F452688

General Info

Members Datasets Scaffolds Average Seq Length
482 293 277 182

Family's Representative Sequence

Representative Sequence 3300059493|Ga0587077_005916|Ga0587077_005916_654_1274
Length 206
Sequence VPWHPGSQADDLFQTEFTMKLLSLAFAGALAAASLASQAFAAADDFLTIQLKSGPVVVQLMPEIAPKHVAQVKKLAAEGKYNDVAFHRVIDGFMAQTGDVKFGNLTKGFDARRAGMGGSDLPNIPAEFSKVPFERGTVGMARSQDPNSANSQFFIMFAPGSFLNGQYTVIGKVVSGMENVDKIKRGAGGNGEVSDPDRMIKVTVGK

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
6 2519899620 Rhizobium sp. Pop5 Isolate Nodule
7 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
8 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
9 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
10 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
11 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
12 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
13 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
14 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
15 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
16 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
17 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
18 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
19 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
20 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
21 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
22 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
23 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
24 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
25 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
26 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
27 2643221558 Rhizobium sp. Root149 Isolate Unclassified
28 2643221568 Rhizobium sp. Root564 Isolate Unclassified
29 2643221582 Rhizobium sp. Root651 Isolate Unclassified
30 2643221607 Rhizobium sp. Root73 Isolate Unclassified
31 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
32 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
33 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
34 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
35 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
36 2643221719 Rhizobium sp. Root274 Isolate Unclassified
37 2718217882 Rhizobium sp. N741 Isolate Nodule
38 2718218009 Rhizobium sp. N561 Isolate Nodule
39 2718218363 Rhizobium sp. N113 Isolate Nodule
40 2718218366 Rhizobium sp. N621 Isolate Nodule
41 2721755514 Rhizobium sp. N6212 Isolate Nodule
42 2721755810 Rhizobium sp. N871 Isolate Nodule
43 2728369365 Rhizobium sp. N1341 Isolate Nodule
44 2738541293 Rhizobium sp. GV031 Isolate Unclassified
45 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
46 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
47 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
48 2791355262 Rhizobium sp. M1 Isolate Nodule
49 2791355264 Rhizobium sp. S9 Isolate Nodule
50 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
51 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
52 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
53 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
54 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
55 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
56 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
57 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
58 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
59 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
60 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
61 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
62 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
63 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
64 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
65 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
66 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
67 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
68 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
69 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
70 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
71 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
72 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
73 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
74 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
75 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
76 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
77 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
78 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
79 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
80 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
81 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
82 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
83 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
84 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
85 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
86 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
87 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
88 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
89 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
90 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
91 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
92 2902330777 Methylobacterium sp. 2A Isolate Unclassified
93 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
94 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
95 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
96 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
97 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
98 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
99 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
100 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
101 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
102 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
103 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
104 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
105 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
106 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
107 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
108 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
109 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
110 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
111 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
