F452570

General Info

Members Datasets Scaffolds Average Seq Length
482 230 964 321

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100170803|Ga0070695_1001708031
Length 364
Sequence VADVQCCGHGSQRRSVPSGLGALGRRAVIGSRRHHVTRFGYAGGELALSEIREFSVEADSNVRLDLFIAQRGELSRTQAATLIAQGHVLVDGRREKASYKPEEGEVVRVEIPTVEKRAISGEDIPITVVYEDDSLLVVDKPAGMVVHPAPGNWSGTLVNALLGRGGALSKEGEPERAGMVHRLDKETSGLLIVAKTDRAHRLLSSAIAARRVTRRYAVMTWGHLSSDHLTIDKPIARDPRDRKRMAIVNKGRPAKTDVTRLARFDAGDLLRAHLHSGRTHQIRVHLASIGHPVMGDDVYGVAGLPPKRHFLHAAWLAFNHPVTGKPLDFRSPLPDDLRHALGVIAGEHALPAGVDPLVAFRFYE

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.45
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100170803 3300005545 Bacteria 1534
2 Ga0070658_10097101 3300005327 Bacteria 2433
3 Ga0070676_10004531 3300005328 Bacteria 7316
4 Ga0070676_10105335 3300005328 Bacteria 1748
5 Ga0070683_100000914 3300005329 Bacteria 21921
6 Ga0070683_100027041 3300005329 Bacteria 5171
7 Ga0070683_100060543 3300005329 Bacteria 3519
8 Ga0070683_100071236 3300005329 Bacteria 3243
9 Ga0070683_100079680 3300005329 Bacteria 3065
10 Ga0070683_100084391 3300005329 Bacteria 2976
11 Ga0070683_100164074 3300005329 Unclassified 2108
12 Ga0070690_100088306 3300005330 Bacteria 2038
13 Ga0070690_100158530 3300005330 Bacteria 1549
14 Ga0070670_100008893 3300005331 Bacteria 8574
15 Ga0070670_100014929 3300005331 Bacteria 6665
16 Ga0070670_100103007 3300005331 Bacteria 2459
17 Ga0070670_100395802 3300005331 Bacteria 1219
18 Ga0068869_100002218 3300005334 Bacteria 11689
19 Ga0068869_100020679 3300005334 Bacteria 4518
20 Ga0070666_10144696 3300005335 Bacteria 1657
21 Ga0070680_100000010 3300005336 Bacteria 97194
22 Ga0070680_100002659 3300005336 Bacteria 13245
23 Ga0070680_100007078 3300005336 Bacteria 8552
24 Ga0070680_100016417 3300005336 Bacteria 5828
25 Ga0070680_100050422 3300005336 Bacteria 3395
26 Ga0070680_100077788 3300005336 Bacteria 2732
27 Ga0070680_100082563 3300005336 Bacteria 2652
28 Ga0068868_100002398 3300005338 Bacteria 12969
29 Ga0068868_100072494 3300005338 Bacteria 2748
30 Ga0070660_100089783 3300005339 Bacteria 2422
31 Ga0070689_100159859 3300005340 Bacteria 1821
32 Ga0070691_10014564 3300005341 Bacteria 3609
33 Ga0070687_100001965 3300005343 Bacteria 7518
34 Ga0070687_100021187 3300005343 Bacteria 3051
35 Ga0070661_100001030 3300005344 Bacteria 19749
36 Ga0070661_100008294 3300005344 Bacteria 7175
37 Ga0070661_100008603 3300005344 Bacteria 7059
38 Ga0070661_100038698 3300005344 Bacteria 3473
39 Ga0070661_100048359 3300005344 Bacteria 3113
40 Ga0070661_100176500 3300005344 Unclassified 1624
41 Ga0070661_100225480 3300005344 Bacteria 1439
42 Ga0070692_10016003 3300005345 Bacteria 3560
43 Ga0070692_10071121 3300005345 Bacteria 1853
44 Ga0070675_100003654 3300005354 Bacteria 11704
45 Ga0070675_100031034 3300005354 Bacteria 4318
46 Ga0070675_100044681 3300005354 Bacteria 3622
47 Ga0070671_100019849 3300005355 Bacteria 5476
48 Ga0070674_100067753 3300005356 Bacteria 2512
49 Ga0070673_100051016 3300005364 Bacteria 3237
50 Ga0070673_100052435 3300005364 Bacteria 3200
51 Ga0070673_100137202 3300005364 Bacteria 2060
52 Ga0070659_100006150 3300005366 Bacteria 8665
53 Ga0070709_10005733 3300005434 Bacteria 6733
54 Ga0070709_10052754 3300005434 Bacteria 2558
55 Ga0070714_100013023 3300005435 Bacteria 6654
56 Ga0070710_10027153 3300005437 Bacteria 3051
57 Ga0070701_10008088 3300005438 Bacteria 4527
58 Ga0070701_10165649 3300005438 Bacteria 1284
59 Ga0070694_100057095 3300005444 Bacteria 2653
60 Ga0070708_100000168 3300005445 Bacteria 46393
61 Ga0070663_100049575 3300005455 Bacteria 2983
62 Ga0070662_100004363 3300005457 Bacteria 8938
63 Ga0070681_10007526 3300005458 Bacteria 10642
64 Ga0070681_10011072 3300005458 Bacteria 8920
65 Ga0070681_10031391 3300005458 Bacteria 5333
66 Ga0070681_10121071 3300005458 Bacteria 2552
67 Ga0070681_10123429 3300005458 Bacteria 2522
68 Ga0068867_100029785 3300005459 Bacteria 3934
69 Ga0068867_100056744 3300005459 Bacteria 2898
70 Ga0068867_100161952 3300005459 Bacteria 1765
71 Ga0070685_10039975 3300005466 Bacteria 2667
72 Ga0070706_100150428 3300005467 Bacteria 2173
73 Ga0070679_100010525 3300005530 Bacteria 8776
74 Ga0070679_100016597 3300005530 Bacteria 7110
75 Ga0070679_100030886 3300005530 Bacteria 5292
76 Ga0070679_100048529 3300005530 Bacteria 4229
77 Ga0070679_100099954 3300005530 Bacteria 2888
78 Ga0070679_100117647 3300005530 Bacteria 2643
79 Ga0070679_100167953 3300005530 Bacteria 2167
80 Ga0070679_100182529 3300005530 Bacteria 2070
81 Ga0070684_100003904 3300005535 Bacteria 11289
82 Ga0070684_100016125 3300005535 Bacteria 6104
