F452431

General Info

Members Datasets Scaffolds Average Seq Length
481 222 962 163

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10405807|Ga0268265_104058071
Length 191
Sequence MPTFDIISEVNQVEVRNALDQTNKELSTRFDFKGSDARVDHADKLLTLFADDDFKLSQVTDILTGKLAKRGVDVRSLKYGDVEKISGNKVKQAVTIRVGIEQELSKKIVKLLKDSKLKVQASIQGDAVRVSGAKRDELQNAIGLFNGQEDRYPRDLNELVAKHYIQAIPPLPTGSRYAYNPQTGDIRVVQQ

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 2.7
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10405807 3300028380 Bacteria 1261
2 rootL2_10196782 3300003322 Bacteria 1911
3 Ga0065712_10442793 3300005290 Bacteria 693
4 Ga0065707_11008136 3300005295 Bacteria 537
5 Ga0070658_10272188 3300005327 Bacteria 1440
6 Ga0070676_10004261 3300005328 Bacteria 7513
7 Ga0070676_10004432 3300005328 Bacteria 7386
8 Ga0070676_10099535 3300005328 Bacteria 1794
9 Ga0070676_10650901 3300005328 Bacteria 765
10 Ga0070690_100049950 3300005330 Bacteria 2668
11 Ga0070690_100179572 3300005330 Bacteria 1462
12 Ga0070670_100033326 3300005331 Bacteria 4436
13 Ga0070670_100083548 3300005331 Bacteria 2744
14 Ga0070670_100829225 3300005331 Bacteria 836
15 Ga0068869_100007397 3300005334 Bacteria 7014
16 Ga0068869_100029648 3300005334 Bacteria 3836
17 Ga0068869_100050411 3300005334 Bacteria 3017
18 Ga0068869_101152155 3300005334 Bacteria 680
19 Ga0070666_10214115 3300005335 Bacteria 1358
20 Ga0070680_100087904 3300005336 Bacteria 2570
21 Ga0068868_100060374 3300005338 Bacteria 3002
22 Ga0068868_100125394 3300005338 Bacteria 2097
23 Ga0068868_100362906 3300005338 Bacteria 1243
24 Ga0068868_100455672 3300005338 Bacteria 1113
25 Ga0070660_100103996 3300005339 Bacteria 2252
26 Ga0070689_100078707 3300005340 Bacteria 2585
27 Ga0070689_100207409 3300005340 Bacteria 1603
28 Ga0070691_10123437 3300005341 Bacteria 1306
29 Ga0070691_10519767 3300005341 Bacteria 691
30 Ga0070687_100019572 3300005343 Bacteria 3152
31 Ga0070661_100003945 3300005344 Bacteria 10202
32 Ga0070661_100051143 3300005344 Bacteria 3023
33 Ga0070661_100363351 3300005344 Bacteria 1138
34 Ga0070661_100817514 3300005344 Bacteria 765
35 Ga0070668_100001309 3300005347 Bacteria 17812
36 Ga0070668_100138461 3300005347 Bacteria 1960
37 Ga0070668_100560006 3300005347 Bacteria 996
38 Ga0070669_100022899 3300005353 Bacteria 4468
39 Ga0070669_100166437 3300005353 Bacteria 1716
40 Ga0070669_100773533 3300005353 Bacteria 815
41 Ga0070675_100018132 3300005354 Bacteria 5602
42 Ga0070675_100212351 3300005354 Bacteria 1682
43 Ga0070671_100031940 3300005355 Bacteria 4352
44 Ga0070671_100186920 3300005355 Bacteria 1755
45 Ga0070671_100263229 3300005355 Bacteria 1466
46 Ga0070671_100280721 3300005355 Bacteria 1416
47 Ga0070671_101002193 3300005355 Bacteria 732
48 Ga0070674_100053239 3300005356 Bacteria 2793
49 Ga0070674_100190684 3300005356 Bacteria 1577
50 Ga0070673_100087117 3300005364 Bacteria 2545
51 Ga0070673_100135267 3300005364 Bacteria 2074
52 Ga0070673_100367515 3300005364 Bacteria 1280
53 Ga0070673_100526412 3300005364 Bacteria 1072
54 Ga0070673_101093161 3300005364 Bacteria 745
55 Ga0070673_101271212 3300005364 Bacteria 691
56 Ga0070659_100004570 3300005366 Bacteria 9895
57 Ga0070659_100017095 3300005366 Bacteria 5452
58 Ga0070659_100213809 3300005366 Bacteria 1589
59 Ga0070659_100379304 3300005366 Bacteria 1191
60 Ga0070667_100020983 3300005367 Bacteria 5425
61 Ga0070667_100106308 3300005367 Bacteria 2429
62 Ga0070667_100954866 3300005367 Bacteria 799
63 Ga0070714_100047281 3300005435 Bacteria 3655
64 Ga0070701_10251813 3300005438 Bacteria 1067
65 Ga0070694_100195550 3300005444 Bacteria 1505
66 Ga0070708_100865384 3300005445 Bacteria 849
67 Ga0070663_100071288 3300005455 Bacteria 2528
68 Ga0070678_100178399 3300005456 Bacteria 1736
69 Ga0070678_100437521 3300005456 Bacteria 1143
70 Ga0070662_100118652 3300005457 Bacteria 2025
71 Ga0070681_10010730 3300005458 Bacteria 9052
72 Ga0068867_100025481 3300005459 Bacteria 4244
73 Ga0070706_100398787 3300005467 Bacteria 1281
74 Ga0070679_100015853 3300005530 Bacteria 7253
75 Ga0070684_100009132 3300005535 Bacteria 7796
76 Ga0070684_100097702 3300005535 Bacteria 2619
77 Ga0070684_100707787 3300005535 Bacteria 939
78 Ga0068853_100009051 3300005539 Bacteria 8017
79 Ga0068853_100072445 3300005539 Bacteria 3002
80 Ga0068853_100082476 3300005539 Bacteria 2816
81 Ga0068853_100185518 3300005539 Bacteria 1888
82 Ga0068853_100257258 3300005539 Bacteria 1604
83 Ga0068853_100546482 3300005539 Bacteria 1097
84 Ga0068853_100949522 3300005539 Bacteria 827
85 Ga0068853_101857883 3300005539 Bacteria 584
