F452589

General Info

Members Datasets Scaffolds Average Seq Length
482 253 964 115

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100995684|Ga0075434_1009956842
Length 122
Sequence MPYDDEGDTVIHLVTAIVKPFKLEEIKDALRGAGIVGMTVSEVQGYGRQGGKSETFRGGEYQVSFVPKVKIEVLVETADVDKVIDIIATTGRTGKIGDGKIWATDVDRAMRVRTGEVGAEAL

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
144 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
150 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
250 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 0
Rhizoplane 3.53
Rhizosphere 81.33
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100995684 3300006871 Bacteria 852
2 Ga0070676_10096922 3300005328 Bacteria 1816
3 Ga0070683_101487570 3300005329 Bacteria 651
4 Ga0070670_100226460 3300005331 Bacteria 1627
5 Ga0070680_101846777 3300005336 Bacteria 524
6 Ga0070661_100833763 3300005344 Bacteria 758
7 Ga0070668_101687470 3300005347 Bacteria 581
8 Ga0070675_100288141 3300005354 Bacteria 1445
9 Ga0070671_100000253 3300005355 Bacteria 35862
10 Ga0070673_100592917 3300005364 Bacteria 1010
11 Ga0070659_101586792 3300005366 Bacteria 584
12 Ga0070667_100294115 3300005367 Bacteria 1461
13 Ga0070714_100623739 3300005435 Bacteria 1037
14 Ga0070705_101435450 3300005440 Bacteria 576
15 Ga0070700_101313932 3300005441 Bacteria 608
16 Ga0070694_101777940 3300005444 Bacteria 525
17 Ga0070708_100017349 3300005445 Bacteria 6003
18 Ga0070708_100019390 3300005445 Bacteria 5715
19 Ga0070708_100030924 3300005445 Bacteria 4631
20 Ga0070708_100069612 3300005445 Bacteria 3165
21 Ga0070708_100243477 3300005445 Bacteria 1689
22 Ga0070708_100300976 3300005445 Bacteria 1510
23 Ga0070708_100318231 3300005445 Bacteria 1466
24 Ga0070708_100329373 3300005445 Bacteria 1439
25 Ga0070708_101101862 3300005445 Unclassified 744
26 Ga0070663_101152001 3300005455 Bacteria 680
27 Ga0070681_10004128 3300005458 Bacteria 13734
28 Ga0070681_10022186 3300005458 Bacteria 6372
29 Ga0070681_10241612 3300005458 Bacteria 1719
30 Ga0070681_10459840 3300005458 Bacteria 1185
31 Ga0070706_100032333 3300005467 Bacteria 4825
32 Ga0070706_100108254 3300005467 Bacteria 2586
33 Ga0070706_100171945 3300005467 Bacteria 2023
34 Ga0070706_100246724 3300005467 Bacteria 1667
35 Ga0070706_100339809 3300005467 Bacteria 1400
36 Ga0070706_101647442 3300005467 Bacteria 585
37 Ga0070707_100028631 3300005468 Bacteria 5303
38 Ga0070707_100039443 3300005468 Bacteria 4514
39 Ga0070707_100152181 3300005468 Bacteria 2253
40 Ga0070707_100177336 3300005468 Bacteria 2077
41 Ga0070707_100185245 3300005468 Bacteria 2030
42 Ga0070707_100529977 3300005468 Bacteria 1140
43 Ga0070707_100966281 3300005468 Bacteria 817
44 Ga0070707_101272905 3300005468 Bacteria 702
45 Ga0070707_101359406 3300005468 Bacteria 677
46 Ga0070707_101685285 3300005468 Bacteria 601
47 Ga0070707_101820397 3300005468 Bacteria 576
48 Ga0070698_100113794 3300005471 Bacteria 2671
49 Ga0070699_100758171 3300005518 Bacteria 888
50 Ga0070699_101791750 3300005518 Bacteria 562
51 Ga0070679_100693452 3300005530 Bacteria 961
52 Ga0070697_101018284 3300005536 Bacteria 736
53 Ga0070697_101269354 3300005536 Bacteria 657
54 Ga0070697_101401990 3300005536 Bacteria 624
55 Ga0070697_101497938 3300005536 Bacteria 603
56 Ga0068853_100631890 3300005539 Bacteria 1018
57 Ga0070695_100081862 3300005545 Bacteria 2137
58 Ga0070696_100618140 3300005546 Bacteria 875
59 Ga0070696_100768553 3300005546 Bacteria 791
60 Ga0070665_102216631 3300005548 Bacteria 553
61 Ga0070704_100716424 3300005549 Bacteria 888
62 Ga0070704_101363587 3300005549 Bacteria 650
63 Ga0068856_100059222 3300005614 Bacteria 3783
64 Ga0068864_100939199 3300005618 Bacteria 855
65 Ga0068861_102050057 3300005719 Bacteria 571
66 Ga0068863_102534516 3300005841 Bacteria 522
67 Ga0068858_100010768 3300005842 Bacteria 8647
68 Ga0068858_100015841 3300005842 Bacteria 7086
69 Ga0068860_101492604 3300005843 Bacteria 698
70 Ga0081538_10044152 3300005981 Bacteria 2784
71 Ga0075365_10182594 3300006038 Bacteria 1467
72 Ga0075365_10186725 3300006038 Bacteria 1450
73 Ga0075365_10405229 3300006038 Bacteria 962
74 Ga0075365_10446263 3300006038 Bacteria 913
75 Ga0075365_10470740 3300006038 Bacteria 888
76 Ga0075368_10089605 3300006042 Bacteria 1258
77 Ga0075368_10156960 3300006042 Bacteria 952
78 Ga0075363_100062265 3300006048 Bacteria 2011
79 Ga0075363_100267324 3300006048 Bacteria 987
80 Ga0075363_100474364 3300006048 Bacteria 741
81 Ga0075364_10086972 3300006051 Bacteria 2071
82 Ga0075364_10292406 3300006051 Bacteria 1109