112 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
113 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
114 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
115 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
116 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
117 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
118 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
119 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
120 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
121 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
122 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
123 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
124 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
125 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
126 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
128 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
129 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
130 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
131 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
132 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
133 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
134 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
135 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
136 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
137 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
138 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
139 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
143 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
144 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
145 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
146 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
147 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
148 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
149 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
150 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
181 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
186 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
203 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
246 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
254 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
281 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
282 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
283 8005382845 Rhizobium sp. R634 Isolate Nodule
284 8005395548 Rhizobium sp. R339 Isolate Nodule
285 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
286 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
287 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
288 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
289 8024501048 Rhizobium sp. H4 Isolate Nodule
290 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
291 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
292 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
293 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 58.3
Metatranscriptomes 5.81
Isolates 35.89

Biome Distribution

Category Percentage (%)
Aerial Root 2.07
Bulb 0
Endosphere 18.26
Nodule 17.43
Rhizoplane 3.94
Rhizosphere 32.78
Stem 0
Stem Tuber 0
Unclassified 25.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000167 3300002739 Bacteria 15671
2 JGI25152J39213_1000470 3300002773 Bacteria 23536
3 JGI25152J39213_1000568 3300002773 Bacteria 20156
4 JGI25150J39212_1000010 3300002774 Bacteria 236260
5 JGI25150J39212_1010497 3300002774 Bacteria 1718
6 JGI25159J45721_1001125 3300002987 Bacteria 11424
7 Ga0006778J45830_1085467 3300003162 Bacteria 1204
8 JGI25151J46595_10000026 3300003187 Bacteria 211045
9 JGI25151J46595_10003454 3300003187 Bacteria 8727
10 JGI25153J46596_10001408 3300003215 Bacteria 14433
11 JGI25153J46596_10034606 3300003215 Bacteria 1648
12 Ga0006777J48905_1110259 3300003308 Bacteria 909
13 JGI25160J50197_1010449 3300003354 Bacteria 3358
14 JGI25161J50226_1001739 3300003374 Bacteria 6159
15 Ga0032354_1080927 3300003693 Bacteria 1189
16 Ga0055526_1006958 3300003771 Bacteria 6004
17 Ga0055526_1010214 3300003771 Bacteria 4395
18 Ga0055526_1030597 3300003771 Bacteria 1566
19 Ga0055524_1003862 3300003775 Bacteria 7107
20 Ga0055536_1002349 3300003781 Bacteria 10712
21 Ga0055528_1005825 3300003790 Bacteria 5664
22 Ga0055540_1004071 3300003792 Bacteria 6778
23 Ga0055540_1004285 3300003792 Bacteria 6516
24 Ga0055531_10003846 3300003794 Bacteria 9402
25 Ga0058692_1002330 3300003856 Bacteria 6416
26 Ga0058692_1009730 3300003856 Bacteria 2409
27 Ga0058692_1023844 3300003856 Bacteria 1236
28 Ga0055543_1000255 3300004625 Bacteria 40071
29 Ga0070670_100000535 3300005331 Bacteria 30434
30 Ga0070668_100415432 3300005347 Bacteria 1151
31 Ga0070668_100442730 3300005347 Bacteria 1116
32 Ga0070667_100600477 3300005367 Bacteria 1014
33 Ga0070663_100171233 3300005455 Bacteria 1679
34 Ga0070681_10726216 3300005458 Bacteria 909
35 Ga0070665_100832855 3300005548 Bacteria 936
36 Ga0068856_100451677 3300005614 Bacteria 1306
37 Ga0068852_100719818 3300005616 Bacteria 1009
38 Ga0075365_10064678 3300006038 Bacteria 2450
39 Ga0075365_10792800 3300006038 Bacteria 669
40 Ga0075364_10000043 3300006051 Bacteria 44079
41 Ga0075364_10160918 3300006051 Bacteria 1515
42 Ga0075367_10351054 3300006178 Bacteria 931
43 Ga0075369_10009230 3300006186 Bacteria 3825
44 Ga0075369_10071842 3300006186 Bacteria 1524
45 Ga0075369_10135048 3300006186 Bacteria 1123
46 Ga0075369_10465359 3300006186 Bacteria 599
47 Ga0075370_10152445 3300006353 Bacteria 1355
48 Ga0079104_1000022 3300006946 Bacteria 223522
49 Ga0099826_10000090 3300006948 Bacteria 44830
50 Ga0099826_10004510 3300006948 Bacteria 9777
51 Ga0105244_10166073 3300009036 Bacteria 1052
52 Ga0105243_10407386 3300009148 Bacteria 1265
53 Ga0105239_10693846 3300010375 Bacteria 1164
54 Ga0105246_10393096 3300011119 Bacteria 1149
55 Ga0157373_10131447 3300013100 Bacteria 1760
56 Ga0157371_10005986 3300013102 Bacteria 10143
57 Ga0157369_10148912 3300013105 Bacteria 2474
58 Ga0163162_10144134 3300013306 Bacteria 2497
59 Ga0157372_10481257 3300013307 Bacteria 1447
60 Ga0182006_1183458 3300015261 Bacteria 697
61 Ga0213871_10076342 3300021441 Bacteria 954
62 Ga0209436_100507 3300025208 Bacteria 17013
63 Ga0209563_101289 3300025230 Bacteria 6852
64 Ga0207425_1000010 3300025245 Bacteria 572898
65 Ga0207425_1003974 3300025245 Bacteria 4547
66 Ga0209129_1000197 3300025258 Bacteria 78908
67 Ga0209129_1001042 3300025258 Bacteria 16374