86 Ga0070672_100018956 3300005543 Bacteria 4985
87 Ga0070672_100139032 3300005543 Bacteria 2002
88 Ga0070672_100310742 3300005543 Bacteria 1338
89 Ga0070696_100051841 3300005546 Bacteria 2854
90 Ga0070696_100776591 3300005546 Bacteria 787
91 Ga0070693_100167489 3300005547 Bacteria 1405
92 Ga0070665_100777002 3300005548 Bacteria 971
93 Ga0070665_101316974 3300005548 Bacteria 732
94 Ga0068855_100004053 3300005563 Bacteria 17877
95 Ga0068855_100170627 3300005563 Bacteria 2464
96 Ga0068855_100471336 3300005563 Bacteria 1368
97 Ga0068855_100510047 3300005563 Bacteria 1306
98 Ga0070664_100001119 3300005564 Bacteria 21198
99 Ga0070664_100025788 3300005564 Bacteria 4872
100 Ga0070664_100083856 3300005564 Bacteria 2750
101 Ga0070664_100189208 3300005564 Bacteria 1833
102 Ga0070664_100498231 3300005564 Bacteria 1122
103 Ga0068857_100002260 3300005577 Bacteria 15661
104 Ga0068857_100083205 3300005577 Bacteria 2859
105 Ga0068857_100212749 3300005577 Bacteria 1764
106 Ga0068854_100002192 3300005578 Bacteria 12012
107 Ga0068854_100018695 3300005578 Bacteria 4656
108 Ga0068854_100100529 3300005578 Bacteria 2167
109 Ga0068854_100164300 3300005578 Bacteria 1722
110 Ga0068856_100021277 3300005614 Bacteria 6301
111 Ga0068856_100090524 3300005614 Bacteria 3043
112 Ga0068856_100188232 3300005614 Bacteria 2078
113 Ga0068856_100292189 3300005614 Bacteria 1647
114 Ga0068856_100414722 3300005614 Bacteria 1367
115 Ga0070702_100072529 3300005615 Bacteria 2038
116 Ga0070702_100448715 3300005615 Bacteria 935
117 Ga0068852_100002634 3300005616 Bacteria 12393
118 Ga0068852_100114196 3300005616 Bacteria 2460
119 Ga0068852_100228353 3300005616 Bacteria 1773
120 Ga0068852_100231272 3300005616 Bacteria 1762
121 Ga0068852_100517021 3300005616 Bacteria 1191
122 Ga0068852_100906188 3300005616 Bacteria 899
123 Ga0068859_100007927 3300005617 Bacteria 10771
124 Ga0068859_100126509 3300005617 Bacteria 2624
125 Ga0068864_100008630 3300005618 Bacteria 8408
126 Ga0068864_100028143 3300005618 Bacteria 4750
127 Ga0068864_100176398 3300005618 Bacteria 1951
128 Ga0068861_100003683 3300005719 Bacteria 10222
129 Ga0068861_100010411 3300005719 Bacteria 6454
130 Ga0068861_100471575 3300005719 Bacteria 1129
131 Ga0068851_10010195 3300005834 Bacteria 4380
132 Ga0068851_10077404 3300005834 Bacteria 1731
133 Ga0068851_10193877 3300005834 Bacteria 1131
134 Ga0068870_10011201 3300005840 Bacteria 4149
135 Ga0068870_10012975 3300005840 Bacteria 3905
136 Ga0068863_100017641 3300005841 Bacteria 6837
137 Ga0068863_100067166 3300005841 Bacteria 3392
138 Ga0068863_100144873 3300005841 Bacteria 2272
139 Ga0068863_100162607 3300005841 Bacteria 2139
140 Ga0068863_100268270 3300005841 Bacteria 1652
141 Ga0068858_100012497 3300005842 Bacteria 8008
142 Ga0068858_100022533 3300005842 Bacteria 5877
143 Ga0068858_100160935 3300005842 Bacteria 2113
144 Ga0068858_100605722 3300005842 Bacteria 1063
145 Ga0068860_100026009 3300005843 Bacteria 5645
146 Ga0068860_100030156 3300005843 Bacteria 5216
147 Ga0068860_100152008 3300005843 Bacteria 2229
148 Ga0068860_100159736 3300005843 Bacteria 2173
149 Ga0068860_100223515 3300005843 Bacteria 1828
150 Ga0068860_100248270 3300005843 Bacteria 1732
151 Ga0068860_100391980 3300005843 Bacteria 1372
152 Ga0068862_100004198 3300005844 Bacteria 12202
153 Ga0068862_100086765 3300005844 Bacteria 2721
154 Ga0068862_100159507 3300005844 Bacteria 2012
155 Ga0068862_100390508 3300005844 Bacteria 1300
156 Ga0068862_101908698 3300005844 Bacteria 604
157 Ga0081455_10572081 3300005937 Bacteria 742
158 Ga0081539_10050831 3300005985 Bacteria 2342
159 Ga0070717_10516541 3300006028 Unclassified 1080
160 Ga0070716_100352470 3300006173 Bacteria 1042
161 Ga0070712_100409351 3300006175 Bacteria 1122
162 Ga0075366_10153546 3300006195 Unclassified 1395
163 Ga0075366_10173609 3300006195 Bacteria 1308
164 Ga0097621_100004267 3300006237 Bacteria 9930
165 Ga0097621_100065757 3300006237 Bacteria 2985
166 Ga0097621_101024009 3300006237 Bacteria 773
167 Ga0068871_100047129 3300006358 Bacteria 3474
168 Ga0075428_100048298 3300006844 Bacteria 4671
169 Ga0075430_101294193 3300006846 Bacteria 600
170 Ga0075434_100677804 3300006871 Bacteria 1049
171 Ga0068865_100053782 3300006881 Bacteria 2795
172 Ga0068865_100822120 3300006881 Bacteria 803
173 Ga0068865_100975625 3300006881 Bacteria 741
174 Ga0097620_100007927 3300006931 Bacteria 10771
175 Ga0097620_100126516 3300006931 Bacteria 2624
176 Ga0075435_100393870 3300007076 Bacteria 1191
177 Ga0105251_10218973 3300009011 Bacteria 857
