613 Ga0105240_10210576
614 Ga0105240_10251080
615 Ga0111539_10002662
616 Ga0111539_10003771
617 Ga0105245_10003727
618 Ga0105245_10010083
619 Ga0105245_10012049
620 Ga0105245_10015669
621 Ga0105245_10044670
622 Ga0105245_10086757
623 Ga0105245_10091740
624 Ga0105245_10330237
625 Ga0105245_10459770
626 Ga0114129_10367873
627 Ga0114129_10389728
628 Ga0105243_10045188
629 Ga0105243_10132443
630 Ga0105243_10177521
631 Ga0105241_10004635
632 Ga0105241_10007385
633 Ga0105241_10007784
634 Ga0105241_10020682
635 Ga0105241_10085613
636 Ga0105241_10476786
637 Ga0105242_10021860
638 Ga0105242_10066871
639 Ga0105248_10004128
640 Ga0105248_10095298
641 Ga0105248_10331469
642 Ga0105237_10011226
643 Ga0105237_10017997
644 Ga0105237_10035941
645 Ga0105237_10105500
646 Ga0105237_10255337
647 Ga0105238_10001639
648 Ga0105238_10008172
649 Ga0105238_10014478
650 Ga0105238_10015211
651 Ga0105238_10021250
652 Ga0105238_10025564
653 Ga0105238_10032171
654 Ga0105238_10034360
655 Ga0105238_10204584
656 Ga0105249_10063506
657 Ga0105249_10464589
658 Ga0105249_10535367
659 Ga0105239_10002614
660 Ga0105239_10014347
661 Ga0105239_10026440
662 Ga0105239_10051400
663 Ga0105239_10138590
664 Ga0105239_10138706
665 Ga0105239_10186874
666 Ga0105246_10015476
667 Ga0105246_10019075
668 Ga0105246_10038905
669 Ga0105246_10058401
670 Ga0157370_10001437
671 Ga0157370_10002842
672 Ga0157370_10022760
673 Ga0157370_10031068
674 Ga0157369_10002996
675 Ga0157369_10003435
676 Ga0157369_10005797
677 Ga0157369_10015805
678 Ga0157369_10106385
679 Ga0157369_10112890
680 Ga0157369_10176816
681 Ga0157374_10022916
682 Ga0157374_10121006
683 Ga0157374_10193400
684 Ga0157378_10002561
685 Ga0157378_10024555
686 Ga0163162_10011793
687 Ga0157372_10006323
688 Ga0157372_10006624
689 Ga0157372_10013994
690 Ga0157372_10050727
691 Ga0157372_10162703
692 Ga0157372_10243655
693 Ga0157375_10147282
694 Ga0157375_10379139
695 Ga0163163_10005151
696 Ga0163163_10019911
697 Ga0163163_10022339
698 Ga0163163_10028731
699 Ga0163163_10193824
700 Ga0157380_10058609
701 Ga0157379_10054143
702 Ga0157379_10186063
703 Ga0157376_10173085
704 Ga0157376_10262977
705 Ga0206355_1025311
706 Ga0213874_10002379
707 Ga0213875_10003280
708 Ga0213875_10008620
709 Ga0207642_10054903
710 Ga0207680_10034328
711 Ga0207699_10036540
712 Ga0207705_10062532
713 Ga0207705_10213977
714 Ga0207684_10118355
715 Ga0207654_10015825
716 Ga0207654_10023691
717 Ga0207654_10042845
718 Ga0207654_10125863
719 Ga0207654_10273285
720 Ga0207707_10006756
721 Ga0207707_10010025
722 Ga0207707_10019785
723 Ga0207707_10036433
724 Ga0207707_10073642
725 Ga0207707_10102658
726 Ga0207707_10417098
727 Ga0207695_10000504
728 Ga0207695_10000843
729 Ga0207695_10003331
730 Ga0207695_10008327
731 Ga0207695_10050498
732 Ga0207695_10050566
733 Ga0207695_10070418
734 Ga0207695_10092405
735 Ga0207695_10121882
736 Ga0207671_10010407
737 Ga0207671_10012376
738 Ga0207671_10022640
739 Ga0207663_10000074
740 Ga0207663_10015223
741 Ga0207663_10096458
742 Ga0207663_10149520
743 Ga0207660_10095139
744 Ga0207657_10071303
745 Ga0207657_10072910
746 Ga0207649_10150349
747 Ga0207649_10150703
748 Ga0207649_10193344
749 Ga0207652_10007839
750 Ga0207652_10008232
751 Ga0207652_10038894
752 Ga0207652_10095735
753 Ga0207652_10315187
754 Ga0207681_10006945
755 Ga0207694_10011422
756 Ga0207694_10025118
757 Ga0207694_10028460
758 Ga0207694_10037802
759 Ga0207694_10094711
760 Ga0207694_10118683
761 Ga0207694_10138655
762 Ga0207694_10171936
763 Ga0207687_10001902
764 Ga0207687_10008830
765 Ga0207687_10012119
766 Ga0207687_10015869
767 Ga0207700_10001844
768 Ga0207700_10005539
769 Ga0207700_10040757
770 Ga0207664_10000970
771 Ga0207664_10079960
772 Ga0207644_10134181
773 Ga0207686_10038429
774 Ga0207709_10024154
775 Ga0207670_10083410
776 Ga0207704_10075496
777 Ga0207704_10194466
778 Ga0207711_10006942
779 Ga0207711_10042080
780 Ga0207711_10082265
781 Ga0207689_10008482
782 Ga0207689_10009761
783 Ga0207661_10012216
784 Ga0207661_10029284
785 Ga0207661_10042398
786 Ga0207661_10070854
787 Ga0207661_10172086
788 Ga0207661_10255137
789 Ga0207679_10060693