83 Ga0075364_10488582 3300006051 Bacteria 842
84 Ga0075364_10682562 3300006051 Bacteria 701
85 Ga0075364_10874379 3300006051 Bacteria 612
86 Ga0075364_11021377 3300006051 Bacteria 562
87 Ga0075362_10188179 3300006177 Bacteria 1002
88 Ga0075367_10020399 3300006178 Bacteria 3690
89 Ga0075367_10109491 3300006178 Bacteria 1694
90 Ga0075367_10176340 3300006178 Bacteria 1332
91 Ga0075367_10245295 3300006178 Bacteria 1123
92 Ga0075367_10348805 3300006178 Bacteria 934
93 Ga0075367_10494220 3300006178 Bacteria 776
94 Ga0075370_10400887 3300006353 Bacteria 823
95 Ga0075370_11044806 3300006353 Bacteria 501
96 Ga0075428_100000001 3300006844 Bacteria 772630
97 Ga0075428_100301196 3300006844 Bacteria 1723
98 Ga0075430_100013965 3300006846 Bacteria 6845
99 Ga0075431_100004573 3300006847 Bacteria 13589
100 Ga0075431_101437540 3300006847 Bacteria 649
101 Ga0075434_101481280 3300006871 Bacteria 688
102 Ga0075429_100010193 3300006880 Bacteria 8136
103 Ga0075436_100057959 3300006914 Bacteria 2675
104 Ga0075436_100445658 3300006914 Bacteria 942
105 Ga0075435_100043172 3300007076 Bacteria 3609
106 Ga0075435_100109629 3300007076 Bacteria 2295
107 Ga0111539_10343685 3300009094 Bacteria 1737
108 Ga0111539_13440666 3300009094 Bacteria 509
109 Ga0105245_13271152 3300009098 Bacteria 502
110 Ga0105247_10879220 3300009101 Bacteria 690
111 Ga0114129_10000007 3300009147 Bacteria 156645
112 Ga0114129_10250982 3300009147 Bacteria 2375
113 Ga0105243_10991764 3300009148 Bacteria 842
114 Ga0105241_11922060 3300009174 Bacteria 580
115 Ga0105242_11047065 3300009176 Bacteria 827
116 Ga0105242_12190704 3300009176 Bacteria 598
117 Ga0105248_13112681 3300009177 Bacteria 528
118 Ga0105237_11514455 3300009545 Bacteria 677
119 Ga0105238_10833013 3300009551 Bacteria 939
120 Ga0105238_12649954 3300009551 Bacteria 538
121 Ga0157373_11110894 3300013100 Bacteria 593
122 Ga0157369_10391816 3300013105 Bacteria 1441
123 Ga0157369_11689275 3300013105 Bacteria 643
124 Ga0163162_10819020 3300013306 Bacteria 1047
125 Ga0157375_10086204 3300013308 Bacteria 3191
126 Ga0157375_12083148 3300013308 Bacteria 675
127 Ga0163163_10197867 3300014325 Bacteria 2058
128 Ga0163163_10922312 3300014325 Bacteria 937
129 Ga0163163_11217281 3300014325 Bacteria 816
130 Ga0163163_11444998 3300014325 Bacteria 749
131 Ga0163163_11570796 3300014325 Bacteria 719
132 Ga0163163_12560442 3300014325 Bacteria 568
133 Ga0163163_12707755 3300014325 Bacteria 553
134 Ga0157380_11360239 3300014326 Bacteria 759
135 Ga0157379_11083523 3300014968 Bacteria 767
136 Ga0213873_10054416 3300021358 Bacteria 1068
137 Ga0213876_10004144 3300021384 Bacteria 8137
138 Ga0213876_10018577 3300021384 Bacteria 3671
139 Ga0213876_10090734 3300021384 Bacteria 1618
140 Ga0213876_10133900 3300021384 Bacteria 1318
141 Ga0213876_10134197 3300021384 Bacteria 1316
142 Ga0213876_10210248 3300021384 Bacteria 1034
143 Ga0213876_10295287 3300021384 Bacteria 861
144 Ga0213876_10381184 3300021384 Bacteria 750
145 Ga0207692_10993780 3300025898 Bacteria 554
146 Ga0207688_10487180 3300025901 Bacteria 771
147 Ga0207645_10048913 3300025907 Bacteria 2700
148 Ga0207684_10007698 3300025910 Bacteria 9657
149 Ga0207684_10146284 3300025910 Bacteria 2033
150 Ga0207684_10387812 3300025910 Bacteria 1201
151 Ga0207684_10448454 3300025910 Bacteria 1108
152 Ga0207684_10525540 3300025910 Bacteria 1013
153 Ga0207684_10951354 3300025910 Bacteria 720
154 Ga0207707_10018139 3300025912 Bacteria 6133
155 Ga0207707_10073346 3300025912 Bacteria 2985
156 Ga0207707_10139786 3300025912 Bacteria 2117
157 Ga0207671_11296149 3300025914 Bacteria 567
158 Ga0207663_10242779 3300025916 Bacteria 1322
159 Ga0207662_10243473 3300025918 Bacteria 1178
160 Ga0207652_10577655 3300025921 Bacteria 1009
161 Ga0207652_11047268 3300025921 Bacteria 715
162 Ga0207652_11317874 3300025921 Bacteria 625
163 Ga0207646_10014544 3300025922 Bacteria 7469
164 Ga0207646_10049463 3300025922 Bacteria 3765
165 Ga0207646_10117857 3300025922 Bacteria 2385
166 Ga0207646_10202923 3300025922 Bacteria 1791
167 Ga0207646_10396085 3300025922 Bacteria 1247
168 Ga0207646_10458730 3300025922 Bacteria 1149
169 Ga0207646_10688403 3300025922 Bacteria 915
170 Ga0207646_10766270 3300025922 Bacteria 861
171 Ga0207646_10895478 3300025922 Bacteria 787
172 Ga0207646_10946668 3300025922 Bacteria 763
173 Ga0207646_11066363 3300025922 Bacteria 712
174 Ga0207646_11091050 3300025922 Bacteria 703
175 Ga0207646_11394582 3300025922 Bacteria 610
176 Ga0207646_11659287 3300025922 Bacteria 550
177 Ga0207681_10359657 3300025923 Unclassified 1167