178 Ga0105240_10006563 3300009093 Bacteria 17085
179 Ga0105245_10904062 3300009098 Bacteria 924
180 Ga0105245_11477270 3300009098 Bacteria 730
181 Ga0105245_12632961 3300009098 Bacteria 556
182 Ga0105247_10027357 3300009101 Bacteria 3449
183 Ga0105247_10164443 3300009101 Bacteria 1471
184 Ga0114129_10062333 3300009147 Bacteria 5209
185 Ga0105243_10049710 3300009148 Bacteria 3309
186 Ga0105241_10100042 3300009174 Unclassified 2304
187 Ga0105242_10208927 3300009176 Bacteria 1738
188 Ga0105248_10067773 3300009177 Bacteria 4006
189 Ga0105248_10138753 3300009177 Bacteria 2742
190 Ga0105248_10173520 3300009177 Bacteria 2430
191 Ga0105248_10419036 3300009177 Bacteria 1508
192 Ga0105237_10584420 3300009545 Bacteria 1124
193 Ga0105237_10732921 3300009545 Unclassified 995
194 Ga0105237_10761647 3300009545 Bacteria 975
195 Ga0105237_10967127 3300009545 Bacteria 858
196 Ga0105238_10001828 3300009551 Bacteria 21327
197 Ga0105238_10031378 3300009551 Bacteria 5409
198 Ga0105238_10164320 3300009551 Bacteria 2195
199 Ga0105249_10070541 3300009553 Bacteria 3225
200 Ga0105249_10082435 3300009553 Bacteria 2992
201 Ga0105249_10097735 3300009553 Bacteria 2757
202 Ga0105239_10729679 3300010375 Bacteria 1134
203 Ga0105239_11365434 3300010375 Bacteria 818
204 Ga0105239_12233177 3300010375 Bacteria 636
205 Ga0105246_10288391 3300011119 Bacteria 1320
206 Ga0105246_10515513 3300011119 Bacteria 1018
207 Ga0157373_10139455 3300013100 Bacteria 1705
208 Ga0157373_10143919 3300013100 Bacteria 1676
209 Ga0157373_10590515 3300013100 Unclassified 808
210 Ga0157371_10076558 3300013102 Bacteria 2369
211 Ga0157371_10357622 3300013102 Bacteria 1064
212 Ga0157370_10006365 3300013104 Bacteria 13033
213 Ga0157369_10017627 3300013105 Bacteria 8027
214 Ga0157369_10052757 3300013105 Bacteria 4397
215 Ga0157369_11833019 3300013105 Bacteria 616
216 Ga0157374_10269488 3300013296 Bacteria 1678
217 Ga0157374_10534369 3300013296 Unclassified 1179
218 Ga0157374_10904213 3300013296 Bacteria 900
219 Ga0157378_10013686 3300013297 Bacteria 7095
220 Ga0157378_10029249 3300013297 Bacteria 4864
221 Ga0157378_10153451 3300013297 Bacteria 2147
222 Ga0157378_10221427 3300013297 Bacteria 1799
223 Ga0157378_11332056 3300013297 Bacteria 760
224 Ga0163162_10108712 3300013306 Bacteria 2870
225 Ga0163162_10144341 3300013306 Bacteria 2495
226 Ga0163162_10354785 3300013306 Bacteria 1599
227 Ga0163162_10490496 3300013306 Bacteria 1359
228 Ga0163162_10695089 3300013306 Bacteria 1139
229 Ga0163162_10815429 3300013306 Bacteria 1050
230 Ga0163162_11141679 3300013306 Bacteria 883
231 Ga0163162_12232931 3300013306 Bacteria 628
232 Ga0157372_10007021 3300013307 Bacteria 11994
233 Ga0157372_10122380 3300013307 Bacteria 2990
234 Ga0157372_10170138 3300013307 Bacteria 2521
235 Ga0157372_10744025 3300013307 Bacteria 1140
236 Ga0157375_10069626 3300013308 Bacteria 3525
237 Ga0157375_10141136 3300013308 Bacteria 2536
238 Ga0157375_10618275 3300013308 Bacteria 1241
239 Ga0157375_11012843 3300013308 Bacteria 970
240 Ga0163163_10084875 3300014325 Bacteria 3174
241 Ga0163163_10088282 3300014325 Bacteria 3112
242 Ga0157380_10079538 3300014326 Bacteria 2677
243 Ga0157377_10015382 3300014745 Bacteria 3914
244 Ga0157379_10000544 3300014968 Bacteria 30401
245 Ga0157379_10071722 3300014968 Bacteria 3098
246 Ga0157379_10080145 3300014968 Bacteria 2925
247 Ga0157379_10461435 3300014968 Bacteria 1174
248 Ga0157376_10070123 3300014969 Bacteria 2974
249 Ga0157376_10080878 3300014969 Bacteria 2788
250 Ga0163161_10025561 3300017792 Bacteria 4180
251 Ga0163161_10364947 3300017792 Bacteria 1151
252 Ga0213876_10372247 3300021384 Bacteria 760
253 Ga0207697_10107236 3300025315 Bacteria 1194
254 Ga0207697_10128730 3300025315 Bacteria 1093
255 Ga0207656_10016330 3300025321 Bacteria 2889
256 Ga0207710_10036609 3300025900 Bacteria 2164
257 Ga0207710_10141589 3300025900 Bacteria 1161
258 Ga0207688_10061913 3300025901 Bacteria 2110
259 Ga0207688_10237161 3300025901 Bacteria 1102
260 Ga0207688_10302004 3300025901 Bacteria 979
261 Ga0207680_10045510 3300025903 Bacteria 2588
262 Ga0207680_10094618 3300025903 Bacteria 1908
263 Ga0207680_10419420 3300025903 Bacteria 948
264 Ga0207645_10008274 3300025907 Bacteria 7271
265 Ga0207645_10015105 3300025907 Bacteria 5143
266 Ga0207645_10071549 3300025907 Bacteria 2220
267 Ga0207643_10005856 3300025908 Bacteria 6567
268 Ga0207643_10049535 3300025908 Bacteria 2381
269 Ga0207705_10072401 3300025909 Bacteria 2500
270 Ga0207705_10177535 3300025909 Bacteria 1606
271 Ga0207684_10207092 3300025910 Bacteria 1692