790 Ga0207667_10000189
791 Ga0207667_10001704
792 Ga0207667_10002671
793 Ga0207667_10032013
794 Ga0207667_10086740
795 Ga0207667_10175599
796 Ga0207712_10063715
797 Ga0207677_10011682
798 Ga0207677_10247430
799 Ga0207703_10038329
800 Ga0207703_10043375
801 Ga0207703_10067285
802 Ga0207703_10071992
803 Ga0207703_10341319
804 Ga0207639_10019984
805 Ga0207639_10231857
806 Ga0207702_10016621
807 Ga0207702_10019172
808 Ga0207702_10037201
809 Ga0207702_10056702
810 Ga0207702_10073848
811 Ga0207702_10074562
812 Ga0207702_10178649
813 Ga0207702_10180395
814 Ga0207702_10351750
815 Ga0207641_10043144
816 Ga0207641_10049778
817 Ga0207641_10208050
818 Ga0207648_10036719
819 Ga0207674_10000110
820 Ga0207674_10000967
821 Ga0207674_10001825
822 Ga0207674_10058111
823 Ga0207674_10113757
824 Ga0207674_10113965
825 Ga0207674_10115144
826 Ga0207698_10006003
827 Ga0207698_10239894
828 Ga0207428_10005059
829 Ga0207428_10091734
830 Ga0268266_10036181
831 Ga0268266_10048641
832 Ga0268264_10007180
833 Ga0268264_10033461
834 Ga0265338_10058894
835 Ga0265338_10067374
836 Ga0265338_10229251
837 Ga0265332_10009292
838 Ga0265328_10086174
839 Ga0265320_10004869
840 Ga0265331_10003700
841 Ga0265316_10013482
842 Ga0265316_10024522
843 Ga0265313_10000402
844 Ga0265313_10005660
845 Ga0265314_10002275
846 Ga0265314_10005761
847 Ga0265314_10006035
848 Ga0265314_10024723
849 Ga0265314_10169832
850 Ga0316576_10003760
851 Ga0373926_0057635
852 Ga0373934_0014905
853 Ga0373945_0019487
854 Ga0373953_0046989
855 Ga0373954_0003966
856 Ga0373954_0011529
857 Ga0373954_0028763
858 Ga0373943_0075660
859 Ga0373946_0015854
860 Ga0373955_0005971
861 Ga0373955_0048367
862 Ga0373955_0198175
863 Ga0373931_0097443
864 Ga0373935_0108435
865 Ga0373947_0005096
866 Ga0373947_0059676
867 Ga0373937_0003053
868 Ga0373937_0004454
869 Ga0373937_0006692
870 Ga0373937_0011045
871 Ga0373937_0012710
872 Ga0373937_0019614
873 Ga0373937_0020786
874 Ga0373937_0069003
875 Ga0373937_0195123
876 Ga0316584_0032680
877 Ga0373925_0053711
878 Ga0373925_0070106
879 Ga0373925_0085555
880 Ga0373925_0135594
881 Ga0373925_0253915
882 Ga0436364_0031928
883 Ga0436364_0219654
884 Ga0436364_0353578
885 Ga0436364_0800414
886 Ga0436364_0919643
887 Ga0436364_1027385
888 Ga0436365_0206992
889 Ga0436365_0593040
890 Ga0436360_0158638
891 Ga0436363_0084857
892 Ga0436363_0691483
893 Ga0436363_0780336
894 Ga0436363_1600200
895 Ga0436362_0797954
896 Ga0451577_0220507
897 Ga0451577_0238747
898 Ga0453684_0012977
899 Ga0453684_0191893
900 Ga0495592_0069218
901 Ga0495580_0005528
902 Ga0495580_0015674
903 Ga0495580_0021093
904 Ga0495580_0111797
905 Ga0495582_0170530
906 Ga0495664_0087312
907 Ga0495594_0124910
908 Ga0495608_0100919
909 Ga0495652_0046467
910 Ga0495652_0173201
911 Ga0495665_0047960
912 Ga0495587_0001933
913 Ga0495667_0225872
914 Ga0495623_0122999
915 Ga0495613_0212795
916 Ga0495600_0175241
917 Ga0495581_0113740
918 Ga0495674_0146329
919 Ga0495674_0190520
920 Ga0495675_0042195
921 Ga0495684_0009330
922 Ga0495684_0224526
923 Ga0495602_0014747
924 Ga0495602_0015494
925 Ga0496102_0143117
926 Ga0496104_0290986
927 Ga0496112_0118067
928 Ga0496115_0091310
929 Ga0496115_0212775
930 Ga0501031_0002906
931 Ga0501032_0000945
932 Ga0501033_0002915
933 Ga0501034_0023391
934 Ga0501036_0000212
935 Ga0501037_0057818
936 Ga0501039_0060522
937 Ga0501043_0001008
938 Ga0501046_0000898
939 Ga0501047_0026090
940 Ga0501048_0023971
941 Ga0501067_0006820
942 Ga0501068_0000243
943 Ga0501069_0000255
944 Ga0501070_0055970
945 Ga0501070_0162687
946 Ga0501072_0004802
947 Ga0501073_0000231
948 Ga0501076_0098960
949 Ga0501077_0002913
950 Ga0501079_0024317
951 Ga0501080_0000304
952 Ga0501035_0055022
953 Ga0501044_0000495
954 Ga0501044_0003780
955 Ga0501045_0094919
956 nmdc:mga05p37_493935_c1
957 nmdc:mga0qj67_44660_c1
958 nmdc:mga06r32_15791_c1
959 nmdc:mga06r32_99732_c1
960 nmdc:mga08y16_4691_c1
961 nmdc:mga08x19_1068_c1
962 nmdc:mga08x19_11_c1
963 nmdc:mga0a205_157131_c1
964 Ga0500568_0000420
965 Ga0501084_0007353
966 Ga0501082_0007120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00154