83 Ga0070684_100022792 3300005535 Bacteria 5229
84 Ga0070684_100032908 3300005535 Bacteria 4423
85 Ga0070684_100106879 3300005535 Bacteria 2506
86 Ga0070684_100339480 3300005535 Bacteria 1381
87 Ga0070684_100384492 3300005535 Bacteria 1293
88 Ga0068853_100057008 3300005539 Bacteria 3370
89 Ga0068853_100129743 3300005539 Bacteria 2256
90 Ga0070672_100203851 3300005543 Bacteria 1655
91 Ga0070672_100289407 3300005543 Bacteria 1387
92 Ga0070672_100373409 3300005543 Bacteria 1219
93 Ga0070696_100022547 3300005546 Bacteria 4279
94 Ga0070693_100002950 3300005547 Bacteria 7869
95 Ga0068855_100069366 3300005563 Bacteria 4102
96 Ga0070664_100001163 3300005564 Bacteria 20879
97 Ga0070664_100032756 3300005564 Bacteria 4348
98 Ga0070664_100044697 3300005564 Bacteria 3740
99 Ga0070664_100071199 3300005564 Bacteria 2979
100 Ga0070664_100138780 3300005564 Bacteria 2139
101 Ga0070664_100290259 3300005564 Unclassified 1476
102 Ga0068857_100009994 3300005577 Bacteria 8236
103 Ga0068857_100015156 3300005577 Bacteria 6726
104 Ga0068857_100027056 3300005577 Bacteria 5059
105 Ga0068857_100112463 3300005577 Bacteria 2448
106 Ga0068857_100415759 3300005577 Bacteria 1253
107 Ga0068856_100050751 3300005614 Bacteria 4090
108 Ga0068856_100062778 3300005614 Bacteria 3670
109 Ga0068856_100124169 3300005614 Bacteria 2584
110 Ga0068856_100561058 3300005614 Bacteria 1163
111 Ga0068852_100003850 3300005616 Bacteria 10540
112 Ga0068852_100172504 3300005616 Bacteria 2029
113 Ga0068859_100028004 3300005617 Bacteria 5650
114 Ga0068859_100043445 3300005617 Bacteria 4516
115 Ga0068864_100011386 3300005618 Bacteria 7350
116 Ga0068864_100034642 3300005618 Bacteria 4295
117 Ga0068861_100002906 3300005719 Bacteria 11291
118 Ga0068851_10142154 3300005834 Bacteria 1306
119 Ga0068870_10108900 3300005840 Bacteria 1578
120 Ga0068863_100013062 3300005841 Bacteria 8010
121 Ga0068858_100173809 3300005842 Bacteria 2032
122 Ga0068860_100302351 3300005843 Bacteria 1567
123 Ga0068862_100000345 3300005844 Bacteria 50340
124 Ga0070716_100030214 3300006173 Bacteria 2937
125 Ga0070716_100078849 3300006173 Bacteria 1959
126 Ga0070712_100027829 3300006175 Bacteria 3777
127 Ga0070712_100065478 3300006175 Bacteria 2579
128 Ga0097621_100067231 3300006237 Bacteria 2954
129 Ga0075428_100135699 3300006844 Bacteria 2675
130 Ga0075428_100137561 3300006844 Bacteria 2655
131 Ga0075430_100039156 3300006846 Bacteria 4015
132 Ga0075431_100010008 3300006847 Bacteria 9525
133 Ga0075431_100133159 3300006847 Bacteria 2563
134 Ga0075433_10018376 3300006852 Bacteria 5811
135 Ga0075433_10142410 3300006852 Bacteria 2131
136 Ga0075434_100024355 3300006871 Bacteria 5917
137 Ga0075434_100043530 3300006871 Bacteria 4453
138 Ga0068865_100023733 3300006881 Bacteria 4020
139 Ga0075436_100002301 3300006914 Bacteria 13163
140 Ga0097620_100028003 3300006931 Bacteria 5650
141 Ga0097620_100043442 3300006931 Bacteria 4516
142 Ga0075435_100219742 3300007076 Bacteria 1613
143 Ga0105240_10057070 3300009093 Bacteria 4882
144 Ga0105240_10309745 3300009093 Bacteria 1803
145 Ga0111539_10018859 3300009094 Bacteria 8535
146 Ga0105245_10244055 3300009098 Bacteria 1742
147 Ga0105245_10262855 3300009098 Bacteria 1680
148 Ga0114129_10009248 3300009147 Bacteria 14052
149 Ga0114129_10023207 3300009147 Bacteria 8800
150 Ga0114129_10141803 3300009147 Bacteria 3293
151 Ga0105243_10414739 3300009148 Bacteria 1254
152 Ga0105241_10055886 3300009174 Unclassified 3025
153 Ga0105242_10003307 3300009176 Bacteria 12547
154 Ga0105242_10115718 3300009176 Bacteria 2293
155 Ga0105248_10001631 3300009177 Bacteria 24934
156 Ga0105248_10019818 3300009177 Bacteria 7449
157 Ga0105248_10069952 3300009177 Bacteria 3941
158 Ga0105237_10110044 3300009545 Bacteria 2747
159 Ga0105238_10060734 3300009551 Bacteria 3784
160 Ga0105249_10000276 3300009553 Bacteria 54132
161 Ga0105249_10025588 3300009553 Bacteria 5315
162 Ga0105249_10202466 3300009553 Bacteria 1943
163 Ga0105246_10001879 3300011119 Bacteria 12645
164 Ga0157373_10008991 3300013100 Bacteria 7390
165 Ga0157371_10003912 3300013102 Bacteria 13253
166 Ga0157371_10017373 3300013102 Bacteria 5348
167 Ga0157370_10005892 3300013104 Bacteria 13661
168 Ga0157370_10029655 3300013104 Bacteria 5366
169 Ga0157370_10042235 3300013104 Bacteria 4395
170 Ga0157370_10063356 3300013104 Bacteria 3503
171 Ga0157369_10010955 3300013105 Bacteria 10322
172 Ga0157369_10028668 3300013105 Bacteria 6158
173 Ga0157369_10197536 3300013105 Bacteria 2111
174 Ga0157374_10001983 3300013296 Bacteria 17163
175 Ga0157374_10198874 3300013296 Bacteria 1962
176 Ga0157378_10020643 3300013297 Bacteria 5794
177 Ga0157378_10204904 3300013297 Bacteria 1867