272 Ga0207654_10087089 3300025911 Bacteria 1894
273 Ga0207707_10024797 3300025912 Bacteria 5247
274 Ga0207707_10399307 3300025912 Bacteria 1180
275 Ga0207695_10022114 3300025913 Bacteria 7232
276 Ga0207695_10373109 3300025913 Bacteria 1313
277 Ga0207671_10102798 3300025914 Bacteria 2166
278 Ga0207671_10292834 3300025914 Unclassified 1285
279 Ga0207660_10211785 3300025917 Unclassified 1518
280 Ga0207662_10025260 3300025918 Bacteria 3421
281 Ga0207662_10060137 3300025918 Bacteria 2278
282 Ga0207662_10165781 3300025918 Bacteria 1414
283 Ga0207657_10095040 3300025919 Bacteria 2480
284 Ga0207657_10172927 3300025919 Bacteria 1749
285 Ga0207657_10646234 3300025919 Bacteria 824
286 Ga0207649_10003570 3300025920 Bacteria 8500
287 Ga0207649_10010388 3300025920 Bacteria 5114
288 Ga0207649_10437097 3300025920 Bacteria 985
289 Ga0207652_10004547 3300025921 Bacteria 11262
290 Ga0207681_10005073 3300025923 Bacteria 8092
291 Ga0207681_10094524 3300025923 Bacteria 2142
292 Ga0207681_10233021 3300025923 Bacteria 1430
293 Ga0207681_10750550 3300025923 Bacteria 813
294 Ga0207694_10001560 3300025924 Bacteria 19448
295 Ga0207694_10028817 3300025924 Bacteria 4234
296 Ga0207694_10376933 3300025924 Bacteria 1177
297 Ga0207650_10006236 3300025925 Bacteria 8126
298 Ga0207650_10124890 3300025925 Bacteria 2008
299 Ga0207659_10267737 3300025926 Bacteria 1393
300 Ga0207659_10950284 3300025926 Bacteria 739
301 Ga0207700_10157042 3300025928 Unclassified 1886
302 Ga0207664_10039366 3300025929 Bacteria 3671
303 Ga0207644_10010457 3300025931 Bacteria 6116
304 Ga0207644_10131870 3300025931 Bacteria 1914
305 Ga0207644_10151468 3300025931 Bacteria 1795
306 Ga0207690_10009473 3300025932 Bacteria 5784
307 Ga0207690_10156939 3300025932 Bacteria 1692
308 Ga0207706_10129630 3300025933 Bacteria 2218
309 Ga0207709_10040959 3300025935 Bacteria 2777
310 Ga0207670_10063342 3300025936 Bacteria 2530
311 Ga0207670_10299326 3300025936 Bacteria 1259
312 Ga0207669_10115722 3300025937 Bacteria 1808
313 Ga0207704_10429357 3300025938 Bacteria 1050
314 Ga0207704_10766800 3300025938 Bacteria 803
315 Ga0207691_10004778 3300025940 Bacteria 13103
316 Ga0207691_10015881 3300025940 Bacteria 7156
317 Ga0207691_10095533 3300025940 Bacteria 2658
318 Ga0207691_10296940 3300025940 Bacteria 1389
319 Ga0207691_10385334 3300025940 Bacteria 1196
320 Ga0207711_10022276 3300025941 Bacteria 5297
321 Ga0207689_10001557 3300025942 Bacteria 21753
322 Ga0207689_10019254 3300025942 Bacteria 5754
323 Ga0207689_10082117 3300025942 Bacteria 2650
324 Ga0207661_10015990 3300025944 Bacteria 5530
325 Ga0207661_10550878 3300025944 Bacteria 1056
326 Ga0207679_10006603 3300025945 Bacteria 7336
327 Ga0207679_10020557 3300025945 Bacteria 4456
328 Ga0207679_10023585 3300025945 Bacteria 4209
329 Ga0207679_10130922 3300025945 Bacteria 2012
330 Ga0207679_10248752 3300025945 Bacteria 1510
331 Ga0207667_10008594 3300025949 Bacteria 12119
332 Ga0207667_10164126 3300025949 Bacteria 2284
333 Ga0207667_10253309 3300025949 Bacteria 1801
334 Ga0207667_10433648 3300025949 Bacteria 1336
335 Ga0207651_10053547 3300025960 Bacteria 2759
336 Ga0207651_10315071 3300025960 Bacteria 1306
337 Ga0207712_10098356 3300025961 Bacteria 2170
338 Ga0207712_10170117 3300025961 Bacteria 1702
339 Ga0207668_10003447 3300025972 Bacteria 9281
340 Ga0207668_10028203 3300025972 Bacteria 3668
341 Ga0207668_10029870 3300025972 Bacteria 3577
342 Ga0207668_11005447 3300025972 Bacteria 745
343 Ga0207640_10066532 3300025981 Bacteria 2408
344 Ga0207640_10066942 3300025981 Bacteria 2401
345 Ga0207640_10094360 3300025981 Bacteria 2081
346 Ga0207640_10751392 3300025981 Bacteria 841
347 Ga0207640_10999116 3300025981 Bacteria 736
348 Ga0207658_10029708 3300025986 Bacteria 3863
349 Ga0207658_10139798 3300025986 Bacteria 1958
350 Ga0207658_10284983 3300025986 Bacteria 1418
351 Ga0207658_10511570 3300025986 Bacteria 1071
352 Ga0207677_10041418 3300026023 Bacteria 3045
353 Ga0207677_10178006 3300026023 Bacteria 1670
354 Ga0207677_10264155 3300026023 Bacteria 1404
355 Ga0207703_10015345 3300026035 Bacteria 5975
356 Ga0207703_10031265 3300026035 Bacteria 4208
357 Ga0207703_10089568 3300026035 Bacteria 2584
358 Ga0207639_10007140 3300026041 Bacteria 7609
359 Ga0207639_10137357 3300026041 Bacteria 2032
360 Ga0207639_10202555 3300026041 Bacteria 1703
361 Ga0207639_10369294 3300026041 Bacteria 1286
362 Ga0207639_10680541 3300026041 Bacteria 953
363 Ga0207639_11042144 3300026041 Bacteria 766
364 Ga0207639_11286564 3300026041 Bacteria 686