178 Ga0207681_11839949 3300025923 Bacteria 505
179 Ga0207694_11822761 3300025924 Bacteria 511
180 Ga0207650_10191090 3300025925 Bacteria 1636
181 Ga0207650_10273801 3300025925 Bacteria 1373
182 Ga0207664_10116553 3300025929 Bacteria 2229
183 Ga0207664_10638583 3300025929 Bacteria 957
184 Ga0207644_10004025 3300025931 Bacteria 9537
185 Ga0207644_10043206 3300025931 Bacteria 3197
186 Ga0207690_11571223 3300025932 Bacteria 550
187 Ga0207709_10777694 3300025935 Bacteria 771
188 Ga0207691_10915241 3300025940 Bacteria 734
189 Ga0207661_11359477 3300025944 Bacteria 652
190 Ga0207679_10928182 3300025945 Bacteria 797
191 Ga0207667_10293512 3300025949 Bacteria 1661
192 Ga0207668_10964400 3300025972 Bacteria 761
193 Ga0207658_10313371 3300025986 Bacteria 1356
194 Ga0207703_10013276 3300026035 Bacteria 6416
195 Ga0207703_10041432 3300026035 Bacteria 3689
196 Ga0207639_10601543 3300026041 Bacteria 1014
197 Ga0207678_11059565 3300026067 Bacteria 718
198 Ga0207678_11188605 3300026067 Bacteria 675
199 Ga0207708_11150136 3300026075 Bacteria 678
200 Ga0207676_10914280 3300026095 Bacteria 861
201 Ga0209813_10101059 3300027866 Bacteria 981
202 Ga0209813_10226573 3300027866 Bacteria 702
203 Ga0209813_10280820 3300027866 Bacteria 641
204 Ga0209813_10340016 3300027866 Bacteria 592
205 Ga0265334_10004822 3300028573 Bacteria 5929
206 Ga0265338_10003838 3300028800 Bacteria 20870
207 Ga0265325_10002255 3300031241 Bacteria 13069
208 Ga0265339_10004555 3300031249 Bacteria 9437
209 Ga0265331_10069752 3300031250 Bacteria 1646
210 Ga0265327_10201392 3300031251 Bacteria 901
211 Ga0265327_10227826 3300031251 Bacteria 836
212 Ga0265316_10051622 3300031344 Bacteria 3230
213 Ga0307408_100162748 3300031548 Bacteria 1774
214 Ga0265313_10004707 3300031595 Bacteria 10302
215 Ga0265314_10029560 3300031711 Bacteria 4071
216 Ga0265342_10502848 3300031712 Bacteria 618
217 Ga0307413_11303020 3300031824 Bacteria 636
218 Ga0307412_10171195 3300031911 Bacteria 1624
219 Ga0307409_101569737 3300031995 Bacteria 686
220 Ga0373930_0011857 3300034816 Bacteria 1580
221 Ga0373948_0008987 3300034817 Bacteria 1714
222 Ga0373928_0094936 3300035084 Bacteria 770
223 Ga0373929_0014939 3300035085 Bacteria 1505
224 Ga0373932_0000134 3300035112 Bacteria 20925
225 Ga0373936_0155835 3300035113 Bacteria 992
226 Ga0373941_0477558 3300035115 Bacteria 527
227 Ga0373945_0222688 3300035116 Bacteria 790
228 Ga0373953_0528034 3300035117 Bacteria 524
229 Ga0373954_0004984 3300035118 Bacteria 5736
230 Ga0373957_0040750 3300035120 Bacteria 1747
231 Ga0373957_0062022 3300035120 Bacteria 1450
232 Ga0373957_0397241 3300035120 Bacteria 593
233 Ga0373943_0210221 3300035170 Bacteria 1080
234 Ga0373955_0230602 3300035172 Bacteria 1107
235 Ga0373961_0361637 3300035241 Bacteria 549
236 Ga0373924_0055117 3300035410 Bacteria 1654
237 Ga0373924_0526414 3300035410 Bacteria 532
238 Ga0373931_0000029 3300035691 Bacteria 116290
239 Ga0373931_0000033 3300035691 Bacteria 94739
240 Ga0373935_0028070 3300035692 Bacteria 3478
241 Ga0373935_1251542 3300035692 Bacteria 554
242 Ga0373927_0018929 3300035695 Bacteria 4518
243 Ga0373927_0040913 3300035695 Bacteria 3006
244 Ga0373933_0000883 3300035724 Bacteria 18320
245 Ga0373933_0358356 3300035724 Bacteria 948
246 Ga0373933_0376147 3300035724 Bacteria 925
247 Ga0373947_0035874 3300035725 Bacteria 2938
248 Ga0373947_0036740 3300035725 Bacteria 2905
249 Ga0373937_0004251 3300036401 Bacteria 12135
250 Ga0373925_0048139 3300037068 Bacteria 3176
251 Ga0373925_0089006 3300037068 Bacteria 2358
252 Ga0436365_0177383 3300039437 Bacteria 4794
253 Ga0436365_0292234 3300039437 Bacteria 3363
254 Ga0436365_0493874 3300039437 Bacteria 9510
255 Ga0436365_0513887 3300039437 Bacteria 750
256 Ga0436365_0647853 3300039437 Bacteria 1837
257 Ga0436365_1095224 3300039437 Bacteria 3924
258 Ga0436365_1134178 3300039437 Bacteria 8465
259 Ga0436365_1292179 3300039437 Bacteria 549
260 Ga0436365_1886045 3300039437 Bacteria 4054
261 Ga0436362_0619249 3300039453 Bacteria 5178
262 Ga0436362_0712511 3300039453 Bacteria 711
263 Ga0436362_1261218 3300039453 Bacteria 10405
264 Ga0439438_018514 3300041405 Bacteria 1982
265 Ga0439439_0035310 3300041406 Bacteria 1284
266 Ga0439439_0048895 3300041406 Bacteria 1107
267 Ga0439465_0143569 3300041413 Bacteria 849
268 Ga0439465_0363669 3300041413 Bacteria 548
269 Ga0451791_1258252 3300041451 Bacteria 1360
270 Ga0451802_0184681 3300041460 Bacteria 651
271 Ga0451802_0768334 3300041460 Bacteria 520
272 Ga0451837_0145419 3300041494 Bacteria 695