68 Ga0209129_1015238 3300025258 Bacteria 1592
69 Ga0209673_1002230 3300025273 Bacteria 14043
70 Ga0209673_1006554 3300025273 Bacteria 5584
71 Ga0209130_1000097 3300025284 Bacteria 143750
72 Ga0209025_1000022 3300025294 Bacteria 574487
73 Ga0209025_1001678 3300025294 Bacteria 27100
74 Ga0209025_1022846 3300025294 Bacteria 3298
75 Ga0209025_1080112 3300025294 Bacteria 1113
76 Ga0209564_1000986 3300025295 Bacteria 35645
77 Ga0209758_1000086 3300025297 Bacteria 254778
78 Ga0209758_1000505 3300025297 Bacteria 63185
79 Ga0209758_1000805 3300025297 Bacteria 44274
80 Ga0209758_1001745 3300025297 Bacteria 24202
81 Ga0209758_1007599 3300025297 Bacteria 7316
82 Ga0209050_1004356 3300025298 Bacteria 9613
83 Ga0209256_1009219 3300025299 Bacteria 4372
84 Ga0207426_1000003 3300025302 Bacteria 1063212
85 Ga0209051_1004182 3300025303 Bacteria 9017
86 Ga0209051_1004697 3300025303 Bacteria 8308
87 Ga0209257_1015871 3300025304 Bacteria 3092
88 Ga0207707_10706996 3300025912 Bacteria 846
89 Ga0207650_10014417 3300025925 Bacteria 5494
90 Ga0207668_10332305 3300025972 Bacteria 1265
91 Ga0207668_10348765 3300025972 Bacteria 1237
92 Ga0207678_10060591 3300026067 Bacteria 3255
93 Ga0207678_10196394 3300026067 Bacteria 1725
94 Ga0207702_10284652 3300026078 Bacteria 1564
95 Ga0209281_1000036 3300027111 Bacteria 369415
96 Ga0209281_1000047 3300027111 Bacteria 326514
97 Ga0209371_1000178 3300027312 Bacteria 93894
98 Ga0209371_1000382 3300027312 Bacteria 47344
99 Ga0209371_1041454 3300027312 Bacteria 932
100 Ga0209282_1000235 3300027666 Bacteria 28597
101 Ga0209282_1264013 3300027666 Bacteria 752
102 Ga0268266_10130838 3300028379 Bacteria 2244
103 Ga0268266_10422457 3300028379 Bacteria 1263
104 Ga0307515_10013071 3300028794 Bacteria 15547
105 Ga0307515_10095379 3300028794 Bacteria 3662
106 Ga0268256_1000251 3300030500 Bacteria 56750
107 Ga0268256_1006569 3300030500 Bacteria 4299
108 Ga0268256_1046989 3300030500 Bacteria 932
109 Ga0316181_1013095 3300030744 Bacteria 2040
110 Ga0307514_10249403 3300031649 Bacteria 1053
111 Ga0307405_10026000 3300031731 Bacteria 3370
112 Ga0307413_10432299 3300031824 Bacteria 1040
113 Ga0307406_10006937 3300031901 Bacteria 6274
114 Ga0307412_10000449 3300031911 Bacteria 24913
115 Ga0373943_0694710 3300035170 Bacteria 603
116 Ga0373927_0002488 3300035695 Bacteria 13446
117 Ga0373947_0213461 3300035725 Bacteria 1266
118 Ga0316582_0124041 3300036647 Bacteria 1731
119 Ga0373925_0001826 3300037068 Bacteria 17766
120 Ga0395900_0556409 3300037418 Bacteria 1091
121 Ga0395905_0011890 3300037471 Bacteria 8400
122 Ga0395901_0789012 3300038443 Bacteria 940
123 Ga0436360_0377957 3300039438 Bacteria 916
124 Ga0439465_0013632 3300041413 Bacteria 2532
125 Ga0439465_0014950 3300041413 Bacteria 2422
126 Ga0439465_0161648 3300041413 Bacteria 803
127 Ga0451837_0974919 3300041494 Bacteria 636
128 Ga0450906_051735 3300042145 Bacteria 726
129 Ga0466968_0002442 3300044735 Bacteria 6815
130 Ga0466970_0067559 3300044765 Bacteria 1920
131 Ga0495638_0058932 3300046460 Bacteria 2378
132 Ga0495583_0055378 3300046506 Bacteria 1792
133 Ga0495606_0002073 3300046507 Bacteria 24490
134 Ga0495606_0029987 3300046507 Bacteria 3809
135 Ga0495606_0165939 3300046507 Bacteria 1285
136 Ga0495616_0176257 3300046513 Bacteria 953
137 Ga0495632_0029894 3300046519 Bacteria 2832
138 Ga0495632_0082028 3300046519 Bacteria 1537
139 Ga0495643_0027844 3300046522 Bacteria 3172
140 Ga0495654_0003690 3300046530 Bacteria 9293
141 Ga0495625_0283096 3300046660 Bacteria 1066
142 Ga0495673_0029012 3300047469 Bacteria 2614
143 Ga0495686_0002178 3300047472 Bacteria 19063
144 Ga0495686_0005411 3300047472 Bacteria 10084
145 Ga0495686_0021093 3300047472 Bacteria 4334
146 Ga0495686_0055515 3300047472 Bacteria 2476
147 Ga0495686_0299973 3300047472 Bacteria 887
148 Ga0496100_0328499 3300048903 Bacteria 1150
149 Ga0496101_0748151 3300048904 Bacteria 771
150 Ga0496106_0000478 3300048909 Bacteria 28406
151 Ga0496106_0561753 3300048909 Bacteria 915
152 Ga0496106_0655445 3300048909 Bacteria 839
153 Ga0496108_0371913 3300048911 Bacteria 1248
154 Ga0496111_0003975 3300048914 Bacteria 9283
155 Ga0496114_0385216 3300048917 Bacteria 1241
156 Ga0496116_0000232 3300048919 Bacteria 103015
157 Ga0496116_0113373 3300048919 Bacteria 1586
158 Ga0496116_0114463 3300048919 Bacteria 1575
159 Ga0496116_0130129 3300048919 Bacteria 1436
160 Ga0496116_0134310 3300048919 Bacteria 1404
161 Ga0496117_0012239 3300048920 Bacteria 7587
162 Ga0496117_0058523 3300048920 Bacteria 2668
163 Ga0496117_0058762 3300048920 Bacteria 2661
164 Ga0496117_0094417 3300048920 Bacteria 1914
165 Ga0496118_0016459 3300048921 Bacteria 6783
166 Ga0496118_0020559 3300048921 Bacteria 5850
167 Ga0496118_0066889 3300048921 Bacteria 2621
168 Ga0496118_0066968 3300048921 Bacteria 2619
169 Ga0496118_0071989 3300048921 Bacteria 2485
170 Ga0496118_0072297 3300048921 Bacteria 2478
171 Ga0496119_0023760 3300048922 Bacteria 4335
172 Ga0496119_0047757 3300048922 Bacteria 2660
173 Ga0496119_0107690 3300048922 Bacteria 1553
174 Ga0496119_0209091 3300048922 Bacteria 1005
175 Ga0496120_0011669 3300048923 Bacteria 6028
176 Ga0496121_0000001 3300048924 Bacteria 1830318
177 Ga0496121_0005949 3300048924 Bacteria 15422
178 Ga0496121_0010507 3300048924 Bacteria 10428
179 Ga0496121_0068293 3300048924 Bacteria 2875
180 Ga0496121_0081738 3300048924 Bacteria 2556
181 Ga0496121_0218672 3300048924 Bacteria 1343
182 Ga0496121_0534752 3300048924 Bacteria 736
183 Ga0496121_0702166 3300048924 Bacteria 608
184 Ga0496122_0000025 3300048925 Bacteria 362915
185 Ga0496122_0004632 3300048925 Bacteria 16911
186 Ga0496122_0011586 3300048925 Bacteria 8900
187 Ga0496122_0027499 3300048925 Bacteria 4860
188 Ga0496122_0052212 3300048925 Bacteria 3097
189 Ga0496122_0158031 3300048925 Bacteria 1387
190 Ga0496123_0000032 3300048926 Bacteria 285282
191 Ga0496123_0005205 3300048926 Bacteria 13219
192 Ga0496123_0005232 3300048926 Bacteria 13181
193 Ga0496123_0055421 3300048926 Bacteria 2601
194 Ga0496123_0073377 3300048926 Bacteria 2123
195 Ga0496123_0074234 3300048926 Bacteria 2106
196 Ga0496123_0155040 3300048926 Bacteria 1229
197 Ga0496124_0000377 3300048927 Bacteria 81321
198 Ga0496124_0002623 3300048927 Bacteria 23151
199 Ga0496124_0004853 3300048927 Bacteria 15467
200 Ga0496124_0088751 3300048927 Bacteria 2526
201 Ga0496124_0089526 3300048927 Bacteria 2512
202 Ga0496124_0090858 3300048927 Bacteria 2489
203 Ga0496124_0179238 3300048927 Bacteria 1632
204 Ga0496124_0189891 3300048927 Bacteria 1573