178 Ga0163162_10025161 3300013306 Bacteria 5883
179 Ga0157372_10009898 3300013307 Bacteria 10140
180 Ga0157372_10012842 3300013307 Bacteria 8928
181 Ga0157372_10069755 3300013307 Bacteria 3954
182 Ga0157372_10247897 3300013307 Bacteria 2067
183 Ga0157372_10407057 3300013307 Unclassified 1585
184 Ga0157375_10033974 3300013308 Bacteria 4853
185 Ga0157375_10034069 3300013308 Bacteria 4847
186 Ga0157375_10052054 3300013308 Bacteria 4024
187 Ga0157375_10135353 3300013308 Bacteria 2587
188 Ga0163163_10004641 3300014325 Bacteria 11742
189 Ga0157380_10009657 3300014326 Bacteria 6918
190 Ga0157377_10002307 3300014745 Bacteria 8396
191 Ga0157377_10087976 3300014745 Unclassified 1829
192 Ga0157376_10116124 3300014969 Bacteria 2364
193 Ga0207697_10005553 3300025315 Bacteria 5844
194 Ga0207656_10087078 3300025321 Bacteria 1412
195 Ga0207692_10033628 3300025898 Bacteria 2475
196 Ga0207688_10017902 3300025901 Bacteria 3856
197 Ga0207699_10031896 3300025906 Unclassified 2963
198 Ga0207645_10000387 3300025907 Bacteria 36355
199 Ga0207643_10009191 3300025908 Bacteria 5307
200 Ga0207705_10001964 3300025909 Bacteria 16042
201 Ga0207705_10180715 3300025909 Bacteria 1592
202 Ga0207654_10046673 3300025911 Bacteria 2471
203 Ga0207654_10241457 3300025911 Bacteria 1207
204 Ga0207707_10000982 3300025912 Bacteria 27377
205 Ga0207707_10001698 3300025912 Bacteria 20259
206 Ga0207707_10003256 3300025912 Bacteria 14427
207 Ga0207707_10005128 3300025912 Bacteria 11484
208 Ga0207695_10010483 3300025913 Bacteria 11337
209 Ga0207695_10081723 3300025913 Bacteria 3269
210 Ga0207693_10018173 3300025915 Bacteria 5602
211 Ga0207693_10066619 3300025915 Bacteria 2819
212 Ga0207693_10095687 3300025915 Bacteria 2328
213 Ga0207663_10046329 3300025916 Bacteria 2678
214 Ga0207663_10098135 3300025916 Bacteria 1961
215 Ga0207660_10002967 3300025917 Bacteria 11095
216 Ga0207660_10011047 3300025917 Bacteria 5873
217 Ga0207660_10022798 3300025917 Bacteria 4221
218 Ga0207660_10051065 3300025917 Bacteria 2939
219 Ga0207660_10115461 3300025917 Bacteria 2026
220 Ga0207660_10223791 3300025917 Bacteria 1477
221 Ga0207662_10005462 3300025918 Bacteria 6779
222 Ga0207662_10013026 3300025918 Bacteria 4644
223 Ga0207657_10023382 3300025919 Bacteria 5755
224 Ga0207657_10068194 3300025919 Bacteria 3022
225 Ga0207657_10232971 3300025919 Bacteria 1472
226 Ga0207649_10005586 3300025920 Bacteria 6802
227 Ga0207649_10021523 3300025920 Bacteria 3714
228 Ga0207649_10040407 3300025920 Bacteria 2835
229 Ga0207649_10113773 3300025920 Bacteria 1813
230 Ga0207649_10205150 3300025920 Bacteria 1395
231 Ga0207649_10224947 3300025920 Unclassified 1339
232 Ga0207652_10005886 3300025921 Bacteria 9922
233 Ga0207652_10008870 3300025921 Bacteria 8101
234 Ga0207652_10049938 3300025921 Bacteria 3583
235 Ga0207652_10137530 3300025921 Bacteria 2183
236 Ga0207681_10000718 3300025923 Bacteria 21752
237 Ga0207681_10026299 3300025923 Bacteria 3752
238 Ga0207694_10299417 3300025924 Bacteria 1324
239 Ga0207650_10011845 3300025925 Bacteria 6008
240 Ga0207650_10026210 3300025925 Bacteria 4156
241 Ga0207650_10187203 3300025925 Bacteria 1652
242 Ga0207650_10275319 3300025925 Bacteria 1369
243 Ga0207650_10429036 3300025925 Bacteria 1098
244 Ga0207659_10047504 3300025926 Bacteria 3036
245 Ga0207659_10134650 3300025926 Bacteria 1911
246 Ga0207659_10163225 3300025926 Bacteria 1751
247 Ga0207687_10169069 3300025927 Bacteria 1685
248 Ga0207644_10081943 3300025931 Bacteria 2386
249 Ga0207690_10004418 3300025932 Bacteria 8296
250 Ga0207690_10048793 3300025932 Bacteria 2818
251 Ga0207690_10075507 3300025932 Bacteria 2337
252 Ga0207706_10000329 3300025933 Bacteria 51537
253 Ga0207686_10054038 3300025934 Bacteria 2514
254 Ga0207686_10068239 3300025934 Bacteria 2278
255 Ga0207670_10013126 3300025936 Bacteria 4874
256 Ga0207704_10065260 3300025938 Bacteria 2278
257 Ga0207665_10046817 3300025939 Bacteria 2898
258 Ga0207691_10004295 3300025940 Bacteria 13844
259 Ga0207691_10005840 3300025940 Bacteria 11907
260 Ga0207691_10008070 3300025940 Bacteria 10115
261 Ga0207711_10111618 3300025941 Bacteria 2432
262 Ga0207689_10000655 3300025942 Bacteria 33035
263 Ga0207689_10003371 3300025942 Bacteria 14629
264 Ga0207661_10000773 3300025944 Bacteria 20768
265 Ga0207661_10003324 3300025944 Bacteria 11156
266 Ga0207661_10027043 3300025944 Bacteria 4378
267 Ga0207661_10062764 3300025944 Bacteria 3007
268 Ga0207661_10086141 3300025944 Bacteria 2606
269 Ga0207661_10101249 3300025944 Bacteria 2420
270 Ga0207661_10174356 3300025944 Bacteria 1874
271 Ga0207661_10180290 3300025944 Bacteria 1844
272 Ga0207661_10191305 3300025944 Unclassified 1794