273 Ga0451837_0707467 3300041494 Bacteria 715
274 Ga0451839_0256837 3300041496 Bacteria 548
275 Ga0451843_0352310 3300041509 Bacteria 575
276 Ga0451853_0193852 3300041512 Bacteria 572
277 Ga0439433_0145115 3300041999 Bacteria 609
278 Ga0439445_0015847 3300042004 Bacteria 1850
279 Ga0439432_136586 3300042006 Bacteria 722
280 Ga0439432_156071 3300042006 Bacteria 669
281 Ga0439451_136466 3300042009 Bacteria 502
282 Ga0439452_026976 3300042010 Bacteria 1446
283 Ga0439462_0052571 3300042015 Bacteria 1096
284 Ga0439463_015122 3300042016 Bacteria 1908
285 Ga0439434_0023536 3300042435 Bacteria 1856
286 Ga0439434_0036447 3300042435 Bacteria 1504
287 Ga0439434_0101472 3300042435 Bacteria 927
288 Ga0439459_0221321 3300042438 Bacteria 524
289 Ga0453683_0794946 3300044673 Bacteria 623
290 Ga0466963_0108636 3300044694 Bacteria 1903
291 Ga0466968_0161034 3300044735 Bacteria 1036
292 Ga0466957_0053056 3300044842 Bacteria 2471
293 Ga0466957_1137892 3300044842 Bacteria 563
294 Ga0466960_0324028 3300044901 Bacteria 873
295 Ga0466967_0915090 3300045976 Bacteria 872
296 Ga0495592_0002231 3300046454 Bacteria 13664
297 Ga0495592_0198646 3300046454 Bacteria 1355
298 Ga0495592_0342558 3300046454 Bacteria 961
299 Ga0495629_0005400 3300046459 Bacteria 9532
300 Ga0495629_0218710 3300046459 Bacteria 1314
301 Ga0495629_0244641 3300046459 Bacteria 1235
302 Ga0495651_0000479 3300046462 Bacteria 30785
303 Ga0495651_0008314 3300046462 Bacteria 7952
304 Ga0495651_0340680 3300046462 Bacteria 993
305 Ga0495653_0000553 3300046463 Bacteria 28588
306 Ga0495653_0191089 3300046463 Bacteria 1397
307 Ga0495653_0602140 3300046463 Bacteria 675
308 Ga0495653_0778296 3300046463 Bacteria 576
309 Ga0495653_0858653 3300046463 Bacteria 543
310 Ga0495582_0469522 3300046473 Bacteria 727
311 Ga0495662_0176624 3300046476 Bacteria 1053
312 Ga0495662_0188481 3300046476 Bacteria 1017
313 Ga0495662_0594594 3300046476 Bacteria 541
314 Ga0495664_0390348 3300046477 Bacteria 836
315 Ga0495584_0050445 3300046491 Bacteria 2096
316 Ga0495585_0537373 3300046492 Bacteria 553
317 Ga0495608_0000376 3300046511 Bacteria 31189
318 Ga0495608_0021109 3300046511 Bacteria 4472
319 Ga0495608_0448852 3300046511 Bacteria 785
320 Ga0495618_0005542 3300046514 Bacteria 7684
321 Ga0495618_0018351 3300046514 Bacteria 4295
322 Ga0495628_0041473 3300046516 Bacteria 3674
323 Ga0495630_0051241 3300046517 Bacteria 3090
324 Ga0495630_0452244 3300046517 Bacteria 984
325 Ga0495630_0809852 3300046517 Bacteria 715
326 Ga0495652_0006143 3300046529 Bacteria 11225
327 Ga0495652_0506516 3300046529 Bacteria 836
328 Ga0495652_0580970 3300046529 Bacteria 767
329 Ga0495640_0000612 3300046533 Bacteria 26306
330 Ga0495640_0010403 3300046533 Bacteria 7196
331 Ga0495640_0295032 3300046533 Bacteria 1008
332 Ga0495640_0639241 3300046533 Bacteria 641
333 Ga0495587_0001125 3300046536 Bacteria 17493
334 Ga0495587_0267060 3300046536 Bacteria 960
335 Ga0495645_0021402 3300046543 Bacteria 4674
336 Ga0495645_0085446 3300046543 Bacteria 2258
337 Ga0495667_0000294 3300046559 Bacteria 32145
338 Ga0495667_0024114 3300046559 Bacteria 4097
339 Ga0495667_0149049 3300046559 Bacteria 1506
340 Ga0495634_0008930 3300046642 Bacteria 7421
341 Ga0495635_0000828 3300046663 Bacteria 20258
342 Ga0495635_0043029 3300046663 Bacteria 3117
343 Ga0495635_0394008 3300046663 Bacteria 920
344 Ga0495635_0706020 3300046663 Bacteria 654
345 Ga0495657_0027370 3300046675 Bacteria 4025
346 Ga0495657_0034867 3300046675 Bacteria 3492
347 Ga0495599_0004220 3300046678 Bacteria 8490
348 Ga0495599_0053561 3300046678 Bacteria 2527
349 Ga0495599_0265613 3300046678 Bacteria 1042
350 Ga0495623_0001907 3300046679 Bacteria 13995
351 Ga0495623_0009474 3300046679 Bacteria 6323
352 Ga0495623_0019279 3300046679 Bacteria 4409
353 Ga0495646_0005159 3300046680 Bacteria 8241
354 Ga0495646_0031881 3300046680 Bacteria 3282
355 Ga0495658_0095499 3300046683 Bacteria 1767
356 Ga0495613_0038952 3300046689 Bacteria 3524
357 Ga0495624_0182608 3300046690 Bacteria 1278
358 Ga0495600_0013933 3300046809 Bacteria 5066
359 Ga0495604_0000972 3300047317 Bacteria 23909
360 Ga0495674_0009055 3300047319 Bacteria 9455
361 Ga0495674_0324128 3300047319 Bacteria 1254
362 Ga0495676_0030408 3300047321 Bacteria 4584
363 Ga0495676_0385616 3300047321 Bacteria 932
364 Ga0495680_0003511 3300047322 Bacteria 15382
365 Ga0495680_0003955 3300047322 Bacteria 14330
366 Ga0495675_0003250 3300047444 Bacteria 9763
367 Ga0495675_0076445 3300047444 Bacteria 2110
368 Ga0495684_0002466 3300047471 Bacteria 14757
369 Ga0495684_0231654 3300047471 Bacteria 1350