205 Ga0496124_0349072 3300048927 Bacteria 1047
206 Ga0496124_0547335 3300048927 Bacteria 765
207 Ga0496125_0000155 3300048928 Bacteria 151541
208 Ga0496125_0005370 3300048928 Bacteria 14292
209 Ga0496125_0053841 3300048928 Bacteria 3294
210 Ga0496126_0001369 3300048929 Bacteria 38538
211 Ga0496126_0450563 3300048929 Bacteria 1036
212 Ga0501032_0026502 3300049569 Bacteria 3985
213 Ga0501032_0231493 3300049569 Bacteria 1201
214 Ga0501033_0000190 3300049570 Bacteria 58924
215 Ga0501034_0750625 3300049571 Bacteria 871
216 Ga0501034_0955600 3300049571 Bacteria 742
217 Ga0501036_0212407 3300049572 Bacteria 1626
218 Ga0501036_0300209 3300049572 Bacteria 1343
219 Ga0501037_0121929 3300049573 Bacteria 1874
220 Ga0501038_0289215 3300049574 Bacteria 1288
221 Ga0501043_0039644 3300049579 Bacteria 3702
222 Ga0501043_0063470 3300049579 Bacteria 2901
223 Ga0501046_0341524 3300049580 Bacteria 1088
224 Ga0501047_0132631 3300049581 Bacteria 2371
225 Ga0501067_0140107 3300049583 Bacteria 1347
226 Ga0501073_0215620 3300049589 Bacteria 1326
227 Ga0501083_0108576 3300049744 Bacteria 1825
228 Ga0501083_0318867 3300049744 Bacteria 1011
229 Ga0501241_036434 3300049758 Bacteria 943
230 Ga0501280_001680 3300049776 Bacteria 3938
231 Ga0501035_0001475 3300049822 Bacteria 24081
232 Ga0501044_0062346 3300049823 Bacteria 3811
233 Ga0501044_0634278 3300049823 Bacteria 959
234 nmdc:mga00v17_104217_c2 3300050491 Bacteria 1391
235 nmdc:mga00v17_203_c1 3300050491 Bacteria 35824
236 nmdc:mga00v17_305931_c1 3300050491 Bacteria 1033
237 nmdc:mga06z11_164431_c1 3300050494 Bacteria 1270
238 nmdc:mga0sz30_105390_c1 3300050516 Bacteria 1233
239 nmdc:mga0sz30_138738_c1 3300050516 Bacteria 1073
240 nmdc:mga0sz30_151825_c1 3300050516 Bacteria 1025
241 Ga0500556_0199814 3300053104 Bacteria 790
242 Ga0500572_004022 3300053111 Bacteria 3344
243 Ga0500608_178531 3300053122 Bacteria 902
244 Ga0500618_000084 3300053125 Bacteria 76331
245 Ga0500618_015906 3300053125 Bacteria 1891
246 Ga0500658_0012162 3300053134 Bacteria 3170
247 Ga0500559_0014583 3300053136 Bacteria 3321
248 Ga0500568_0003249 3300053139 Bacteria 9186
249 Ga0500568_0185959 3300053139 Bacteria 763
250 Ga0500573_0017553 3300053140 Bacteria 4074
251 Ga0500573_0067641 3300053140 Bacteria 2041
252 Ga0500604_0007494 3300053151 Bacteria 2890
253 Ga0500616_0000703 3300053153 Bacteria 38838
254 Ga0500622_0000778 3300053156 Bacteria 27680
255 Ga0500624_003933 3300053157 Bacteria 1949
256 Ga0500627_0096598 3300053158 Bacteria 1324
257 Ga0500634_0010832 3300053161 Bacteria 4674
258 Ga0500636_0001081 3300053177 Bacteria 14582
259 Ga0587084_006133 3300059477 Bacteria 1447
260 Ga0587077_005916 3300059493 Bacteria 1703
261 Ga0587088_003679 3300059508 Bacteria 1879
262 Ga0587088_020537 3300059508 Bacteria 1096
263 Ga0587088_029200 3300059508 Bacteria 975
264 Ga0587090_000719 3300059510 Bacteria 2967
265 Ga0587090_027862 3300059510 Bacteria 927
266 Ga0587091_007099 3300059511 Bacteria 1603
267 Ga0587062_014462 3300059639 Bacteria 1042
268 Ga0587067_016652 3300059640 Bacteria 1210
269 Ga0587068_003037 3300059641 Bacteria 2108
270 Ga0587069_006072 3300059642 Bacteria 1437
271 Ga0587069_034656 3300059642 Bacteria 834
272 Ga0587072_003485 3300059643 Bacteria 2215
273 Ga0587076_013044 3300059645 Bacteria 1253
274 Ga0587079_012547 3300059647 Bacteria 1387
275 Ga0587079_037366 3300059647 Bacteria 965
276 Ga0587079_071578 3300059647 Bacteria 774
277 Ga0587111_0060649 3300060346 Bacteria 859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0002442 Ga0466968_0002442_1845_2393 160
2 3300048927 Ga0496124_0547335 Ga0496124_0547335_187_735 161
3 iso_pu_bacteria 2767802442 2770195609 162
4 iso_pu_bacteria 2915650412 2915653864 162
5 iso_pu_bacteria 2510917026 2511172607 163
6 iso_pu_bacteria 2513237351 2514589933 163
7 iso_pu_bacteria 2537561587 2537875990 163
8 iso_pu_bacteria 2558860983 2561466504 163
9 iso_pu_bacteria 2585427633 2585995874 163
10 iso_pu_bacteria 2599185210 2599604149 163
11 iso_pu_bacteria 2599185236 2599721500 163
12 iso_pu_bacteria 2600255279 2601608058 163
13 iso_pu_bacteria 2600255308 2601744833 163
14 iso_pu_bacteria 2643221558 2643811900 163
15 iso_pu_bacteria 2643221568 2643857686 163
16 iso_pu_bacteria 2643221582 2643919379 163
17 iso_pu_bacteria 2818991439 2819559775 163
18 iso_pu_bacteria 2821123053 2821127923 163
19 iso_pu_bacteria 2838675328 2838676186 163
20 iso_pu_bacteria 2838714209 2838715068 163
21 iso_pu_bacteria 2838719591 2838721132 163
22 iso_pu_bacteria 2838724970 2838725827 163
23 iso_pu_bacteria 2838736955 2838738347 163
24 iso_pu_bacteria 2841840854 2841841283 163
25 iso_pu_bacteria 2841846520 2841848089 163
26 iso_pu_bacteria 2841859092 2841859360 163
27 iso_pu_bacteria 2842124991 2842125881 163
28 iso_pu_bacteria 2842130223 2842131080 163
29 iso_pu_bacteria 2842140634 2842141061 163
30 iso_pu_bacteria 2842152218 2842153750 163
31 iso_pu_bacteria 2842170452 2842171311 163
32 iso_pu_bacteria 2842175837 2842177370 163
33 iso_pu_bacteria 2842187318 2842188176 163
34 iso_pu_bacteria 2842211629 2842212487 163
35 iso_pu_bacteria 2842224351 2842225894 163
36 iso_pu_bacteria 2842515876 2842516144 163
37 iso_pu_bacteria 2854896431 2854899245 163
38 iso_pu_bacteria 2854916844 2854918728 163
39 iso_pu_bacteria 2857531043 2857534336 163
40 iso_pu_bacteria 2899792073 2899794166 163
41 iso_pu_bacteria 2919114240 2919115159 163
42 iso_pu_bacteria 2919166419 2919167866 163
43 iso_pu_bacteria 2926754445 2926756205 163
44 iso_pu_bacteria 2933006813 2933008396 163
45 iso_pu_bacteria 2933011516 2933013212 163
46 iso_pu_bacteria 2933594066 2933597901 163
47 iso_pu_bacteria 2978969890 2978974318 163
48 iso_pu_bacteria 2979100975 2979103521 163
49 iso_pu_bacteria 2984509177 2984511910 163
50 iso_pu_bacteria 2984518228 2984521730 163
51 iso_pu_bacteria 2984537506 2984541027 163
52 iso_pu_bacteria 2984587000 2984589660 163
53 iso_pu_bacteria 2984601300 2984603308 163
54 iso_pu_bacteria 8003570095 8003571204 163
55 iso_pu_bacteria 8054460903 8054462277 163
56 3300036647 Ga0316582_0124041 Ga0316582_0124041_1180_1686 166
57 3300003187 JGI25151J46595_10003454 JGI25151J46595_100034548 167
58 3300003856 Ga0058692_1002330 Ga0058692_10023301 167
59 3300005347 Ga0070668_100415432 Ga0070668_1004154322 167
60 3300006038 Ga0075365_10064678 Ga0075365_100646783 167
61 3300006038 Ga0075365_10792800 Ga0075365_107928001 167
62 3300006178 Ga0075367_10351054 Ga0075367_103510542 167
63 3300006186 Ga0075369_10009230 Ga0075369_100092304 167