RecA

recA bacterial DNA recombination protein

86

347

0.99

PF21096

RecA_C

RecA C-terminal domain

350

406

0.97

PF08423

Rad51

Rad51

112

329

0.81

PF06745

ATPase

KaiC

118

326

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmv-assembly2.cif.gz_B mechanism of homologous recombination from the reca-ssdna/dsdna structures 0.9291 10 329
1ube-assembly1.cif.gz_A msreca-adp complex 0.924 7 329
2zrp-assembly1.cif.gz_A msreca datp form ii' 0.9226 9 328
1xmv-assembly1.cif.gz_A e. coli reca in complex with mgadp 0.9221 6 329
2odw-assembly1.cif.gz_A msreca-atp-gama-s complex 0.9219 9 328
ID Description Score Start End Superfamily
af_C0HJ69_348_406_3.30.250.10 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 1.001 273 327 3.30.250.10
af_I1MI58_328_403_3.30.250.10 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9964 271 330 3.30.250.10
2zrcA02 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9933 271 329 3.30.250.10
2zr7A02 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9782 271 328 3.30.250.10
2zriA02 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9765 271 329 3.30.250.10
ID Description Score Start End GO Terms
AF-A0A2H4PKS4-F1-model_v4 Protein RecA 0.992 40 141 GO:0003697
GO:0005524
GO:0005829
GO:0006281
GO:0006310
GO:0140664
AF-A0A2H4PKS4-F1-model_v4 Protein RecA 0.9824 40 141 GO:0003697
GO:0005524
GO:0005829
GO:0006281
GO:0006310
GO:0140664
AF-A0A3D0DFD7-F1-model_v4 Protein RecA 0.9742 226 338 GO:0003697
GO:0005524
GO:0005829
GO:0006281
GO:0006310
GO:0008094
AF-A0A3D0CZB9-F1-model_v4 Protein RecA 0.969 220 332 GO:0003697
GO:0005524
GO:0005829
GO:0006281
GO:0006310
GO:0008094
AF-A0A520D8R1-F1-model_v4 Protein RecA 0.9673 239 332 GO:0003697
GO:0005524
GO:0005829
GO:0006281
GO:0006310
GO:0008094

Map