370 Ga0495593_0022589 3300047673 Bacteria 3503
371 Ga0495602_0002877 3300048088 Bacteria 17634
372 Ga0495602_0088872 3300048088 Bacteria 2571
373 Ga0495614_0084763 3300048089 Bacteria 1375
374 Ga0495614_0316119 3300048089 Unclassified 724
375 Ga0496100_1206392 3300048903 Bacteria 597
376 Ga0496104_0379524 3300048907 Bacteria 1326
377 Ga0496104_0728333 3300048907 Bacteria 899
378 Ga0496105_0880803 3300048908 Bacteria 676
379 Ga0496108_0167905 3300048911 Bacteria 1898
380 Ga0496108_0226323 3300048911 Bacteria 1626
381 Ga0496109_1710017 3300048912 Bacteria 563
382 Ga0496110_0009049 3300048913 Bacteria 8035
383 Ga0496110_1825644 3300048913 Bacteria 518
384 Ga0496111_0049843 3300048914 Bacteria 3019
385 Ga0496112_0012211 3300048915 Bacteria 7884
386 Ga0496112_0058088 3300048915 Bacteria 3809
387 Ga0496113_0482037 3300048916 Bacteria 996
388 Ga0496114_0512659 3300048917 Bacteria 1061
389 Ga0501031_0332825 3300049568 Bacteria 983
390 Ga0501032_0011987 3300049569 Bacteria 6207
391 Ga0501033_0019047 3300049570 Bacteria 5189
392 Ga0501034_0001930 3300049571 Bacteria 26274
393 Ga0501034_0011354 3300049571 Bacteria 9236
394 Ga0501034_0025255 3300049571 Bacteria 6047
395 Ga0501034_0059287 3300049571 Bacteria 3845
396 Ga0501034_0072435 3300049571 Bacteria 3454
397 Ga0501034_0145893 3300049571 Bacteria 2344
398 Ga0501034_1204352 3300049571 Bacteria 636
399 Ga0501036_0172991 3300049572 Bacteria 1819
400 Ga0501037_0033366 3300049573 Bacteria 3802
401 Ga0501037_0609567 3300049573 Bacteria 732
402 Ga0501038_0036395 3300049574 Bacteria 4320
403 Ga0501038_1396055 3300049574 Bacteria 503
404 Ga0501040_1004907 3300049576 Bacteria 605
405 Ga0501043_0141199 3300049579 Bacteria 1886
406 Ga0501047_0093217 3300049581 Bacteria 2891
407 Ga0501047_0370685 3300049581 Bacteria 1267
408 Ga0501067_0010703 3300049583 Bacteria 5074
409 Ga0501067_0423690 3300049583 Bacteria 743
410 Ga0501067_0805236 3300049583 Bacteria 529
411 Ga0501068_0113911 3300049584 Bacteria 1683
412 Ga0501068_0146027 3300049584 Bacteria 1485
413 Ga0501068_0206701 3300049584 Bacteria 1246
414 Ga0501068_0713112 3300049584 Bacteria 656
415 Ga0501069_0433505 3300049585 Bacteria 780
416 Ga0501070_0041861 3300049586 Bacteria 3814
417 Ga0501070_0818811 3300049586 Bacteria 730
418 Ga0501071_0094061 3300049587 Bacteria 2204
419 Ga0501071_0773950 3300049587 Bacteria 740
420 Ga0501072_0022569 3300049588 Bacteria 4880
421 Ga0501072_0027809 3300049588 Bacteria 4412
422 Ga0501072_0572104 3300049588 Bacteria 892
423 Ga0501073_0195486 3300049589 Bacteria 1399
424 Ga0501074_0173331 3300049590 Bacteria 1539
425 Ga0501074_0295273 3300049590 Bacteria 1151
426 Ga0501079_0391382 3300049741 Bacteria 1090
427 Ga0501080_0131279 3300049742 Bacteria 2319
428 Ga0501080_0227429 3300049742 Bacteria 1706
429 Ga0501080_1357746 3300049742 Bacteria 607
430 Ga0501080_1680185 3300049742 Bacteria 536
431 Ga0501035_0147710 3300049822 Bacteria 2041
432 Ga0501044_0000932 3300049823 Bacteria 35145
433 Ga0501044_0080421 3300049823 Bacteria 3301
434 nmdc:mga03683_202581_c1 3300050489 Bacteria 911
435 nmdc:mga03n38_252992_c1 3300050490 Bacteria 931
436 nmdc:mga03n38_90102_c1 3300050490 Bacteria 1458
437 nmdc:mga00v17_302042_c1 3300050491 Bacteria 1040
438 nmdc:mga00v17_612298_c1 3300050491 Bacteria 702
439 nmdc:mga00v17_737668_c1 3300050491 Bacteria 630
440 nmdc:mga0yw44_228219_c1 3300050492 Bacteria 1235
441 nmdc:mga0yw44_289095_c1 3300050492 Bacteria 1097
442 nmdc:mga0yw44_31962_c1 3300050492 Bacteria 3064
443 nmdc:mga0yw44_679449_c1 3300050492 Bacteria 700
444 nmdc:mga0yw44_684789_c1 3300050492 Bacteria 697
445 nmdc:mga06z11_12712_c1 3300050494 Bacteria 3669
446 nmdc:mga06z11_203244_c1 3300050494 Bacteria 1151
447 nmdc:mga06z11_596667_c1 3300050494 Bacteria 672
448 nmdc:mga06z11_700906_c1 3300050494 Bacteria 617
449 nmdc:mga04h51_374930_c1 3300050495 Bacteria 592
450 nmdc:mga04h51_414487_c1 3300050495 Bacteria 566
451 nmdc:mga07m45_254511_c1 3300050496 Bacteria 1021
452 nmdc:mga05p37_208783_c1 3300050507 Bacteria 2361
453 nmdc:mga05p37_58574_c1 3300050507 Bacteria 4744
454 nmdc:mga09592_1031_c1 3300050508 Bacteria 22165
455 nmdc:mga09592_143408_c1 3300050508 Bacteria 2059
456 nmdc:mga0qj67_10076_c1 3300050509 Bacteria 7053
457 nmdc:mga06r32_6123_c1 3300050510 Bacteria 10805
458 nmdc:mga0n895_1869095_c1 3300050512 Bacteria 560
459 nmdc:mga0n895_934402_c1 3300050512 Bacteria 851
460 nmdc:mga0rr50_123648_c1 3300050513 Bacteria 2063
461 nmdc:mga0rr50_277522_c1 3300050513 Bacteria 1398
462 nmdc:mga08x19_115399_c1 3300050514 Bacteria 1795