64 3300006186 Ga0075369_10465359 Ga0075369_104653591 167
65 3300006946 Ga0079104_1000022 Ga0079104_1000022126 167
66 3300006948 Ga0099826_10000090 Ga0099826_1000009013 167
67 3300006948 Ga0099826_10004510 Ga0099826_100045103 167
68 3300013100 Ga0157373_10131447 Ga0157373_101314471 167
69 3300013307 Ga0157372_10481257 Ga0157372_104812571 167
70 3300015261 Ga0182006_1183458 Ga0182006_11834581 167
71 3300025294 Ga0209025_1001678 Ga0209025_100167812 167
72 3300025972 Ga0207668_10348765 Ga0207668_103487652 167
73 3300026067 Ga0207678_10060591 Ga0207678_100605914 167
74 3300027111 Ga0209281_1000036 Ga0209281_1000036402 167
75 3300027111 Ga0209281_1000047 Ga0209281_1000047344 167
76 3300027312 Ga0209371_1000178 Ga0209371_100017854 167
77 3300027312 Ga0209371_1000382 Ga0209371_10003823 167
78 3300027312 Ga0209371_1041454 Ga0209371_10414542 167
79 3300027666 Ga0209282_1000235 Ga0209282_100023515 167
80 3300028379 Ga0268266_10130838 Ga0268266_101308384 167
81 3300030500 Ga0268256_1000251 Ga0268256_100025130 167
82 3300030500 Ga0268256_1006569 Ga0268256_10065693 167
83 3300030500 Ga0268256_1046989 Ga0268256_10469891 167
84 3300030744 Ga0316181_1013095 Ga0316181_10130952 167
85 3300031649 Ga0307514_10249403 Ga0307514_102494031 167
86 3300035170 Ga0373943_0694710 Ga0373943_0694710_52_564 167
87 3300035695 Ga0373927_0002488 Ga0373927_0002488_3687_4199 167
88 3300035725 Ga0373947_0213461 Ga0373947_0213461_261_773 167
89 3300037068 Ga0373925_0001826 Ga0373925_0001826_3557_4069 167
90 3300037418 Ga0395900_0556409 Ga0395900_0556409_527_1039 167
91 3300037471 Ga0395905_0011890 Ga0395905_0011890_2142_2654 167
92 3300038443 Ga0395901_0789012 Ga0395901_0789012_378_890 167
93 3300046460 Ga0495638_0058932 Ga0495638_0058932_790_1305 167
94 3300046530 Ga0495654_0003690 Ga0495654_0003690_1278_1787 167
95 3300048914 Ga0496111_0003975 Ga0496111_0003975_1408_1917 167
96 3300048919 Ga0496116_0000232 Ga0496116_0000232_31146_31655 167
97 3300048921 Ga0496118_0020559 Ga0496118_0020559_3855_4364 167
98 3300048921 Ga0496118_0072297 Ga0496118_0072297_1611_2120 167
99 3300048922 Ga0496119_0047757 Ga0496119_0047757_40_549 167
100 3300048924 Ga0496121_0081738 Ga0496121_0081738_1292_1801 167
101 3300048925 Ga0496122_0011586 Ga0496122_0011586_5973_6482 167
102 3300048925 Ga0496122_0027499 Ga0496122_0027499_3873_4382 167
103 3300048926 Ga0496123_0005232 Ga0496123_0005232_10328_10837 167
104 3300048926 Ga0496123_0074234 Ga0496123_0074234_1460_1969 167
105 3300048927 Ga0496124_0090858 Ga0496124_0090858_1023_1532 167
106 3300048929 Ga0496126_0001369 Ga0496126_0001369_26894_27403 167
107 3300049758 Ga0501241_036434 Ga0501241_036434_399_908 167
108 3300050516 nmdc:mga0sz30_151825_c1 nmdc:mga0sz30_151825_c1_91_600 167
109 3300053140 Ga0500573_0017553 Ga0500573_0017553_3010_3519 167
110 3300053140 Ga0500573_0067641 Ga0500573_0067641_769_1278 167
111 3300053153 Ga0500616_0000703 Ga0500616_0000703_16585_17094 167
112 3300053158 Ga0500627_0096598 Ga0500627_0096598_438_953 167
113 3300053177 Ga0500636_0001081 Ga0500636_0001081_10263_10772 167
114 3300059477 Ga0587084_006133 Ga0587084_006133_18_527 167
115 3300059508 Ga0587088_003679 Ga0587088_003679_1233_1742 167
116 3300059510 Ga0587090_000719 Ga0587090_000719_1298_1807 167
117 3300059511 Ga0587091_007099 Ga0587091_007099_200_709 167
118 3300059639 Ga0587062_014462 Ga0587062_014462_464_976 167
119 3300059641 Ga0587068_003037 Ga0587068_003037_1160_1669 167
120 3300059643 Ga0587072_003485 Ga0587072_003485_545_1054 167
121 3300059645 Ga0587076_013044 Ga0587076_013044_188_697 167
122 3300039438 Ga0436360_0377957 Ga0436360_0377957_115_648 169
123 3300011119 Ga0105246_10393096 Ga0105246_103930962 171
124 3300041494 Ga0451837_0974919 Ga0451837_0974919_19_543 171
125 iso_pu_bacteria 2595698237 2596376057 171
126 iso_pu_bacteria 2889306138 2889311641 171
127 iso_pu_bacteria 2902330777 2902335251 171
128 iso_pu_bacteria 2902405164 2902408809 171
129 iso_pu_bacteria 2928125067 2928130259 171
130 3300021441 Ga0213871_10076342 Ga0213871_100763421 174
131 3300030744 Ga0316181_1013095 Ga0316181_10130953 174
132 3300050491 nmdc:mga00v17_104217_c2 nmdc:mga00v17_104217_c2_636_1205 174
133 3300059508 Ga0587088_003679 Ga0587088_003679_627_1196 174
134 iso_pu_bacteria 2837678835 2837680222 175
135 3300003856 Ga0058692_1009730 Ga0058692_10097301 176
136 3300003856 Ga0058692_1023844 Ga0058692_10238441 176
137 3300005458 Ga0070681_10726216 Ga0070681_107262162 176
138 3300005614 Ga0068856_100451677 Ga0068856_1004516772 176
139 3300006186 Ga0075369_10009230 Ga0075369_100092303 176
140 3300025912 Ga0207707_10706996 Ga0207707_107069962 176
141 3300026078 Ga0207702_10284652 Ga0207702_102846523 176
142 3300027312 Ga0209371_1000178 Ga0209371_100017853 176
143 3300027312 Ga0209371_1000382 Ga0209371_10003824 176
144 3300030500 Ga0268256_1000251 Ga0268256_100025129 176
145 3300030500 Ga0268256_1006569 Ga0268256_10065692 176
146 3300059477 Ga0587084_006133 Ga0587084_006133_564_1133 176
147 3300059510 Ga0587090_000719 Ga0587090_000719_1844_2413 176
148 3300059511 Ga0587091_007099 Ga0587091_007099_746_1315 176
149 3300059640 Ga0587067_016652 Ga0587067_016652_333_902 176
150 3300059641 Ga0587068_003037 Ga0587068_003037_554_1123 176
151 3300059643 Ga0587072_003485 Ga0587072_003485_1091_1660 176
152 3300053157 Ga0500624_003933 Ga0500624_003933_1210_1776 177
153 3300053161 Ga0500634_0010832 Ga0500634_0010832_1755_2321 177
154 3300009148 Ga0105243_10407386 Ga0105243_104073862 178
155 3300013306 Ga0163162_10144134 Ga0163162_101441343 178
156 3300048911 Ga0496108_0371913 Ga0496108_0371913_652_1200 178
157 3300048925 Ga0496122_0000025 Ga0496122_0000025_93772_94314 179
158 3300048926 Ga0496123_0000032 Ga0496123_0000032_269899_270441 179
159 3300048927 Ga0496124_0179238 Ga0496124_0179238_460_1002 179
160 iso_pu_bacteria 8055431914 8055435178 182
161 iso_pu_bacteria 2582581304 2585254509 183
162 iso_pu_bacteria 2585427594 2585846563 183
163 iso_pu_bacteria 2599185236 2599721499 183
164 iso_pu_bacteria 2738541293 2738801927 183
165 iso_pu_bacteria 2821123053 2821127922 183
166 iso_pu_bacteria 2838736955 2838738346 183
167 iso_pu_bacteria 2841840854 2841841284 183
168 iso_pu_bacteria 2842140634 2842141062 183
169 iso_pu_bacteria 2857531043 2857534337 183
170 iso_pu_bacteria 2582581283 2585168468 184
171 iso_pu_bacteria 2582581306 2585270042 184
172 iso_pu_bacteria 2582581865 2585389747 184
173 iso_pu_bacteria 2599185156 2599336301 184
174 iso_pu_bacteria 2643221558 2643811899 184