273 Ga0207679_10000510 3300025945 Bacteria 26402
274 Ga0207679_10014612 3300025945 Bacteria 5165
275 Ga0207679_10038784 3300025945 Bacteria 3397
276 Ga0207679_10175130 3300025945 Unclassified 1770
277 Ga0207679_10186500 3300025945 Unclassified 1720
278 Ga0207667_10037594 3300025949 Bacteria 5174
279 Ga0207667_10049766 3300025949 Bacteria 4424
280 Ga0207667_10173547 3300025949 Bacteria 2215
281 Ga0207651_10286367 3300025960 Bacteria 1364
282 Ga0207712_10000346 3300025961 Bacteria 41710
283 Ga0207712_10069219 3300025961 Bacteria 2532
284 Ga0207712_10083999 3300025961 Bacteria 2325
285 Ga0207677_10044831 3300026023 Bacteria 2949
286 Ga0207677_10074984 3300026023 Bacteria 2402
287 Ga0207678_10073422 3300026067 Bacteria 2931
288 Ga0207708_10015945 3300026075 Bacteria 5643
289 Ga0207702_10028484 3300026078 Bacteria 4643
290 Ga0207648_10029323 3300026089 Bacteria 4880
291 Ga0207648_10041378 3300026089 Bacteria 4046
292 Ga0207676_10062982 3300026095 Bacteria 2944
293 Ga0207676_10164720 3300026095 Bacteria 1925
294 Ga0207674_10000066 3300026116 Bacteria 107916
295 Ga0207674_10004919 3300026116 Bacteria 15974
296 Ga0207674_10036558 3300026116 Bacteria 5114
297 Ga0207674_10081092 3300026116 Bacteria 3246
298 Ga0207674_10132898 3300026116 Bacteria 2451
299 Ga0207675_100000074 3300026118 Bacteria 76792
300 Ga0209966_1000668 3300027695 Bacteria 7568
301 Ga0209998_10000516 3300027717 Bacteria 10562
302 Ga0268265_10000331 3300028380 Bacteria 51469
303 Ga0268265_10039612 3300028380 Bacteria 3474
304 Ga0268265_10315225 3300028380 Bacteria 1414
305 Ga0268264_10058423 3300028381 Bacteria 3230
306 Ga0265332_10014489 3300031238 Bacteria 3487
307 Ga0307408_100023930 3300031548 Bacteria 4165
308 Ga0307408_100034723 3300031548 Bacteria 3534
309 Ga0307408_100150456 3300031548 Bacteria 1837
310 Ga0265314_10015473 3300031711 Bacteria 6053
311 Ga0307405_10004252 3300031731 Bacteria 6737
312 Ga0307405_10081057 3300031731 Bacteria 2120
313 Ga0307413_10002748 3300031824 Bacteria 7233
314 Ga0307413_10013252 3300031824 Bacteria 4136
315 Ga0307413_10013339 3300031824 Bacteria 4127
316 Ga0307413_10095746 3300031824 Bacteria 1947
317 Ga0307410_10000703 3300031852 Bacteria 13942
318 Ga0307410_10005533 3300031852 Bacteria 6698
319 Ga0307410_10009432 3300031852 Bacteria 5473
320 Ga0307410_10024164 3300031852 Bacteria 3792
321 Ga0307410_10062836 3300031852 Bacteria 2546
322 Ga0307410_10114484 3300031852 Bacteria 1957
323 Ga0307406_10007225 3300031901 Bacteria 6153
324 Ga0307406_10009142 3300031901 Bacteria 5549
325 Ga0307406_10020356 3300031901 Bacteria 3906
326 Ga0307407_10047676 3300031903 Bacteria 2433
327 Ga0307407_10059287 3300031903 Bacteria 2229
328 Ga0307407_10064461 3300031903 Bacteria 2153
329 Ga0307407_10100567 3300031903 Bacteria 1793
330 Ga0307407_10138350 3300031903 Bacteria 1568
331 Ga0307412_10012658 3300031911 Bacteria 4923
332 Ga0307409_100000828 3300031995 Bacteria 14225
333 Ga0307409_100003026 3300031995 Bacteria 8979
334 Ga0307409_100014909 3300031995 Bacteria 5077
335 Ga0307409_100030719 3300031995 Bacteria 3865
336 Ga0307409_100044011 3300031995 Bacteria 3358
337 Ga0307409_100121196 3300031995 Bacteria 2215
338 Ga0307409_100180739 3300031995 Bacteria 1867
339 Ga0307409_100280589 3300031995 Bacteria 1539
340 Ga0307409_100328034 3300031995 Bacteria 1435
341 Ga0307416_100001671 3300032002 Bacteria 12256
342 Ga0307416_100017477 3300032002 Bacteria 5021
343 Ga0307416_100068997 3300032002 Bacteria 2923
344 Ga0307416_100150478 3300032002 Bacteria 2133
345 Ga0307414_10004152 3300032004 Bacteria 7819
346 Ga0307414_10009085 3300032004 Bacteria 5689
347 Ga0307414_10012996 3300032004 Bacteria 4943
348 Ga0307414_10047438 3300032004 Bacteria 2956
349 Ga0307411_10002231 3300032005 Bacteria 8447
350 Ga0307411_10004747 3300032005 Bacteria 6571
351 Ga0307411_10007652 3300032005 Bacteria 5526
352 Ga0307415_100005556 3300032126 Bacteria 6707
353 Ga0307415_100011154 3300032126 Bacteria 5126
354 Ga0307415_100039533 3300032126 Bacteria 3118
355 Ga0307415_100145044 3300032126 Bacteria 1818
356 Ga0373959_0003043 3300034820 Bacteria 2665
357 Ga0373934_0004281 3300035086 Bacteria 5268
358 Ga0373936_0023255 3300035113 Bacteria 2414
359 Ga0373954_0087666 3300035118 Bacteria 1492
360 Ga0373956_0014309 3300035119 Bacteria 3313
361 Ga0373957_0077046 3300035120 Bacteria 1311
362 Ga0373943_0003456 3300035170 Bacteria 7186
363 Ga0373943_0024036 3300035170 Bacteria 2839
364 Ga0373946_0005618 3300035171 Bacteria 4529
365 Ga0373946_0012020 3300035171 Bacteria 3237
366 Ga0373955_0013357 3300035172 Bacteria 3970
367 Ga0373931_0048492 3300035691 Bacteria 2252