463 Ga0495601_0001493 3300053077 Bacteria 12895
464 Ga0495601_0028561 3300053077 Bacteria 3455
465 Ga0495601_0083978 3300053077 Bacteria 2045
466 Ga0495612_0069407 3300053078 Bacteria 1467
467 Ga0500635_0015947 3300053080 Bacteria 2226
468 Ga0495595_0004500 3300053084 Bacteria 5606
469 Ga0495595_0010662 3300053084 Bacteria 3826
470 Ga0495595_0312600 3300053084 Bacteria 791
471 Ga0495619_0000426 3300053085 Bacteria 28605
472 Ga0495619_0007516 3300053085 Bacteria 6902
473 Ga0495619_0022120 3300053085 Bacteria 4065
474 Ga0495619_0757512 3300053085 Bacteria 658
475 Ga0500603_073177 3300053150 Bacteria 980
476 Ga0500604_0168658 3300053151 Bacteria 748
477 Ga0500616_0004601 3300053153 Bacteria 9748
478 Ga0501084_0860760 3300054114 Bacteria 763
479 Ga0501084_1369248 3300054114 Bacteria 593
480 Ga0501082_1003630 3300060353 Bacteria 730
481 Ga0501082_1237289 3300060353 Bacteria 652
482 Ga0501082_1672752 3300060353 Bacteria 555
483 Ga0075434_100995684
484 Ga0070676_10096922
485 Ga0070683_101487570
486 Ga0070670_100226460
487 Ga0070680_101846777
488 Ga0070661_100833763
489 Ga0070668_101687470
490 Ga0070675_100288141
491 Ga0070671_100000253
492 Ga0070673_100592917
493 Ga0070659_101586792
494 Ga0070667_100294115
495 Ga0070714_100623739
496 Ga0070705_101435450
497 Ga0070700_101313932
498 Ga0070694_101777940
499 Ga0070708_100017349
500 Ga0070708_100019390
501 Ga0070708_100030924
502 Ga0070708_100069612
503 Ga0070708_100243477
504 Ga0070708_100300976
505 Ga0070708_100318231
506 Ga0070708_100329373
507 Ga0070708_101101862
508 Ga0070663_101152001
509 Ga0070681_10004128
510 Ga0070681_10022186
511 Ga0070681_10241612
512 Ga0070681_10459840
513 Ga0070706_100032333
514 Ga0070706_100108254
515 Ga0070706_100171945
516 Ga0070706_100246724
517 Ga0070706_100339809
518 Ga0070706_101647442
519 Ga0070707_100028631
520 Ga0070707_100039443
521 Ga0070707_100152181
522 Ga0070707_100177336
523 Ga0070707_100185245
524 Ga0070707_100529977
525 Ga0070707_100966281
526 Ga0070707_101272905
527 Ga0070707_101359406
528 Ga0070707_101685285
529 Ga0070707_101820397
530 Ga0070698_100113794
531 Ga0070699_100758171
532 Ga0070699_101791750
533 Ga0070679_100693452
534 Ga0070697_101018284
535 Ga0070697_101269354
536 Ga0070697_101401990
537 Ga0070697_101497938
538 Ga0068853_100631890
539 Ga0070695_100081862
540 Ga0070696_100618140
541 Ga0070696_100768553
542 Ga0070665_102216631
543 Ga0070704_100716424
544 Ga0070704_101363587
545 Ga0068856_100059222
546 Ga0068864_100939199
547 Ga0068861_102050057
548 Ga0068863_102534516
549 Ga0068858_100010768
550 Ga0068858_100015841
551 Ga0068860_101492604
552 Ga0081538_10044152
553 Ga0075365_10182594
554 Ga0075365_10186725
555 Ga0075365_10405229
556 Ga0075365_10446263
557 Ga0075365_10470740
558 Ga0075368_10089605
559 Ga0075368_10156960
560 Ga0075363_100062265
561 Ga0075363_100267324
562 Ga0075363_100474364
563 Ga0075364_10086972
564 Ga0075364_10292406
565 Ga0075364_10488582
566 Ga0075364_10682562
567 Ga0075364_10874379
568 Ga0075364_11021377
569 Ga0075362_10188179
570 Ga0075367_10020399
571 Ga0075367_10109491
572 Ga0075367_10176340
573 Ga0075367_10245295
574 Ga0075367_10348805
575 Ga0075367_10494220
576 Ga0075370_10400887
577 Ga0075370_11044806
578 Ga0075428_100000001
579 Ga0075428_100301196
580 Ga0075430_100013965
581 Ga0075431_100004573
582 Ga0075431_101437540
583 Ga0075434_101481280
584 Ga0075429_100010193
585 Ga0075436_100057959
586 Ga0075436_100445658
587 Ga0075435_100043172
588 Ga0075435_100109629
589 Ga0111539_10343685
590 Ga0111539_13440666
591 Ga0105245_13271152
592 Ga0105247_10879220
593 Ga0114129_10000007
594 Ga0114129_10250982
595 Ga0105243_10991764
596 Ga0105241_11922060
597 Ga0105242_11047065
598 Ga0105242_12190704
599 Ga0105248_13112681
600 Ga0105237_11514455
601 Ga0105238_10833013
602 Ga0105238_12649954
603 Ga0157373_11110894
604 Ga0157369_10391816
605 Ga0157369_11689275
606 Ga0163162_10819020
607 Ga0157375_10086204
608 Ga0157375_12083148
609 Ga0163163_10197867
610 Ga0163163_10922312
611 Ga0163163_11217281
612 Ga0163163_11444998
613 Ga0163163_11570796
614 Ga0163163_12560442
615 Ga0163163_12707755
616 Ga0157380_11360239
617 Ga0157379_11083523
618 Ga0213873_10054416
619 Ga0213876_10004144
620 Ga0213876_10018577
621 Ga0213876_10090734
622 Ga0213876_10133900
623 Ga0213876_10134197
624 Ga0213876_10210248
625 Ga0213876_10295287
626 Ga0213876_10381184
627 Ga0207692_10993780
628 Ga0207688_10487180
629 Ga0207645_10048913
630 Ga0207684_10007698
631 Ga0207684_10146284
632 Ga0207684_10387812
633 Ga0207684_10448454