365 Ga0207678_10025953 3300026067 Bacteria 5112
366 Ga0207678_10640848 3300026067 Bacteria 933
367 Ga0207708_10038021 3300026075 Bacteria 3666
368 Ga0207708_10247903 3300026075 Bacteria 1434
369 Ga0207702_10009734 3300026078 Bacteria 8071
370 Ga0207702_10016806 3300026078 Bacteria 6056
371 Ga0207702_10289792 3300026078 Bacteria 1550
372 Ga0207702_10434091 3300026078 Bacteria 1272
373 Ga0207702_11395264 3300026078 Bacteria 694
374 Ga0207641_10013277 3300026088 Bacteria 6757
375 Ga0207641_10056509 3300026088 Bacteria 3336
376 Ga0207641_10088229 3300026088 Bacteria 2708
377 Ga0207641_10132271 3300026088 Bacteria 2241
378 Ga0207641_10330151 3300026088 Bacteria 1448
379 Ga0207648_10039360 3300026089 Bacteria 4158
380 Ga0207648_10040184 3300026089 Bacteria 4111
381 Ga0207648_10162185 3300026089 Bacteria 1974
382 Ga0207676_10011072 3300026095 Bacteria 6436
383 Ga0207674_10001449 3300026116 Bacteria 30652
384 Ga0207674_10006782 3300026116 Bacteria 13435
385 Ga0207675_100001856 3300026118 Bacteria 21157
386 Ga0207675_100005585 3300026118 Bacteria 12036
387 Ga0207675_100724317 3300026118 Bacteria 1005
388 Ga0207683_10032890 3300026121 Bacteria 4506
389 Ga0207683_10235994 3300026121 Bacteria 1668
390 Ga0207698_10037447 3300026142 Bacteria 3573
391 Ga0207698_10094593 3300026142 Bacteria 2457
392 Ga0207698_10503468 3300026142 Bacteria 1179
393 Ga0207698_11162600 3300026142 Bacteria 785
394 Ga0209981_1025052 3300027378 Bacteria 862
395 Ga0268265_10052622 3300028380 Bacteria 3080
396 Ga0268265_10053123 3300028380 Bacteria 3068
397 Ga0268265_10314899 3300028380 Bacteria 1414
398 Ga0268264_10001578 3300028381 Bacteria 21120
399 Ga0268264_10009097 3300028381 Bacteria 8236
400 Ga0268264_10070074 3300028381 Bacteria 2967
401 Ga0268264_10109452 3300028381 Bacteria 2417
402 Ga0268264_10271374 3300028381 Bacteria 1585
403 Ga0268264_10714202 3300028381 Bacteria 996
404 Ga0265319_1113164 3300028563 Bacteria 848
405 Ga0265338_10824550 3300028800 Bacteria 635
406 Ga0265330_10007892 3300031235 Bacteria 5157
407 Ga0265332_10000401 3300031238 Bacteria 31298
408 Ga0265328_10001731 3300031239 Bacteria 10000
409 Ga0265325_10013083 3300031241 Bacteria 4729
410 Ga0265339_10057785 3300031249 Bacteria 2097
411 Ga0265331_10000262 3300031250 Bacteria 60603
412 Ga0265327_10003154 3300031251 Bacteria 16176
413 Ga0265327_10005687 3300031251 Bacteria 10308
414 Ga0265327_10010517 3300031251 Bacteria 6495
415 Ga0265316_10018188 3300031344 Bacteria 6048
416 Ga0265314_10064963 3300031711 Bacteria 2468
417 Ga0265342_10021097 3300031712 Bacteria 4167
418 Ga0307409_100019068 3300031995 Bacteria 4634
419 Ga0307411_10538427 3300032005 Bacteria 994
420 Ga0373934_0361159 3300035086 Bacteria 605
421 Ga0373949_0023246 3300035090 Bacteria 1434
422 Ga0373952_0019564 3300035092 Bacteria 1411
423 Ga0373943_0067312 3300035170 Bacteria 1806
424 Ga0373946_0075791 3300035171 Bacteria 1463
425 Ga0373955_0100981 3300035172 Bacteria 1656
426 Ga0373942_0072220 3300035207 Bacteria 1010
427 Ga0373931_0027213 3300035691 Bacteria 2917
428 Ga0373937_0095521 3300036401 Bacteria 2756
429 Ga0373937_0478826 3300036401 Bacteria 1182
430 Ga0373925_0122625 3300037068 Bacteria 2019
431 Ga0395905_0463139 3300037471 Unclassified 1166
432 Ga0436365_0637764 3300039437 Bacteria 568
433 Ga0436363_0323057 3300039450 Bacteria 3679
434 Ga0451853_2477886 3300041512 Bacteria 917
435 Ga0450918_112691 3300042531 Bacteria 539
436 Ga0453684_0939746 3300044712 Bacteria 923
437 Ga0451576_0061264 3300045051 Bacteria 3924
438 Ga0451576_0234616 3300045051 Bacteria 1916
439 Ga0451576_1453372 3300045051 Bacteria 713
440 Ga0495629_0058485 3300046459 Bacteria 2695
441 Ga0495580_0035128 3300046472 Bacteria 3605
442 Ga0495580_0064874 3300046472 Bacteria 2559
443 Ga0495580_0475102 3300046472 Bacteria 837
444 Ga0495621_0113834 3300046539 Bacteria 1040
445 Ga0495634_0256602 3300046642 Bacteria 1068
446 Ga0495635_0171017 3300046663 Bacteria 1478
447 Ga0495646_0211194 3300046680 Bacteria 1053
448 Ga0495658_0028409 3300046683 Bacteria 3019
449 Ga0495658_0390173 3300046683 Bacteria 887
450 Ga0495600_0101370 3300046809 Bacteria 1877
451 Ga0495674_0165840 3300047319 Bacteria 1846
452 Ga0495680_0876865 3300047322 Bacteria 581
453 Ga0495684_0072889 3300047471 Bacteria 2609
454 Ga0496101_0011766 3300048904 Bacteria 5818
455 Ga0496102_0049294 3300048905 Bacteria 3831
456 Ga0496103_0257538 3300048906 Bacteria 1123
457 Ga0496104_0080922 3300048907 Bacteria 3097
458 Ga0496106_0126749 3300048909 Bacteria 1999
459 Ga0496107_0120162 3300048910 Bacteria 1935