368 Ga0373935_0066490 3300035692 Bacteria 2316
369 Ga0373935_0090376 3300035692 Bacteria 2004
370 Ga0373927_0017974 3300035695 Bacteria 4651
371 Ga0373933_0017799 3300035724 Bacteria 3988
372 Ga0373933_0023532 3300035724 Bacteria 3520
373 Ga0373947_0008712 3300035725 Bacteria 5838
374 Ga0373947_0010747 3300035725 Bacteria 5253
375 Ga0373937_0000448 3300036401 Bacteria 38003
376 Ga0373937_0026208 3300036401 Bacteria 5267
377 Ga0373937_0113741 3300036401 Bacteria 2518
378 Ga0373937_0227930 3300036401 Bacteria 1754
379 Ga0373925_0033396 3300037068 Bacteria 3791
380 Ga0373925_0125138 3300037068 Bacteria 1999
381 Ga0466959_0043802 3300045049 Bacteria 3298
382 Ga0451576_0074842 3300045051 Bacteria 3523
383 Ga0451576_0128664 3300045051 Bacteria 2639
384 Ga0451576_0151791 3300045051 Bacteria 2416
385 Ga0451576_0293484 3300045051 Bacteria 1700
386 Ga0466958_0041255 3300045836 Bacteria 2776
387 Ga0466967_0011300 3300045976 Bacteria 6752
388 Ga0466967_0088182 3300045976 Bacteria 2815
389 Ga0466967_0169694 3300045976 Bacteria 2052
390 Ga0495592_0029128 3300046454 Bacteria 4180
391 Ga0495603_0009689 3300046455 Bacteria 5827
392 Ga0495629_0027406 3300046459 Bacteria 4044
393 Ga0495629_0038804 3300046459 Bacteria 3354
394 Ga0495629_0056788 3300046459 Bacteria 2737
395 Ga0495629_0110140 3300046459 Bacteria 1919
396 Ga0495629_0256807 3300046459 Bacteria 1202
397 Ga0495651_0003975 3300046462 Bacteria 11300
398 Ga0495651_0039175 3300046462 Bacteria 3690
399 Ga0495580_0004836 3300046472 Bacteria 11273
400 Ga0495580_0008931 3300046472 Bacteria 7926
401 Ga0495580_0047008 3300046472 Bacteria 3060
402 Ga0495582_0011813 3300046473 Bacteria 4809
403 Ga0495639_0003979 3300046475 Bacteria 6341
404 Ga0495639_0127525 3300046475 Bacteria 1216
405 Ga0495664_0018033 3300046477 Bacteria 4037
406 Ga0495664_0098132 3300046477 Bacteria 1764
407 Ga0495594_0008015 3300046499 Bacteria 5432
408 Ga0495594_0012806 3300046499 Bacteria 4374
409 Ga0495594_0074238 3300046499 Bacteria 1894
410 Ga0495608_0011340 3300046511 Bacteria 6205
411 Ga0495628_0020410 3300046516 Bacteria 5465
412 Ga0495628_0068733 3300046516 Bacteria 2763
413 Ga0495630_0001688 3300046517 Bacteria 15399
414 Ga0495630_0026084 3300046517 Bacteria 4325
415 Ga0495630_0032569 3300046517 Bacteria 3885
416 Ga0495665_0025157 3300046531 Bacteria 3198
417 Ga0495665_0030328 3300046531 Bacteria 2893
418 Ga0495640_0120994 3300046533 Bacteria 1702
419 Ga0495586_0030018 3300046535 Bacteria 2910
420 Ga0495586_0120910 3300046535 Bacteria 1463
421 Ga0495587_0001091 3300046536 Bacteria 17839
422 Ga0495587_0002752 3300046536 Bacteria 11734
423 Ga0495645_0000804 3300046543 Bacteria 21498
424 Ga0495645_0001255 3300046543 Bacteria 17285
425 Ga0495622_0137804 3300046557 Bacteria 1109
426 Ga0495667_0047398 3300046559 Bacteria 2840
427 Ga0495667_0107261 3300046559 Bacteria 1805
428 Ga0495635_0138241 3300046663 Bacteria 1660
429 Ga0495588_0003083 3300046674 Bacteria 7213
430 Ga0495588_0138951 3300046674 Unclassified 1283
431 Ga0495657_0152026 3300046675 Bacteria 1437
432 Ga0495657_0207346 3300046675 Bacteria 1192
433 Ga0495599_0002269 3300046678 Bacteria 11191
434 Ga0495623_0001333 3300046679 Bacteria 16739
435 Ga0495623_0048499 3300046679 Bacteria 2693
436 Ga0495646_0076726 3300046680 Bacteria 1956
437 Ga0495658_0000951 3300046683 Bacteria 15445
438 Ga0495600_0049048 3300046809 Bacteria 2755
439 Ga0495581_0000950 3300047315 Bacteria 15568
440 Ga0495581_0042010 3300047315 Bacteria 2646
441 Ga0495674_0114528 3300047319 Bacteria 2283
442 Ga0495672_0005947 3300047320 Bacteria 9562
443 Ga0495675_0007163 3300047444 Bacteria 6866
444 Ga0495675_0036478 3300047444 Bacteria 3135
445 Ga0495675_0098213 3300047444 Bacteria 1834
446 Ga0495684_0103284 3300047471 Bacteria 2154
447 Ga0495593_0009770 3300047673 Bacteria 5565
448 Ga0495593_0074854 3300047673 Bacteria 1756
449 Ga0495614_0003822 3300048089 Bacteria 6771
450 Ga0496104_0128984 3300048907 Bacteria 2429
451 Ga0496108_0026200 3300048911 Bacteria 4809
452 Ga0496109_0224088 3300048912 Bacteria 1768
453 Ga0496112_0003755 3300048915 Bacteria 12685
454 Ga0496112_0003826 3300048915 Bacteria 12572
455 Ga0496112_0174652 3300048915 Bacteria 2114
456 Ga0496113_0081765 3300048916 Bacteria 2477
457 Ga0501033_0004681 3300049570 Bacteria 10947
458 Ga0501034_0008137 3300049571 Bacteria 11119
459 Ga0501036_0277163 3300049572 Bacteria 1403
460 Ga0501047_0014211 3300049581 Bacteria 7567
461 Ga0501070_0114196 3300049586 Bacteria 2231
462 Ga0501249_001158 3300049679 Bacteria 5550
463 Ga0501234_002722 3300049707 Unclassified 2783
464 Ga0501035_0029089 3300049822 Bacteria 5039
465 Ga0501044_0003683 3300049823 Bacteria 17228