634 Ga0207684_10525540
635 Ga0207684_10951354
636 Ga0207707_10018139
637 Ga0207707_10073346
638 Ga0207707_10139786
639 Ga0207671_11296149
640 Ga0207663_10242779
641 Ga0207662_10243473
642 Ga0207652_10577655
643 Ga0207652_11047268
644 Ga0207652_11317874
645 Ga0207646_10014544
646 Ga0207646_10049463
647 Ga0207646_10117857
648 Ga0207646_10202923
649 Ga0207646_10396085
650 Ga0207646_10458730
651 Ga0207646_10688403
652 Ga0207646_10766270
653 Ga0207646_10895478
654 Ga0207646_10946668
655 Ga0207646_11066363
656 Ga0207646_11091050
657 Ga0207646_11394582
658 Ga0207646_11659287
659 Ga0207681_10359657
660 Ga0207681_11839949
661 Ga0207694_11822761
662 Ga0207650_10191090
663 Ga0207650_10273801
664 Ga0207664_10116553
665 Ga0207664_10638583
666 Ga0207644_10004025
667 Ga0207644_10043206
668 Ga0207690_11571223
669 Ga0207709_10777694
670 Ga0207691_10915241
671 Ga0207661_11359477
672 Ga0207679_10928182
673 Ga0207667_10293512
674 Ga0207668_10964400
675 Ga0207658_10313371
676 Ga0207703_10013276
677 Ga0207703_10041432
678 Ga0207639_10601543
679 Ga0207678_11059565
680 Ga0207678_11188605
681 Ga0207708_11150136
682 Ga0207676_10914280
683 Ga0209813_10101059
684 Ga0209813_10226573
685 Ga0209813_10280820
686 Ga0209813_10340016
687 Ga0265334_10004822
688 Ga0265338_10003838
689 Ga0265325_10002255
690 Ga0265339_10004555
691 Ga0265331_10069752
692 Ga0265327_10201392
693 Ga0265327_10227826
694 Ga0265316_10051622
695 Ga0307408_100162748
696 Ga0265313_10004707
697 Ga0265314_10029560
698 Ga0265342_10502848
699 Ga0307413_11303020
700 Ga0307412_10171195
701 Ga0307409_101569737
702 Ga0373930_0011857
703 Ga0373948_0008987
704 Ga0373928_0094936
705 Ga0373929_0014939
706 Ga0373932_0000134
707 Ga0373936_0155835
708 Ga0373941_0477558
709 Ga0373945_0222688
710 Ga0373953_0528034
711 Ga0373954_0004984
712 Ga0373957_0040750
713 Ga0373957_0062022
714 Ga0373957_0397241
715 Ga0373943_0210221
716 Ga0373955_0230602
717 Ga0373961_0361637
718 Ga0373924_0055117
719 Ga0373924_0526414
720 Ga0373931_0000029
721 Ga0373931_0000033
722 Ga0373935_0028070
723 Ga0373935_1251542
724 Ga0373927_0018929
725 Ga0373927_0040913
726 Ga0373933_0000883
727 Ga0373933_0358356
728 Ga0373933_0376147
729 Ga0373947_0035874
730 Ga0373947_0036740
731 Ga0373937_0004251
732 Ga0373925_0048139
733 Ga0373925_0089006
734 Ga0436365_0177383
735 Ga0436365_0292234
736 Ga0436365_0493874
737 Ga0436365_0513887
738 Ga0436365_0647853
739 Ga0436365_1095224
740 Ga0436365_1134178
741 Ga0436365_1292179
742 Ga0436365_1886045
743 Ga0436362_0619249
744 Ga0436362_0712511
745 Ga0436362_1261218
746 Ga0439438_018514
747 Ga0439439_0035310
748 Ga0439439_0048895
749 Ga0439465_0143569
750 Ga0439465_0363669
751 Ga0451791_1258252
752 Ga0451802_0184681
753 Ga0451802_0768334
754 Ga0451837_0145419
755 Ga0451837_0707467
756 Ga0451839_0256837
757 Ga0451843_0352310
758 Ga0451853_0193852
759 Ga0439433_0145115
760 Ga0439445_0015847
761 Ga0439432_136586
762 Ga0439432_156071
763 Ga0439451_136466
764 Ga0439452_026976
765 Ga0439462_0052571
766 Ga0439463_015122
767 Ga0439434_0023536
768 Ga0439434_0036447
769 Ga0439434_0101472
770 Ga0439459_0221321
771 Ga0453683_0794946
772 Ga0466963_0108636
773 Ga0466968_0161034
774 Ga0466957_0053056
775 Ga0466957_1137892
776 Ga0466960_0324028
777 Ga0466967_0915090
778 Ga0495592_0002231
779 Ga0495592_0198646
780 Ga0495592_0342558
781 Ga0495629_0005400
782 Ga0495629_0218710
783 Ga0495629_0244641
784 Ga0495651_0000479
785 Ga0495651_0008314
786 Ga0495651_0340680
787 Ga0495653_0000553
788 Ga0495653_0191089
789 Ga0495653_0602140
790 Ga0495653_0778296
791 Ga0495653_0858653
792 Ga0495582_0469522
793 Ga0495662_0176624
794 Ga0495662_0188481
795 Ga0495662_0594594
796 Ga0495664_0390348
797 Ga0495584_0050445
798 Ga0495585_0537373
799 Ga0495608_0000376
800 Ga0495608_0021109
801 Ga0495608_0448852
802 Ga0495618_0005542
803 Ga0495618_0018351
804 Ga0495628_0041473
805 Ga0495630_0051241
806 Ga0495630_0452244
807 Ga0495630_0809852
808 Ga0495652_0006143
809 Ga0495652_0506516
810 Ga0495652_0580970
811 Ga0495640_0000612
812 Ga0495640_0010403
813 Ga0495640_0295032
814 Ga0495640_0639241
815 Ga0495587_0001125
816 Ga0495587_0267060
817 Ga0495645_0021402
818 Ga0495645_0085446
819 Ga0495667_0000294
820 Ga0495667_0024114
821 Ga0495667_0149049
822 Ga0495634_0008930
823 Ga0495635_0000828
824 Ga0495635_0043029
825 Ga0495635_0394008
826 Ga0495635_0706020
827 Ga0495657_0027370
828 Ga0495657_0034867
829 Ga0495599_0004220
830 Ga0495599_0053561
831 Ga0495599_0265613
832 Ga0495623_0001907
833 Ga0495623_0009474
834 Ga0495623_0019279
835 Ga0495646_0005159