175 iso_pu_bacteria 2643221607 2644049366 184
176 iso_pu_bacteria 2643221636 2644204295 184
177 iso_pu_bacteria 2643221686 2644482400 184
178 iso_pu_bacteria 2643221689 2644502053 184
179 iso_pu_bacteria 2791355253 2793279682 184
180 iso_pu_bacteria 2842922631 2842927726 184
181 iso_pu_bacteria 2889914905 2889918700 184
182 iso_pu_bacteria 8005658619 8005659384 184
183 iso_pu_bacteria 8018150411 8018155439 184
184 3300053140 Ga0500573_0017553 Ga0500573_0017553_2412_2969 185
185 3300053140 Ga0500573_0067641 Ga0500573_0067641_1320_1877 185
186 iso_pu_bacteria 2510917026 2511172606 185
187 iso_pu_bacteria 2513237090 2513609904 185
188 iso_pu_bacteria 2513237138 2513866993 185
189 iso_pu_bacteria 2558860983 2561466503 185
190 iso_pu_bacteria 2582581867 2585403455 185
191 iso_pu_bacteria 2585427590 2585819577 185
192 iso_pu_bacteria 2585427633 2585995873 185
193 iso_pu_bacteria 2585427634 2586000438 185
194 iso_pu_bacteria 2599185210 2599604150 185
195 iso_pu_bacteria 2643221568 2643857687 185
196 iso_pu_bacteria 2643221653 2644300651 185
197 iso_pu_bacteria 2643221719 2644658695 185
198 iso_pu_bacteria 2775507049 2776913373 185
199 iso_pu_bacteria 2818991272 2819241895 185
200 iso_pu_bacteria 2818991439 2819559774 185
201 iso_pu_bacteria 2818991461 2819684695 185
202 iso_pu_bacteria 2838675328 2838676185 185
203 iso_pu_bacteria 2838714209 2838715067 185
204 iso_pu_bacteria 2838719591 2838721133 185
205 iso_pu_bacteria 2838724970 2838725826 185
206 iso_pu_bacteria 2841846520 2841848090 185
207 iso_pu_bacteria 2841859092 2841859359 185
208 iso_pu_bacteria 2842124991 2842125880 185
209 iso_pu_bacteria 2842130223 2842131079 185
210 iso_pu_bacteria 2842152218 2842153751 185
211 iso_pu_bacteria 2842170452 2842171310 185
212 iso_pu_bacteria 2842175837 2842177371 185
213 iso_pu_bacteria 2842187318 2842188175 185
214 iso_pu_bacteria 2842211629 2842212486 185
215 iso_pu_bacteria 2842224351 2842225895 185
216 iso_pu_bacteria 2842515876 2842516143 185
217 iso_pu_bacteria 2854896431 2854899244 185
218 iso_pu_bacteria 2854916844 2854918729 185
219 iso_pu_bacteria 2899792073 2899794167 185
220 iso_pu_bacteria 2899803654 2899808866 185
221 iso_pu_bacteria 2919114240 2919115158 185
222 iso_pu_bacteria 2919166419 2919167867 185
223 iso_pu_bacteria 2919171160 2919175095 185
224 iso_pu_bacteria 2926754445 2926756204 185
225 iso_pu_bacteria 2929138655 2929140428 185
226 iso_pu_bacteria 2933006813 2933008397 185
227 iso_pu_bacteria 2933011516 2933013213 185
228 iso_pu_bacteria 2978969890 2978974319 185
229 iso_pu_bacteria 2979100975 2979103522 185
230 iso_pu_bacteria 2984509177 2984511909 185
231 iso_pu_bacteria 2984518228 2984521731 185
232 iso_pu_bacteria 2984537506 2984541028 185
233 iso_pu_bacteria 2984587000 2984589661 185
234 iso_pu_bacteria 2984601300 2984603309 185
235 iso_pu_bacteria 2989776772 2989778816 185
236 iso_pu_bacteria 3005409236 3005409573 185
237 iso_pu_bacteria 3005452660 3005454084 185
238 iso_pu_bacteria 8005246636 8005248366 185
239 iso_pu_bacteria 8054460903 8054462276 185
240 iso_pu_bacteria 8056875544 8056877654 185
241 3300005548 Ga0070665_100832855 Ga0070665_1008328552 186
242 3300005616 Ga0068852_100719818 Ga0068852_1007198181 186
243 3300009036 Ga0105244_10166073 Ga0105244_101660732 186
244 3300046507 Ga0495606_0165939 Ga0495606_0165939_162_722 186
245 3300048909 Ga0496106_0561753 Ga0496106_0561753_294_854 186
246 3300048924 Ga0496121_0218672 Ga0496121_0218672_485_1045 186
247 3300048924 Ga0496121_0534752 Ga0496121_0534752_16_576 186
248 3300048924 Ga0496121_0702166 Ga0496121_0702166_17_577 186
249 3300048925 Ga0496122_0052212 Ga0496122_0052212_1814_2374 186
250 3300048926 Ga0496123_0055421 Ga0496123_0055421_1490_2050 186
251 3300048927 Ga0496124_0349072 Ga0496124_0349072_376_936 186
252 3300049580 Ga0501046_0341524 Ga0501046_0341524_272_835 186
253 3300049583 Ga0501067_0140107 Ga0501067_0140107_433_996 186
254 3300059642 Ga0587069_006072 Ga0587069_006072_480_1040 186
255 3300059647 Ga0587079_012547 Ga0587079_012547_471_1031 186
256 iso_pu_bacteria 2510917030 2511193387 186
257 iso_pu_bacteria 2519899620 2520379422 186
258 iso_pu_bacteria 2582581298 2585225794 186
259 iso_pu_bacteria 2585427529 2585546754 186
260 iso_pu_bacteria 2615840624 2616292687 186
261 iso_pu_bacteria 2643221643 2644239389 186
262 iso_pu_bacteria 2718217882 2719180958 186
263 iso_pu_bacteria 2718218009 2719731707 186
264 iso_pu_bacteria 2718218363 2721147052 186
265 iso_pu_bacteria 2718218366 2721163970 186
266 iso_pu_bacteria 2721755514 2722840140 186
267 iso_pu_bacteria 2721755810 2724044463 186
268 iso_pu_bacteria 2728369365 2730164195 186
269 iso_pu_bacteria 2791355262 2793337046 186
270 iso_pu_bacteria 2791355264 2793347525 186
271 iso_pu_bacteria 2802429605 2805927738 186
272 iso_pu_bacteria 2838022645 2838025376 186
273 iso_pu_bacteria 2838668709 2838670186 186
274 iso_pu_bacteria 2838701080 2838702557 186
275 iso_pu_bacteria 2842146304 2842146898 186
276 iso_pu_bacteria 2842198810 2842200944 186
277 iso_pu_bacteria 2842250916 2842251963 186
278 iso_pu_bacteria 2842317721 2842318147 186
279 iso_pu_bacteria 2842363717 2842366542 186
280 iso_pu_bacteria 2842489311 2842492888 186
281 iso_pu_bacteria 2842495871 2842496417 186
282 iso_pu_bacteria 2919100787 2919107872 186
283 iso_pu_bacteria 3005445848 3005447319 186
284 iso_pu_bacteria 8005301065 8005306925 186
285 iso_pu_bacteria 8005382845 8005388118 186
286 iso_pu_bacteria 8005395548 8005396925 186
287 iso_pu_bacteria 8005688590 8005694843 186
288 iso_pu_bacteria 8018127388 8018129678 186
289 iso_pu_bacteria 8024501048 8024505350 186
290 iso_pu_bacteria 8046767195 8046773944 186
291 3300002773 JGI25152J39213_1000470 JGI25152J39213_100047019 187
292 3300002773 JGI25152J39213_1000568 JGI25152J39213_10005683 187
293 3300002774 JGI25150J39212_1000010 JGI25150J39212_1000010204 187
294 3300003162 Ga0006778J45830_1085467 Ga0006778J45830_10854671 187
295 3300003187 JGI25151J46595_10000026 JGI25151J46595_10000026184 187
296 3300003215 JGI25153J46596_10001408 JGI25153J46596_1000140816 187
297 3300003308 Ga0006777J48905_1110259 Ga0006777J48905_11102592 187
298 3300003693 Ga0032354_1080927 Ga0032354_10809271 187
299 3300006946 Ga0079104_1000022 Ga0079104_1000022127 187
300 3300025245 Ga0207425_1000010 Ga0207425_1000010531 187
301 3300025258 Ga0209129_1000197 Ga0209129_100019752 187
302 3300025273 Ga0209673_1006554 Ga0209673_10065542 187
303 3300025294 Ga0209025_1000022 Ga0209025_100002252 187