466 Ga0501044_0092743 3300049823 Bacteria 3046
467 Ga0501044_0645434 3300049823 Bacteria 948
468 nmdc:mga05p37_117640_c1 3300050507 Bacteria 3266
469 nmdc:mga05p37_60165_c1 3300050507 Bacteria 4677
470 nmdc:mga09592_202851_c1 3300050508 Bacteria 1717
471 nmdc:mga06r32_217537_c1 3300050510 Bacteria 1898
472 nmdc:mga06r32_48612_c1 3300050510 Bacteria 4055
473 nmdc:mga0n895_120461_c1 3300050512 Bacteria 2645
474 nmdc:mga0n895_13154_c1 3300050512 Bacteria 7452
475 nmdc:mga0n895_249563_c1 3300050512 Bacteria 1801
476 nmdc:mga0n895_86996_c1 3300050512 Bacteria 3122
477 nmdc:mga0n895_92604_c1 3300050512 Bacteria 3026
478 nmdc:mga08x19_24045_c1 3300050514 Bacteria 3783
479 nmdc:mga0a205_20577_c1 3300050515 Bacteria 6228
480 nmdc:mga0a205_7731_c1 3300050515 Bacteria 9759
481 Ga0495612_0029996 3300053078 Bacteria 2191
482 Ga0495619_0074240 3300053085 Bacteria 2280
483 Ga0070695_100170803
484 Ga0070658_10097101
485 Ga0070676_10004531
486 Ga0070676_10105335
487 Ga0070683_100000914
488 Ga0070683_100027041
489 Ga0070683_100060543
490 Ga0070683_100071236
491 Ga0070683_100079680
492 Ga0070683_100084391
493 Ga0070683_100164074
494 Ga0070690_100088306
495 Ga0070690_100158530
496 Ga0070670_100008893
497 Ga0070670_100014929
498 Ga0070670_100103007
499 Ga0070670_100395802
500 Ga0068869_100002218
501 Ga0068869_100020679
502 Ga0070666_10144696
503 Ga0070680_100000010
504 Ga0070680_100002659
505 Ga0070680_100007078
506 Ga0070680_100016417
507 Ga0070680_100050422
508 Ga0070680_100077788
509 Ga0070680_100082563
510 Ga0068868_100002398
511 Ga0068868_100072494
512 Ga0070660_100089783
513 Ga0070689_100159859
514 Ga0070691_10014564
515 Ga0070687_100001965
516 Ga0070687_100021187
517 Ga0070661_100001030
518 Ga0070661_100008294
519 Ga0070661_100008603
520 Ga0070661_100038698
521 Ga0070661_100048359
522 Ga0070661_100176500
523 Ga0070661_100225480
524 Ga0070692_10016003
525 Ga0070692_10071121
526 Ga0070675_100003654
527 Ga0070675_100031034
528 Ga0070675_100044681
529 Ga0070671_100019849
530 Ga0070674_100067753
531 Ga0070673_100051016
532 Ga0070673_100052435
533 Ga0070673_100137202
534 Ga0070659_100006150
535 Ga0070709_10005733
536 Ga0070709_10052754
537 Ga0070714_100013023
538 Ga0070710_10027153
539 Ga0070701_10008088
540 Ga0070701_10165649
541 Ga0070694_100057095
542 Ga0070708_100000168
543 Ga0070663_100049575
544 Ga0070662_100004363
545 Ga0070681_10007526
546 Ga0070681_10011072
547 Ga0070681_10031391
548 Ga0070681_10121071
549 Ga0070681_10123429
550 Ga0068867_100029785
551 Ga0068867_100056744
552 Ga0068867_100161952
553 Ga0070685_10039975
554 Ga0070706_100150428
555 Ga0070679_100010525
556 Ga0070679_100016597
557 Ga0070679_100030886
558 Ga0070679_100048529
559 Ga0070679_100099954
560 Ga0070679_100117647
561 Ga0070679_100167953
562 Ga0070679_100182529
563 Ga0070684_100003904
564 Ga0070684_100016125
565 Ga0070684_100022792
566 Ga0070684_100032908
567 Ga0070684_100106879
568 Ga0070684_100339480
569 Ga0070684_100384492
570 Ga0068853_100057008
571 Ga0068853_100129743
572 Ga0070672_100203851
573 Ga0070672_100289407
574 Ga0070672_100373409
575 Ga0070696_100022547
576 Ga0070693_100002950
577 Ga0068855_100069366
578 Ga0070664_100001163
579 Ga0070664_100032756
580 Ga0070664_100044697
581 Ga0070664_100071199
582 Ga0070664_100138780
583 Ga0070664_100290259
584 Ga0068857_100009994
585 Ga0068857_100015156
586 Ga0068857_100027056
587 Ga0068857_100112463
588 Ga0068857_100415759
589 Ga0068856_100050751
590 Ga0068856_100062778
591 Ga0068856_100124169
592 Ga0068856_100561058
593 Ga0068852_100003850
594 Ga0068852_100172504
595 Ga0068859_100028004
596 Ga0068859_100043445
597 Ga0068864_100011386
598 Ga0068864_100034642
599 Ga0068861_100002906
600 Ga0068851_10142154
601 Ga0068870_10108900
602 Ga0068863_100013062
603 Ga0068858_100173809
604 Ga0068860_100302351
605 Ga0068862_100000345
606 Ga0070716_100030214
607 Ga0070716_100078849
608 Ga0070712_100027829
609 Ga0070712_100065478
610 Ga0097621_100067231
611 Ga0075428_100135699
612 Ga0075428_100137561
613 Ga0075430_100039156
614 Ga0075431_100010008
615 Ga0075431_100133159
616 Ga0075433_10018376
617 Ga0075433_10142410
618 Ga0075434_100024355
619 Ga0075434_100043530
620 Ga0068865_100023733
621 Ga0075436_100002301
622 Ga0097620_100028003
623 Ga0097620_100043442
624 Ga0075435_100219742
625 Ga0105240_10057070
626 Ga0105240_10309745
627 Ga0111539_10018859
628 Ga0105245_10244055
629 Ga0105245_10262855
630 Ga0114129_10009248
631 Ga0114129_10023207
632 Ga0114129_10141803
633 Ga0105243_10414739
634 Ga0105241_10055886
635 Ga0105242_10003307
636 Ga0105242_10115718
637 Ga0105248_10001631
638 Ga0105248_10019818