460 Ga0496108_0195175 3300048911 Bacteria 1755
461 Ga0496109_0238462 3300048912 Bacteria 1711
462 Ga0496109_0383209 3300048912 Bacteria 1328
463 Ga0496110_0572639 3300048913 Bacteria 1025
464 Ga0496110_1164196 3300048913 Bacteria 680
465 Ga0496112_0000218 3300048915 Bacteria 37059
466 Ga0496115_0360564 3300048918 Bacteria 1184
467 nmdc:mga0k408_16149_c1 3300050493 Bacteria 4138
468 nmdc:mga0k408_456345_c1 3300050493 Bacteria 759
469 nmdc:mga05p37_235458_c1 3300050507 Bacteria 2204
470 nmdc:mga0n895_167272_c1 3300050512 Bacteria 2230
471 nmdc:mga0n895_185474_c1 3300050512 Bacteria 2111
472 nmdc:mga0rr50_218085_c1 3300050513 Bacteria 1574
473 nmdc:mga0rr50_645262_c1 3300050513 Bacteria 903
474 nmdc:mga0rr50_684814_c1 3300050513 Bacteria 875
475 nmdc:mga08x19_297724_c1 3300050514 Bacteria 1120
476 nmdc:mga0a205_415772_c1 3300050515 Bacteria 1207
477 Ga0495601_0100231 3300053077 Bacteria 1870
478 Ga0495601_0349171 3300053077 Bacteria 962
479 Ga0495619_0572987 3300053085 Bacteria 773
480 Ga0500622_0000001 3300053156 Bacteria 657715
481 2574431918 2574179768 Bacteria 4907129
482 Ga0268265_10405807
483 rootL2_10196782
484 Ga0065712_10442793
485 Ga0065707_11008136
486 Ga0070658_10272188
487 Ga0070676_10004261
488 Ga0070676_10004432
489 Ga0070676_10099535
490 Ga0070676_10650901
491 Ga0070690_100049950
492 Ga0070690_100179572
493 Ga0070670_100033326
494 Ga0070670_100083548
495 Ga0070670_100829225
496 Ga0068869_100007397
497 Ga0068869_100029648
498 Ga0068869_100050411
499 Ga0068869_101152155
500 Ga0070666_10214115
501 Ga0070680_100087904
502 Ga0068868_100060374
503 Ga0068868_100125394
504 Ga0068868_100362906
505 Ga0068868_100455672
506 Ga0070660_100103996
507 Ga0070689_100078707
508 Ga0070689_100207409
509 Ga0070691_10123437
510 Ga0070691_10519767
511 Ga0070687_100019572
512 Ga0070661_100003945
513 Ga0070661_100051143
514 Ga0070661_100363351
515 Ga0070661_100817514
516 Ga0070668_100001309
517 Ga0070668_100138461
518 Ga0070668_100560006
519 Ga0070669_100022899
520 Ga0070669_100166437
521 Ga0070669_100773533
522 Ga0070675_100018132
523 Ga0070675_100212351
524 Ga0070671_100031940
525 Ga0070671_100186920
526 Ga0070671_100263229
527 Ga0070671_100280721
528 Ga0070671_101002193
529 Ga0070674_100053239
530 Ga0070674_100190684
531 Ga0070673_100087117
532 Ga0070673_100135267
533 Ga0070673_100367515
534 Ga0070673_100526412
535 Ga0070673_101093161
536 Ga0070673_101271212
537 Ga0070659_100004570
538 Ga0070659_100017095
539 Ga0070659_100213809
540 Ga0070659_100379304
541 Ga0070667_100020983
542 Ga0070667_100106308
543 Ga0070667_100954866
544 Ga0070714_100047281
545 Ga0070701_10251813
546 Ga0070694_100195550
547 Ga0070708_100865384
548 Ga0070663_100071288
549 Ga0070678_100178399
550 Ga0070678_100437521
551 Ga0070662_100118652
552 Ga0070681_10010730
553 Ga0068867_100025481
554 Ga0070706_100398787
555 Ga0070679_100015853
556 Ga0070684_100009132
557 Ga0070684_100097702
558 Ga0070684_100707787
559 Ga0068853_100009051
560 Ga0068853_100072445
561 Ga0068853_100082476
562 Ga0068853_100185518
563 Ga0068853_100257258
564 Ga0068853_100546482
565 Ga0068853_100949522
566 Ga0068853_101857883
567 Ga0070672_100018956
568 Ga0070672_100139032
569 Ga0070672_100310742
570 Ga0070696_100051841
571 Ga0070696_100776591
572 Ga0070693_100167489
573 Ga0070665_100777002
574 Ga0070665_101316974
575 Ga0068855_100004053
576 Ga0068855_100170627
577 Ga0068855_100471336
578 Ga0068855_100510047
579 Ga0070664_100001119
580 Ga0070664_100025788
581 Ga0070664_100083856
582 Ga0070664_100189208
583 Ga0070664_100498231
584 Ga0068857_100002260
585 Ga0068857_100083205
586 Ga0068857_100212749
587 Ga0068854_100002192
588 Ga0068854_100018695
589 Ga0068854_100100529
590 Ga0068854_100164300
591 Ga0068856_100021277
592 Ga0068856_100090524
593 Ga0068856_100188232
594 Ga0068856_100292189
595 Ga0068856_100414722
596 Ga0070702_100072529
597 Ga0070702_100448715
598 Ga0068852_100002634
599 Ga0068852_100114196
600 Ga0068852_100228353
601 Ga0068852_100231272
602 Ga0068852_100517021
603 Ga0068852_100906188
604 Ga0068859_100007927
605 Ga0068859_100126509
606 Ga0068864_100008630
607 Ga0068864_100028143
608 Ga0068864_100176398
609 Ga0068861_100003683
610 Ga0068861_100010411
611 Ga0068861_100471575
612 Ga0068851_10010195
613 Ga0068851_10077404
614 Ga0068851_10193877
615 Ga0068870_10011201
616 Ga0068870_10012975
617 Ga0068863_100017641
618 Ga0068863_100067166
619 Ga0068863_100144873
620 Ga0068863_100162607
621 Ga0068863_100268270
622 Ga0068858_100012497
623 Ga0068858_100022533
624 Ga0068858_100160935