836 Ga0495646_0031881
837 Ga0495658_0095499
838 Ga0495613_0038952
839 Ga0495624_0182608
840 Ga0495600_0013933
841 Ga0495604_0000972
842 Ga0495674_0009055
843 Ga0495674_0324128
844 Ga0495676_0030408
845 Ga0495676_0385616
846 Ga0495680_0003511
847 Ga0495680_0003955
848 Ga0495675_0003250
849 Ga0495675_0076445
850 Ga0495684_0002466
851 Ga0495684_0231654
852 Ga0495593_0022589
853 Ga0495602_0002877
854 Ga0495602_0088872
855 Ga0495614_0084763
856 Ga0495614_0316119
857 Ga0496100_1206392
858 Ga0496104_0379524
859 Ga0496104_0728333
860 Ga0496105_0880803
861 Ga0496108_0167905
862 Ga0496108_0226323
863 Ga0496109_1710017
864 Ga0496110_0009049
865 Ga0496110_1825644
866 Ga0496111_0049843
867 Ga0496112_0012211
868 Ga0496112_0058088
869 Ga0496113_0482037
870 Ga0496114_0512659
871 Ga0501031_0332825
872 Ga0501032_0011987
873 Ga0501033_0019047
874 Ga0501034_0001930
875 Ga0501034_0011354
876 Ga0501034_0025255
877 Ga0501034_0059287
878 Ga0501034_0072435
879 Ga0501034_0145893
880 Ga0501034_1204352
881 Ga0501036_0172991
882 Ga0501037_0033366
883 Ga0501037_0609567
884 Ga0501038_0036395
885 Ga0501038_1396055
886 Ga0501040_1004907
887 Ga0501043_0141199
888 Ga0501047_0093217
889 Ga0501047_0370685
890 Ga0501067_0010703
891 Ga0501067_0423690
892 Ga0501067_0805236
893 Ga0501068_0113911
894 Ga0501068_0146027
895 Ga0501068_0206701
896 Ga0501068_0713112
897 Ga0501069_0433505
898 Ga0501070_0041861
899 Ga0501070_0818811
900 Ga0501071_0094061
901 Ga0501071_0773950
902 Ga0501072_0022569
903 Ga0501072_0027809
904 Ga0501072_0572104
905 Ga0501073_0195486
906 Ga0501074_0173331
907 Ga0501074_0295273
908 Ga0501079_0391382
909 Ga0501080_0131279
910 Ga0501080_0227429
911 Ga0501080_1357746
912 Ga0501080_1680185
913 Ga0501035_0147710
914 Ga0501044_0000932
915 Ga0501044_0080421
916 nmdc:mga03683_202581_c1
917 nmdc:mga03n38_252992_c1
918 nmdc:mga03n38_90102_c1
919 nmdc:mga00v17_302042_c1
920 nmdc:mga00v17_612298_c1
921 nmdc:mga00v17_737668_c1
922 nmdc:mga0yw44_228219_c1
923 nmdc:mga0yw44_289095_c1
924 nmdc:mga0yw44_31962_c1
925 nmdc:mga0yw44_679449_c1
926 nmdc:mga0yw44_684789_c1
927 nmdc:mga06z11_12712_c1
928 nmdc:mga06z11_203244_c1
929 nmdc:mga06z11_596667_c1
930 nmdc:mga06z11_700906_c1
931 nmdc:mga04h51_374930_c1
932 nmdc:mga04h51_414487_c1
933 nmdc:mga07m45_254511_c1
934 nmdc:mga05p37_208783_c1
935 nmdc:mga05p37_58574_c1
936 nmdc:mga09592_1031_c1
937 nmdc:mga09592_143408_c1
938 nmdc:mga0qj67_10076_c1
939 nmdc:mga06r32_6123_c1
940 nmdc:mga0n895_1869095_c1
941 nmdc:mga0n895_934402_c1
942 nmdc:mga0rr50_123648_c1
943 nmdc:mga0rr50_277522_c1
944 nmdc:mga08x19_115399_c1
945 Ga0495601_0001493
946 Ga0495601_0028561
947 Ga0495601_0083978
948 Ga0495612_0069407
949 Ga0500635_0015947
950 Ga0495595_0004500
951 Ga0495595_0010662
952 Ga0495595_0312600
953 Ga0495619_0000426
954 Ga0495619_0007516
955 Ga0495619_0022120
956 Ga0495619_0757512
957 Ga0500603_073177
958 Ga0500604_0168658
959 Ga0500616_0004601
960 Ga0501084_0860760
961 Ga0501084_1369248
962 Ga0501082_1003630
963 Ga0501082_1237289
964 Ga0501082_1672752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

11

116

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4y-assembly4.cif.gz_K glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.9836 2 113
3t9z-assembly1.cif.gz_A a. fulgidus glnk3, ligand-free 0.9775 3 109
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9756 3 113
2xzw-assembly2.cif.gz_E structure of pii from synechococcus elongatus in complex with 2- oxoglutarate at low 2-og concentrations 0.973 3 112
3lf0-assembly1.cif.gz_A crystal structure of the atp bound mycobacterium tuberculosis nitrogen regulatory pii protein 0.97 2 113
ID Description Score Start End Superfamily
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9571 2 112 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9412 2 113 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9344 2 109 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9227 3 112 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9043 3 112 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9463 3 113 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A517TUK5-F1-model_v4 Nitrogen regulatory protein P-II 0.9377 3 108 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9278 3 113 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1G1A2I2-F1-model_v4 Transcriptional regulator 0.9213 3 113 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1F9V954-F1-model_v4 Transcriptional regulator 0.9202 3 113 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map