639 Ga0105248_10069952
640 Ga0105237_10110044
641 Ga0105238_10060734
642 Ga0105249_10000276
643 Ga0105249_10025588
644 Ga0105249_10202466
645 Ga0105246_10001879
646 Ga0157373_10008991
647 Ga0157371_10003912
648 Ga0157371_10017373
649 Ga0157370_10005892
650 Ga0157370_10029655
651 Ga0157370_10042235
652 Ga0157370_10063356
653 Ga0157369_10010955
654 Ga0157369_10028668
655 Ga0157369_10197536
656 Ga0157374_10001983
657 Ga0157374_10198874
658 Ga0157378_10020643
659 Ga0157378_10204904
660 Ga0163162_10025161
661 Ga0157372_10009898
662 Ga0157372_10012842
663 Ga0157372_10069755
664 Ga0157372_10247897
665 Ga0157372_10407057
666 Ga0157375_10033974
667 Ga0157375_10034069
668 Ga0157375_10052054
669 Ga0157375_10135353
670 Ga0163163_10004641
671 Ga0157380_10009657
672 Ga0157377_10002307
673 Ga0157377_10087976
674 Ga0157376_10116124
675 Ga0207697_10005553
676 Ga0207656_10087078
677 Ga0207692_10033628
678 Ga0207688_10017902
679 Ga0207699_10031896
680 Ga0207645_10000387
681 Ga0207643_10009191
682 Ga0207705_10001964
683 Ga0207705_10180715
684 Ga0207654_10046673
685 Ga0207654_10241457
686 Ga0207707_10000982
687 Ga0207707_10001698
688 Ga0207707_10003256
689 Ga0207707_10005128
690 Ga0207695_10010483
691 Ga0207695_10081723
692 Ga0207693_10018173
693 Ga0207693_10066619
694 Ga0207693_10095687
695 Ga0207663_10046329
696 Ga0207663_10098135
697 Ga0207660_10002967
698 Ga0207660_10011047
699 Ga0207660_10022798
700 Ga0207660_10051065
701 Ga0207660_10115461
702 Ga0207660_10223791
703 Ga0207662_10005462
704 Ga0207662_10013026
705 Ga0207657_10023382
706 Ga0207657_10068194
707 Ga0207657_10232971
708 Ga0207649_10005586
709 Ga0207649_10021523
710 Ga0207649_10040407
711 Ga0207649_10113773
712 Ga0207649_10205150
713 Ga0207649_10224947
714 Ga0207652_10005886
715 Ga0207652_10008870
716 Ga0207652_10049938
717 Ga0207652_10137530
718 Ga0207681_10000718
719 Ga0207681_10026299
720 Ga0207694_10299417
721 Ga0207650_10011845
722 Ga0207650_10026210
723 Ga0207650_10187203
724 Ga0207650_10275319
725 Ga0207650_10429036
726 Ga0207659_10047504
727 Ga0207659_10134650
728 Ga0207659_10163225
729 Ga0207687_10169069
730 Ga0207644_10081943
731 Ga0207690_10004418
732 Ga0207690_10048793
733 Ga0207690_10075507
734 Ga0207706_10000329
735 Ga0207686_10054038
736 Ga0207686_10068239
737 Ga0207670_10013126
738 Ga0207704_10065260
739 Ga0207665_10046817
740 Ga0207691_10004295
741 Ga0207691_10005840
742 Ga0207691_10008070
743 Ga0207711_10111618
744 Ga0207689_10000655
745 Ga0207689_10003371
746 Ga0207661_10000773
747 Ga0207661_10003324
748 Ga0207661_10027043
749 Ga0207661_10062764
750 Ga0207661_10086141
751 Ga0207661_10101249
752 Ga0207661_10174356
753 Ga0207661_10180290
754 Ga0207661_10191305
755 Ga0207679_10000510
756 Ga0207679_10014612
757 Ga0207679_10038784
758 Ga0207679_10175130
759 Ga0207679_10186500
760 Ga0207667_10037594
761 Ga0207667_10049766
762 Ga0207667_10173547
763 Ga0207651_10286367
764 Ga0207712_10000346
765 Ga0207712_10069219
766 Ga0207712_10083999
767 Ga0207677_10044831
768 Ga0207677_10074984
769 Ga0207678_10073422
770 Ga0207708_10015945
771 Ga0207702_10028484
772 Ga0207648_10029323
773 Ga0207648_10041378
774 Ga0207676_10062982
775 Ga0207676_10164720
776 Ga0207674_10000066
777 Ga0207674_10004919
778 Ga0207674_10036558
779 Ga0207674_10081092
780 Ga0207674_10132898
781 Ga0207675_100000074
782 Ga0209966_1000668
783 Ga0209998_10000516
784 Ga0268265_10000331
785 Ga0268265_10039612
786 Ga0268265_10315225
787 Ga0268264_10058423
788 Ga0265332_10014489
789 Ga0307408_100023930
790 Ga0307408_100034723
791 Ga0307408_100150456
792 Ga0265314_10015473
793 Ga0307405_10004252
794 Ga0307405_10081057
795 Ga0307413_10002748
796 Ga0307413_10013252
797 Ga0307413_10013339
798 Ga0307413_10095746
799 Ga0307410_10000703
800 Ga0307410_10005533
801 Ga0307410_10009432
802 Ga0307410_10024164
803 Ga0307410_10062836
804 Ga0307410_10114484
805 Ga0307406_10007225
806 Ga0307406_10009142
807 Ga0307406_10020356
808 Ga0307407_10047676
809 Ga0307407_10059287
810 Ga0307407_10064461
811 Ga0307407_10100567
812 Ga0307407_10138350
813 Ga0307412_10012658
814 Ga0307409_100000828
815 Ga0307409_100003026
816 Ga0307409_100014909
817 Ga0307409_100030719
818 Ga0307409_100044011
819 Ga0307409_100121196
820 Ga0307409_100180739
821 Ga0307409_100280589
822 Ga0307409_100328034
823 Ga0307416_100001671
824 Ga0307416_100017477
825 Ga0307416_100068997
826 Ga0307416_100150478
827 Ga0307414_10004152
828 Ga0307414_10009085
829 Ga0307414_10012996
830 Ga0307414_10047438
831 Ga0307411_10002231
832 Ga0307411_10004747
833 Ga0307411_10007652
834 Ga0307415_100005556
835 Ga0307415_100011154
836 Ga0307415_100039533
837 Ga0307415_100145044