304 3300025297 Ga0209758_1000086 Ga0209758_1000086207 187
305 3300027111 Ga0209281_1000036 Ga0209281_1000036403 187
306 3300027111 Ga0209281_1000047 Ga0209281_1000047345 187
307 3300031731 Ga0307405_10026000 Ga0307405_100260004 187
308 3300031901 Ga0307406_10006937 Ga0307406_100069371 187
309 3300031911 Ga0307412_10000449 Ga0307412_100004497 187
310 3300046519 Ga0495632_0029894 Ga0495632_0029894_829_1392 187
311 3300046519 Ga0495632_0082028 Ga0495632_0082028_649_1212 187
312 3300046530 Ga0495654_0003690 Ga0495654_0003690_1853_2419 187
313 3300047469 Ga0495673_0029012 Ga0495673_0029012_1630_2193 187
314 3300047472 Ga0495686_0005411 Ga0495686_0005411_8035_8598 187
315 3300047472 Ga0495686_0021093 Ga0495686_0021093_261_827 187
316 3300047472 Ga0495686_0299973 Ga0495686_0299973_289_852 187
317 3300048904 Ga0496101_0748151 Ga0496101_0748151_105_668 187
318 3300048919 Ga0496116_0113373 Ga0496116_0113373_1001_1564 187
319 3300048919 Ga0496116_0114463 Ga0496116_0114463_990_1553 187
320 3300048919 Ga0496116_0130129 Ga0496116_0130129_796_1359 187
321 3300048920 Ga0496117_0012239 Ga0496117_0012239_6033_6596 187
322 3300048920 Ga0496117_0058762 Ga0496117_0058762_991_1554 187
323 3300048921 Ga0496118_0016459 Ga0496118_0016459_4922_5485 187
324 3300048921 Ga0496118_0066968 Ga0496118_0066968_428_991 187
325 3300048924 Ga0496121_0068293 Ga0496121_0068293_193_756 187
326 3300048924 Ga0496121_0081738 Ga0496121_0081738_1862_2428 187
327 3300048925 Ga0496122_0004632 Ga0496122_0004632_990_1553 187
328 3300048926 Ga0496123_0005205 Ga0496123_0005205_11301_11864 187
329 3300048927 Ga0496124_0002623 Ga0496124_0002623_15596_16159 187
330 3300048927 Ga0496124_0004853 Ga0496124_0004853_9171_9734 187
331 3300048927 Ga0496124_0088751 Ga0496124_0088751_1735_2301 187
332 3300048928 Ga0496125_0005370 Ga0496125_0005370_11301_11864 187
333 3300053125 Ga0500618_000084 Ga0500618_000084_304_870 187
334 3300053125 Ga0500618_015906 Ga0500618_015906_138_701 187
335 3300053136 Ga0500559_0014583 Ga0500559_0014583_2551_3120 187
336 3300005367 Ga0070667_100600477 Ga0070667_1006004772 188
337 3300028794 Ga0307515_10095379 Ga0307515_100953795 188
338 3300041413 Ga0439465_0014950 Ga0439465_0014950_123_689 188
339 3300046660 Ga0495625_0283096 Ga0495625_0283096_335_904 188
340 3300048914 Ga0496111_0003975 Ga0496111_0003975_1994_2563 188
341 3300048924 Ga0496121_0005949 Ga0496121_0005949_2123_2707 188
342 3300048925 Ga0496122_0027499 Ga0496122_0027499_3227_3796 188
343 3300048926 Ga0496123_0005232 Ga0496123_0005232_9682_10251 188
344 3300059493 Ga0587077_005916 Ga0587077_005916_654_1274 188
345 3300003215 JGI25153J46596_10034606 JGI25153J46596_100346063 189
346 3300003771 Ga0055526_1030597 Ga0055526_10305972 189
347 3300003781 Ga0055536_1002349 Ga0055536_10023493 189
348 3300003792 Ga0055540_1004071 Ga0055540_10040719 189
349 3300003794 Ga0055531_10003846 Ga0055531_100038469 189
350 3300005331 Ga0070670_100000535 Ga0070670_10000053520 189
351 3300006051 Ga0075364_10000043 Ga0075364_1000004315 189
352 3300006051 Ga0075364_10160918 Ga0075364_101609183 189
353 3300006186 Ga0075369_10135048 Ga0075369_101350482 189
354 3300006948 Ga0099826_10004510 Ga0099826_100045102 189
355 3300013102 Ga0157371_10005986 Ga0157371_100059865 189
356 3300013105 Ga0157369_10148912 Ga0157369_101489125 189
357 3300013307 Ga0157372_10481257 Ga0157372_104812572 189
358 3300025230 Ga0209563_101289 Ga0209563_1012895 189
359 3300025294 Ga0209025_1080112 Ga0209025_10801122 189
360 3300025297 Ga0209758_1000805 Ga0209758_100080534 189
361 3300025298 Ga0209050_1004356 Ga0209050_10043569 189
362 3300025303 Ga0209051_1004182 Ga0209051_10041823 189
363 3300025304 Ga0209257_1015871 Ga0209257_10158713 189
364 3300025925 Ga0207650_10014417 Ga0207650_100144176 189
365 3300027666 Ga0209282_1264013 Ga0209282_12640131 189
366 3300028379 Ga0268266_10422457 Ga0268266_104224572 189
367 3300031824 Ga0307413_10432299 Ga0307413_104322992 189
368 3300044765 Ga0466970_0067559 Ga0466970_0067559_40_612 189
369 3300046507 Ga0495606_0002073 Ga0495606_0002073_3409_3978 189
370 3300046507 Ga0495606_0029987 Ga0495606_0029987_602_1171 189
371 3300047472 Ga0495686_0002178 Ga0495686_0002178_993_1562 189
372 3300047472 Ga0495686_0055515 Ga0495686_0055515_1437_2006 189
373 3300048903 Ga0496100_0328499 Ga0496100_0328499_446_1015 189
374 3300048909 Ga0496106_0655445 Ga0496106_0655445_166_738 189
375 3300048917 Ga0496114_0385216 Ga0496114_0385216_332_901 189
376 3300048919 Ga0496116_0000232 Ga0496116_0000232_30508_31077 189
377 3300048920 Ga0496117_0094417 Ga0496117_0094417_502_1071 189
378 3300048921 Ga0496118_0066889 Ga0496118_0066889_1019_1588 189
379 3300048921 Ga0496118_0072297 Ga0496118_0072297_1007_1576 189
380 3300048922 Ga0496119_0023760 Ga0496119_0023760_1054_1623 189
381 3300048922 Ga0496119_0107690 Ga0496119_0107690_265_837 189
382 3300048922 Ga0496119_0209091 Ga0496119_0209091_296_865 189
383 3300048923 Ga0496120_0011669 Ga0496120_0011669_3811_4380 189
384 3300048924 Ga0496121_0000001 Ga0496121_0000001_1717968_1718537 189
385 3300048925 Ga0496122_0011586 Ga0496122_0011586_5369_5938 189
386 3300048926 Ga0496123_0074234 Ga0496123_0074234_823_1392 189
387 3300048926 Ga0496123_0155040 Ga0496123_0155040_89_658 189
388 3300048927 Ga0496124_0000377 Ga0496124_0000377_58751_59320 189
389 3300048927 Ga0496124_0089526 Ga0496124_0089526_1384_1953 189
390 3300048927 Ga0496124_0090858 Ga0496124_0090858_387_956 189
391 3300048928 Ga0496125_0000155 Ga0496125_0000155_28705_29274 189
392 3300048929 Ga0496126_0001369 Ga0496126_0001369_26258_26827 189
393 3300048929 Ga0496126_0450563 Ga0496126_0450563_278_850 189
394 3300049570 Ga0501033_0000190 Ga0501033_0000190_28668_29237 189
395 3300049744 Ga0501083_0318867 Ga0501083_0318867_323_892 189
396 3300049776 Ga0501280_001680 Ga0501280_001680_149_718 189
397 3300049822 Ga0501035_0001475 Ga0501035_0001475_22849_23418 189
398 3300050491 nmdc:mga00v17_203_c1 nmdc:mga00v17_203_c1_14246_14818 189
399 3300050491 nmdc:mga00v17_305931_c1 nmdc:mga00v17_305931_c1_398_967 189
400 3300050494 nmdc:mga06z11_164431_c1 nmdc:mga06z11_164431_c1_484_1053 189
401 3300050516 nmdc:mga0sz30_138738_c1 nmdc:mga0sz30_138738_c1_268_840 189
402 3300053104 Ga0500556_0199814 Ga0500556_0199814_172_744 189
403 3300053111 Ga0500572_004022 Ga0500572_004022_284_853 189
404 3300053122 Ga0500608_178531 Ga0500608_178531_272_841 189
405 3300053153 Ga0500616_0000703 Ga0500616_0000703_17173_17745 189
406 3300053177 Ga0500636_0001081 Ga0500636_0001081_9596_10165 189