625 Ga0068858_100605722
626 Ga0068860_100026009
627 Ga0068860_100030156
628 Ga0068860_100152008
629 Ga0068860_100159736
630 Ga0068860_100223515
631 Ga0068860_100248270
632 Ga0068860_100391980
633 Ga0068862_100004198
634 Ga0068862_100086765
635 Ga0068862_100159507
636 Ga0068862_100390508
637 Ga0068862_101908698
638 Ga0081455_10572081
639 Ga0081539_10050831
640 Ga0070717_10516541
641 Ga0070716_100352470
642 Ga0070712_100409351
643 Ga0075366_10153546
644 Ga0075366_10173609
645 Ga0097621_100004267
646 Ga0097621_100065757
647 Ga0097621_101024009
648 Ga0068871_100047129
649 Ga0075428_100048298
650 Ga0075430_101294193
651 Ga0075434_100677804
652 Ga0068865_100053782
653 Ga0068865_100822120
654 Ga0068865_100975625
655 Ga0097620_100007927
656 Ga0097620_100126516
657 Ga0075435_100393870
658 Ga0105251_10218973
659 Ga0105240_10006563
660 Ga0105245_10904062
661 Ga0105245_11477270
662 Ga0105245_12632961
663 Ga0105247_10027357
664 Ga0105247_10164443
665 Ga0114129_10062333
666 Ga0105243_10049710
667 Ga0105241_10100042
668 Ga0105242_10208927
669 Ga0105248_10067773
670 Ga0105248_10138753
671 Ga0105248_10173520
672 Ga0105248_10419036
673 Ga0105237_10584420
674 Ga0105237_10732921
675 Ga0105237_10761647
676 Ga0105237_10967127
677 Ga0105238_10001828
678 Ga0105238_10031378
679 Ga0105238_10164320
680 Ga0105249_10070541
681 Ga0105249_10082435
682 Ga0105249_10097735
683 Ga0105239_10729679
684 Ga0105239_11365434
685 Ga0105239_12233177
686 Ga0105246_10288391
687 Ga0105246_10515513
688 Ga0157373_10139455
689 Ga0157373_10143919
690 Ga0157373_10590515
691 Ga0157371_10076558
692 Ga0157371_10357622
693 Ga0157370_10006365
694 Ga0157369_10017627
695 Ga0157369_10052757
696 Ga0157369_11833019
697 Ga0157374_10269488
698 Ga0157374_10534369
699 Ga0157374_10904213
700 Ga0157378_10013686
701 Ga0157378_10029249
702 Ga0157378_10153451
703 Ga0157378_10221427
704 Ga0157378_11332056
705 Ga0163162_10108712
706 Ga0163162_10144341
707 Ga0163162_10354785
708 Ga0163162_10490496
709 Ga0163162_10695089
710 Ga0163162_10815429
711 Ga0163162_11141679
712 Ga0163162_12232931
713 Ga0157372_10007021
714 Ga0157372_10122380
715 Ga0157372_10170138
716 Ga0157372_10744025
717 Ga0157375_10069626
718 Ga0157375_10141136
719 Ga0157375_10618275
720 Ga0157375_11012843
721 Ga0163163_10084875
722 Ga0163163_10088282
723 Ga0157380_10079538
724 Ga0157377_10015382
725 Ga0157379_10000544
726 Ga0157379_10071722
727 Ga0157379_10080145
728 Ga0157379_10461435
729 Ga0157376_10070123
730 Ga0157376_10080878
731 Ga0163161_10025561
732 Ga0163161_10364947
733 Ga0213876_10372247
734 Ga0207697_10107236
735 Ga0207697_10128730
736 Ga0207656_10016330
737 Ga0207710_10036609
738 Ga0207710_10141589
739 Ga0207688_10061913
740 Ga0207688_10237161
741 Ga0207688_10302004
742 Ga0207680_10045510
743 Ga0207680_10094618
744 Ga0207680_10419420
745 Ga0207645_10008274
746 Ga0207645_10015105
747 Ga0207645_10071549
748 Ga0207643_10005856
749 Ga0207643_10049535
750 Ga0207705_10072401
751 Ga0207705_10177535
752 Ga0207684_10207092
753 Ga0207654_10087089
754 Ga0207707_10024797
755 Ga0207707_10399307
756 Ga0207695_10022114
757 Ga0207695_10373109
758 Ga0207671_10102798
759 Ga0207671_10292834
760 Ga0207660_10211785
761 Ga0207662_10025260
762 Ga0207662_10060137
763 Ga0207662_10165781
764 Ga0207657_10095040
765 Ga0207657_10172927
766 Ga0207657_10646234
767 Ga0207649_10003570
768 Ga0207649_10010388
769 Ga0207649_10437097
770 Ga0207652_10004547
771 Ga0207681_10005073
772 Ga0207681_10094524
773 Ga0207681_10233021
774 Ga0207681_10750550
775 Ga0207694_10001560
776 Ga0207694_10028817
777 Ga0207694_10376933
778 Ga0207650_10006236
779 Ga0207650_10124890
780 Ga0207659_10267737
781 Ga0207659_10950284
782 Ga0207700_10157042
783 Ga0207664_10039366
784 Ga0207644_10010457
785 Ga0207644_10131870
786 Ga0207644_10151468
787 Ga0207690_10009473
788 Ga0207690_10156939
789 Ga0207706_10129630
790 Ga0207709_10040959
791 Ga0207670_10063342
792 Ga0207670_10299326
793 Ga0207669_10115722
794 Ga0207704_10429357
795 Ga0207704_10766800
796 Ga0207691_10004778
797 Ga0207691_10015881
798 Ga0207691_10095533
799 Ga0207691_10296940
800 Ga0207691_10385334
801 Ga0207711_10022276
802 Ga0207689_10001557
803 Ga0207689_10019254
804 Ga0207689_10082117
805 Ga0207661_10015990
806 Ga0207661_10550878
807 Ga0207679_10006603
808 Ga0207679_10020557
809 Ga0207679_10023585
810 Ga0207679_10130922
811 Ga0207679_10248752
812 Ga0207667_10008594
813 Ga0207667_10164126
814 Ga0207667_10253309
815 Ga0207667_10433648
816 Ga0207651_10053547
817 Ga0207651_10315071
818 Ga0207712_10098356