838 Ga0373959_0003043
839 Ga0373934_0004281
840 Ga0373936_0023255
841 Ga0373954_0087666
842 Ga0373956_0014309
843 Ga0373957_0077046
844 Ga0373943_0003456
845 Ga0373943_0024036
846 Ga0373946_0005618
847 Ga0373946_0012020
848 Ga0373955_0013357
849 Ga0373931_0048492
850 Ga0373935_0066490
851 Ga0373935_0090376
852 Ga0373927_0017974
853 Ga0373933_0017799
854 Ga0373933_0023532
855 Ga0373947_0008712
856 Ga0373947_0010747
857 Ga0373937_0000448
858 Ga0373937_0026208
859 Ga0373937_0113741
860 Ga0373937_0227930
861 Ga0373925_0033396
862 Ga0373925_0125138
863 Ga0466959_0043802
864 Ga0451576_0074842
865 Ga0451576_0128664
866 Ga0451576_0151791
867 Ga0451576_0293484
868 Ga0466958_0041255
869 Ga0466967_0011300
870 Ga0466967_0088182
871 Ga0466967_0169694
872 Ga0495592_0029128
873 Ga0495603_0009689
874 Ga0495629_0027406
875 Ga0495629_0038804
876 Ga0495629_0056788
877 Ga0495629_0110140
878 Ga0495629_0256807
879 Ga0495651_0003975
880 Ga0495651_0039175
881 Ga0495580_0004836
882 Ga0495580_0008931
883 Ga0495580_0047008
884 Ga0495582_0011813
885 Ga0495639_0003979
886 Ga0495639_0127525
887 Ga0495664_0018033
888 Ga0495664_0098132
889 Ga0495594_0008015
890 Ga0495594_0012806
891 Ga0495594_0074238
892 Ga0495608_0011340
893 Ga0495628_0020410
894 Ga0495628_0068733
895 Ga0495630_0001688
896 Ga0495630_0026084
897 Ga0495630_0032569
898 Ga0495665_0025157
899 Ga0495665_0030328
900 Ga0495640_0120994
901 Ga0495586_0030018
902 Ga0495586_0120910
903 Ga0495587_0001091
904 Ga0495587_0002752
905 Ga0495645_0000804
906 Ga0495645_0001255
907 Ga0495622_0137804
908 Ga0495667_0047398
909 Ga0495667_0107261
910 Ga0495635_0138241
911 Ga0495588_0003083
912 Ga0495588_0138951
913 Ga0495657_0152026
914 Ga0495657_0207346
915 Ga0495599_0002269
916 Ga0495623_0001333
917 Ga0495623_0048499
918 Ga0495646_0076726
919 Ga0495658_0000951
920 Ga0495600_0049048
921 Ga0495581_0000950
922 Ga0495581_0042010
923 Ga0495674_0114528
924 Ga0495672_0005947
925 Ga0495675_0007163
926 Ga0495675_0036478
927 Ga0495675_0098213
928 Ga0495684_0103284
929 Ga0495593_0009770
930 Ga0495593_0074854
931 Ga0495614_0003822
932 Ga0496104_0128984
933 Ga0496108_0026200
934 Ga0496109_0224088
935 Ga0496112_0003755
936 Ga0496112_0003826
937 Ga0496112_0174652
938 Ga0496113_0081765
939 Ga0501033_0004681
940 Ga0501034_0008137
941 Ga0501036_0277163
942 Ga0501047_0014211
943 Ga0501070_0114196
944 Ga0501249_001158
945 Ga0501234_002722
946 Ga0501035_0029089
947 Ga0501044_0003683
948 Ga0501044_0092743
949 Ga0501044_0645434
950 nmdc:mga05p37_117640_c1
951 nmdc:mga05p37_60165_c1
952 nmdc:mga09592_202851_c1
953 nmdc:mga06r32_217537_c1
954 nmdc:mga06r32_48612_c1
955 nmdc:mga0n895_120461_c1
956 nmdc:mga0n895_13154_c1
957 nmdc:mga0n895_249563_c1
958 nmdc:mga0n895_86996_c1
959 nmdc:mga0n895_92604_c1
960 nmdc:mga08x19_24045_c1
961 nmdc:mga0a205_20577_c1
962 nmdc:mga0a205_7731_c1
963 Ga0495612_0029996
964 Ga0495619_0074240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

134

288

0.95

PF01479

S4

S4 domain

62

107

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1prz-assembly1.cif.gz_A crystal structure of pseudouridine synthase rlud catalytic module 0.855 34 260
2i82-assembly2.cif.gz_B crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure 0.8522 38 243
1v9f-assembly1.cif.gz_A crystal structure of catalytic domain of pseudouridine synthase rlud from escherichia coli 0.8464 34 260
1xpi-assembly1.cif.gz_A crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc 0.8342 39 257
7bl5-assembly1.cif.gz_7 pre-50s-obge particle 0.8276 34 264
ID Description Score Start End Superfamily
1v9fA01 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8849 39 243 3.30.2350.10
af_Q54N28_538_708_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8815 124 254 3.30.2350.10
1v9fA01 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8763 39 243 3.30.2350.10
af_I1JSZ4_206_438_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8653 79 257 3.30.2350.10
af_P9WHQ3_81_307_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8616 39 258 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A448UT97-F1-model_v4 Ribosomal large subunit pseudouridine synthase D (EC 5.4.99.23) 0.9339 107 255 GO:0000455
GO:0003723
GO:0160140
AF-A0A841TDJ7-F1-model_v4 RluA family pseudouridine synthase 0.9332 92 256 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A7X6YVV1-F1-model_v4 RluA family pseudouridine synthase 0.9265 90 255 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A357NB12-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9234 87 256 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A1Y3ID07-F1-model_v4 deleted 0.9187 89 255

Map