407 3300059508 Ga0587088_029200 Ga0587088_029200_202_771 189
408 3300059642 Ga0587069_034656 Ga0587069_034656_128_697 189
409 3300059647 Ga0587079_071578 Ga0587079_071578_152_721 189
410 3300060346 Ga0587111_0060649 Ga0587111_0060649_64_633 189
411 3300002739 JGI25158J39367_1000167 JGI25158J39367_100016710 190
412 3300002774 JGI25150J39212_1010497 JGI25150J39212_10104973 190
413 3300002987 JGI25159J45721_1001125 JGI25159J45721_10011256 190
414 3300003354 JGI25160J50197_1010449 JGI25160J50197_10104493 190
415 3300003374 JGI25161J50226_1001739 JGI25161J50226_10017396 190
416 3300003771 Ga0055526_1006958 Ga0055526_10069585 190
417 3300003771 Ga0055526_1010214 Ga0055526_10102144 190
418 3300003775 Ga0055524_1003862 Ga0055524_10038625 190
419 3300003790 Ga0055528_1005825 Ga0055528_10058257 190
420 3300003792 Ga0055540_1004285 Ga0055540_10042857 190
421 3300004625 Ga0055543_1000255 Ga0055543_100025529 190
422 3300005347 Ga0070668_100442730 Ga0070668_1004427302 190
423 3300005455 Ga0070663_100171233 Ga0070663_1001712331 190
424 3300006186 Ga0075369_10071842 Ga0075369_100718422 190
425 3300006353 Ga0075370_10152445 Ga0075370_101524452 190
426 3300010375 Ga0105239_10693846 Ga0105239_106938461 190
427 3300025208 Ga0209436_100507 Ga0209436_1005079 190
428 3300025245 Ga0207425_1003974 Ga0207425_10039742 190
429 3300025258 Ga0209129_1001042 Ga0209129_100104214 190
430 3300025258 Ga0209129_1015238 Ga0209129_10152382 190
431 3300025273 Ga0209673_1002230 Ga0209673_10022303 190
432 3300025284 Ga0209130_1000097 Ga0209130_1000097128 190
433 3300025294 Ga0209025_1022846 Ga0209025_10228463 190
434 3300025295 Ga0209564_1000986 Ga0209564_100098615 190
435 3300025297 Ga0209758_1000505 Ga0209758_100050550 190
436 3300025297 Ga0209758_1001745 Ga0209758_100174523 190
437 3300025297 Ga0209758_1007599 Ga0209758_10075999 190
438 3300025299 Ga0209256_1009219 Ga0209256_10092193 190
439 3300025302 Ga0207426_1000003 Ga0207426_1000003738 190
440 3300025303 Ga0209051_1004697 Ga0209051_10046975 190
441 3300025972 Ga0207668_10332305 Ga0207668_103323052 190
442 3300026067 Ga0207678_10196394 Ga0207678_101963943 190
443 3300028794 Ga0307515_10013071 Ga0307515_1001307115 190
444 3300041413 Ga0439465_0013632 Ga0439465_0013632_395_967 190
445 3300041413 Ga0439465_0161648 Ga0439465_0161648_122_694 190
446 3300042145 Ga0450906_051735 Ga0450906_051735_66_638 190
447 3300046506 Ga0495583_0055378 Ga0495583_0055378_1085_1657 190
448 3300046513 Ga0495616_0176257 Ga0495616_0176257_227_799 190
449 3300046522 Ga0495643_0027844 Ga0495643_0027844_806_1378 190
450 3300048909 Ga0496106_0000478 Ga0496106_0000478_6829_7401 190
451 3300048919 Ga0496116_0134310 Ga0496116_0134310_702_1274 190
452 3300048920 Ga0496117_0058523 Ga0496117_0058523_965_1537 190
453 3300048921 Ga0496118_0071989 Ga0496118_0071989_94_666 190
454 3300048924 Ga0496121_0010507 Ga0496121_0010507_4147_4719 190
455 3300048925 Ga0496122_0158031 Ga0496122_0158031_786_1358 190
456 3300048926 Ga0496123_0073377 Ga0496123_0073377_338_910 190
457 3300048927 Ga0496124_0189891 Ga0496124_0189891_611_1183 190
458 3300048928 Ga0496125_0053841 Ga0496125_0053841_666_1238 190
459 3300049569 Ga0501032_0026502 Ga0501032_0026502_1294_1866 190
460 3300049569 Ga0501032_0231493 Ga0501032_0231493_487_1059 190
461 3300049571 Ga0501034_0750625 Ga0501034_0750625_19_591 190
462 3300049571 Ga0501034_0955600 Ga0501034_0955600_88_660 190
463 3300049572 Ga0501036_0212407 Ga0501036_0212407_575_1147 190
464 3300049572 Ga0501036_0300209 Ga0501036_0300209_459_1031 190
465 3300049573 Ga0501037_0121929 Ga0501037_0121929_1061_1633 190
466 3300049574 Ga0501038_0289215 Ga0501038_0289215_324_896 190
467 3300049579 Ga0501043_0039644 Ga0501043_0039644_1925_2497 190
468 3300049579 Ga0501043_0063470 Ga0501043_0063470_753_1325 190
469 3300049581 Ga0501047_0132631 Ga0501047_0132631_1524_2096 190
470 3300049589 Ga0501073_0215620 Ga0501073_0215620_144_716 190
471 3300049744 Ga0501083_0108576 Ga0501083_0108576_82_654 190
472 3300049823 Ga0501044_0062346 Ga0501044_0062346_2236_2808 190
473 3300049823 Ga0501044_0634278 Ga0501044_0634278_319_891 190
474 3300050516 nmdc:mga0sz30_105390_c1 nmdc:mga0sz30_105390_c1_424_996 190
475 3300053134 Ga0500658_0012162 Ga0500658_0012162_857_1429 190
476 3300053139 Ga0500568_0003249 Ga0500568_0003249_1919_2491 190
477 3300053139 Ga0500568_0185959 Ga0500568_0185959_35_607 190
478 3300053151 Ga0500604_0007494 Ga0500604_0007494_183_755 190
479 3300053156 Ga0500622_0000778 Ga0500622_0000778_19855_20427 190
480 3300059508 Ga0587088_020537 Ga0587088_020537_380_952 190
481 3300059510 Ga0587090_027862 Ga0587090_027862_212_784 190
482 3300059647 Ga0587079_037366 Ga0587079_037366_200_772 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

46

204

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a5p-assembly1.cif.gz_z human c complex spliceosome - medium-resolution periphery 0.8538 26 188
4dga-assembly1.cif.gz_A trimcyp cyclophilin domain from macaca mulatta: hiv-1 ca(o-loop) complex 0.8528 27 187
2fu0-assembly1.cif.gz_A plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain 0.8523 28 188
7dvq-assembly1.cif.gz_9 cryo-em structure of the activated human minor spliceosome (minor bact complex) 0.8481 27 187
2alf-assembly1.cif.gz_A crystal structure of human cypa mutant k131a 0.8476 27 189
ID Description Score Start End Superfamily
af_A0A0R0L6H2_25_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9039 29 165 2.40.100.10
af_Q2R1J4_31_206_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8504 25 189 2.40.100.10
af_Q7K2I4_1_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8404 25 187 2.40.100.10
af_Q2L6V8_1_174_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8378 27 189 2.40.100.10
af_A0A0R0L6H2_25_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8361 29 165 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A0H3ANU3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9766 32 186 GO:0006457
GO:0140839
GO:0140840
AF-V7EK82-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9745 28 186 GO:0006457
GO:0140839
GO:0140840
AF-A0A1M3BJD7-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9726 39 169 GO:0006457
GO:0140839
GO:0140840
AF-A0A1C2ACI2-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9725 45 186 GO:0006457
GO:0140839
GO:0140840
AF-A0A359I0S7-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9722 28 186 GO:0006457
GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
87.65 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map