819 Ga0207712_10170117
820 Ga0207668_10003447
821 Ga0207668_10028203
822 Ga0207668_10029870
823 Ga0207668_11005447
824 Ga0207640_10066532
825 Ga0207640_10066942
826 Ga0207640_10094360
827 Ga0207640_10751392
828 Ga0207640_10999116
829 Ga0207658_10029708
830 Ga0207658_10139798
831 Ga0207658_10284983
832 Ga0207658_10511570
833 Ga0207677_10041418
834 Ga0207677_10178006
835 Ga0207677_10264155
836 Ga0207703_10015345
837 Ga0207703_10031265
838 Ga0207703_10089568
839 Ga0207639_10007140
840 Ga0207639_10137357
841 Ga0207639_10202555
842 Ga0207639_10369294
843 Ga0207639_10680541
844 Ga0207639_11042144
845 Ga0207639_11286564
846 Ga0207678_10025953
847 Ga0207678_10640848
848 Ga0207708_10038021
849 Ga0207708_10247903
850 Ga0207702_10009734
851 Ga0207702_10016806
852 Ga0207702_10289792
853 Ga0207702_10434091
854 Ga0207702_11395264
855 Ga0207641_10013277
856 Ga0207641_10056509
857 Ga0207641_10088229
858 Ga0207641_10132271
859 Ga0207641_10330151
860 Ga0207648_10039360
861 Ga0207648_10040184
862 Ga0207648_10162185
863 Ga0207676_10011072
864 Ga0207674_10001449
865 Ga0207674_10006782
866 Ga0207675_100001856
867 Ga0207675_100005585
868 Ga0207675_100724317
869 Ga0207683_10032890
870 Ga0207683_10235994
871 Ga0207698_10037447
872 Ga0207698_10094593
873 Ga0207698_10503468
874 Ga0207698_11162600
875 Ga0209981_1025052
876 Ga0268265_10052622
877 Ga0268265_10053123
878 Ga0268265_10314899
879 Ga0268264_10001578
880 Ga0268264_10009097
881 Ga0268264_10070074
882 Ga0268264_10109452
883 Ga0268264_10271374
884 Ga0268264_10714202
885 Ga0265319_1113164
886 Ga0265338_10824550
887 Ga0265330_10007892
888 Ga0265332_10000401
889 Ga0265328_10001731
890 Ga0265325_10013083
891 Ga0265339_10057785
892 Ga0265331_10000262
893 Ga0265327_10003154
894 Ga0265327_10005687
895 Ga0265327_10010517
896 Ga0265316_10018188
897 Ga0265314_10064963
898 Ga0265342_10021097
899 Ga0307409_100019068
900 Ga0307411_10538427
901 Ga0373934_0361159
902 Ga0373949_0023246
903 Ga0373952_0019564
904 Ga0373943_0067312
905 Ga0373946_0075791
906 Ga0373955_0100981
907 Ga0373942_0072220
908 Ga0373931_0027213
909 Ga0373937_0095521
910 Ga0373937_0478826
911 Ga0373925_0122625
912 Ga0395905_0463139
913 Ga0436365_0637764
914 Ga0436363_0323057
915 Ga0451853_2477886
916 Ga0450918_112691
917 Ga0453684_0939746
918 Ga0451576_0061264
919 Ga0451576_0234616
920 Ga0451576_1453372
921 Ga0495629_0058485
922 Ga0495580_0035128
923 Ga0495580_0064874
924 Ga0495580_0475102
925 Ga0495621_0113834
926 Ga0495634_0256602
927 Ga0495635_0171017
928 Ga0495646_0211194
929 Ga0495658_0028409
930 Ga0495658_0390173
931 Ga0495600_0101370
932 Ga0495674_0165840
933 Ga0495680_0876865
934 Ga0495684_0072889
935 Ga0496101_0011766
936 Ga0496102_0049294
937 Ga0496103_0257538
938 Ga0496104_0080922
939 Ga0496106_0126749
940 Ga0496107_0120162
941 Ga0496108_0195175
942 Ga0496109_0238462
943 Ga0496109_0383209
944 Ga0496110_0572639
945 Ga0496110_1164196
946 Ga0496112_0000218
947 Ga0496115_0360564
948 nmdc:mga0k408_16149_c1
949 nmdc:mga0k408_456345_c1
950 nmdc:mga05p37_235458_c1
951 nmdc:mga0n895_167272_c1
952 nmdc:mga0n895_185474_c1
953 nmdc:mga0rr50_218085_c1
954 nmdc:mga0rr50_645262_c1
955 nmdc:mga0rr50_684814_c1
956 nmdc:mga08x19_297724_c1
957 nmdc:mga0a205_415772_c1
958 Ga0495601_0100231
959 Ga0495601_0349171
960 Ga0495619_0572987
961 Ga0500622_0000001
962 2574431918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

2

157

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8636 1 167
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8588 1 167
6wrx-assembly1.cif.gz_D crystal structure of computationally designed protein 2ds25.1 in complex with the human transferrin receptor ectodomain 0.832 110 154
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.7529 3 167
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.7453 3 167
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9456 105 167 3.30.70.860
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9108 9 103 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8924 9 103 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8786 9 99 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8597 9 99 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A520FJA4-F1-model_v4 DUF520 family protein 0.9878 105 167 GO:0000166
GO:0005829
AF-A0A259DGR8-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9826 105 167 GO:0000166
GO:0005829
AF-A0A0F2IX68-F1-model_v4 deleted 0.9798 107 167
AF-A0A0F2IX68-F1-model_v4 deleted 0.9643 107 167
AF-A0A6N6XAK8-F1-model_v4 deleted 0.9589 105 167

Map