F452312

General Info

Members Datasets Scaffolds Average Seq Length
480 221 960 123

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0192044|Ga0500637_0192044_356_763
Length 135
Sequence VNASVRKIRLLVAAALSLVLTAGVAVAHHSTAMFDMQHTVTVTGTVTQFDWTNPHTFIFMEVLNPSTGTSESWSIEGMSPNYLSRSGWTRHTIKPGDKIGMEVHLLKDGRKGGFCAIITLPDGKRLRNLPGPPLY

Samples

Sample ID Description Type Environment
1 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 3.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 1.25
Rhizosphere 98.33
Stem 0
Stem Tuber 0
Unclassified 28.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500637_0192044 3300053178 Bacteria 1166
2 Ga0058861_10058785 3300004800 Unclassified 713
3 Ga0058862_11967786 3300004803 Unclassified 1040
4 Ga0058862_11967849 3300004803 Unclassified 914
5 Ga0065707_10521604 3300005295 Unclassified 741
6 Ga0070658_11005982 3300005327 Bacteria 725
7 Ga0070683_100001747 3300005329 Bacteria 16931
8 Ga0070683_100009996 3300005329 Bacteria 8136
9 Ga0070683_100078358 3300005329 Bacteria 3091
10 Ga0070683_100121633 3300005329 Bacteria 2466
11 Ga0070683_100476658 3300005329 Bacteria 1191
12 Ga0070683_101081850 3300005329 Bacteria 770
13 Ga0070690_100577759 3300005330 Bacteria 850
14 Ga0070690_100951269 3300005330 Bacteria 674
15 Ga0070690_101236373 3300005330 Unclassified 597
16 Ga0070670_100304313 3300005331 Unclassified 1395
17 Ga0070677_10396381 3300005333 Unclassified 726
18 Ga0068869_100453940 3300005334 Bacteria 1063
19 Ga0068869_100566607 3300005334 Unclassified 956
20 Ga0070666_10335448 3300005335 Bacteria 1080
21 Ga0070680_100018542 3300005336 Bacteria 5500
22 Ga0068868_100467183 3300005338 Bacteria 1100
23 Ga0068868_100513692 3300005338 Bacteria 1051
24 Ga0068868_101150066 3300005338 Unclassified 716
25 Ga0068868_101456947 3300005338 Unclassified 640
26 Ga0070660_100050352 3300005339 Bacteria 3205
27 Ga0070660_101711159 3300005339 Unclassified 536
28 Ga0070689_100065420 3300005340 Unclassified 2831
29 Ga0070689_100273058 3300005340 Bacteria 1400
30 Ga0070689_101040061 3300005340 Unclassified 730
31 Ga0070691_10012873 3300005341 Bacteria 3833
32 Ga0070687_100170110 3300005343 Bacteria 1296
33 Ga0070661_100161372 3300005344 Bacteria 1698
34 Ga0070661_100316036 3300005344 Bacteria 1219
35 Ga0070661_101353026 3300005344 Unclassified 598
36 Ga0070692_10025044 3300005345 Bacteria 2939
37 Ga0070668_100730025 3300005347 Unclassified 875
38 Ga0070675_100114185 3300005354 Bacteria 2288
39 Ga0070675_100190758 3300005354 Bacteria 1775
40 Ga0070675_100620729 3300005354 Bacteria 981
41 Ga0070675_101381288 3300005354 Unclassified 649
42 Ga0070671_100345762 3300005355 Bacteria 1269
43 Ga0070674_100440475 3300005356 Bacteria 1073
44 Ga0070674_100922057 3300005356 Bacteria 762
45 Ga0070673_100753535 3300005364 Bacteria 897
46 Ga0070673_101329184 3300005364 Unclassified 675
47 Ga0070659_100069998 3300005366 Bacteria 2786
48 Ga0070709_10861211 3300005434 Bacteria 714
49 Ga0070714_100095483 3300005435 Bacteria 2611
50 Ga0070713_100055125 3300005436 Bacteria 3302
51 Ga0070713_100668876 3300005436 Bacteria 990
52 Ga0070710_10316003 3300005437 Bacteria 1024
53 Ga0070711_100073929 3300005439 Bacteria 2410
54 Ga0070711_100182538 3300005439 Bacteria 1607
55 Ga0070678_100269115 3300005456 Unclassified 1436
56 Ga0070662_100042994 3300005457 Bacteria 3230
57 Ga0070662_101980520 3300005457 Bacteria 503
58 Ga0070681_10004773 3300005458 Bacteria 12989
59 Ga0070681_10260958 3300005458 Unclassified 1644
60 Ga0070681_11766440 3300005458 Unclassified 545
61 Ga0068867_100147525 3300005459 Unclassified 1845
62 Ga0068867_100178084 3300005459 Bacteria 1689
63 Ga0068867_100255429 3300005459 Unclassified 1427
64 Ga0068867_101566150 3300005459 Unclassified 615
65 Ga0070707_100008126 3300005468 Bacteria 9732
66 Ga0070679_100002792 3300005530 Bacteria 15870
67 Ga0070679_100376208 3300005530 Bacteria 1367
68 Ga0070684_100000613 3300005535 Bacteria 24605
69 Ga0070684_100012249 3300005535 Bacteria 6866
70 Ga0070684_100021656 3300005535 Bacteria 5354
71 Ga0070684_100263417 3300005535 Bacteria 1577
72 Ga0070684_100377820 3300005535 Bacteria 1305
73 Ga0070684_100388186 3300005535 Bacteria 1286
74 Ga0070697_101021509 3300005536 Bacteria 735
75 Ga0068853_100224413 3300005539 Bacteria 1717
76 Ga0068853_101641122 3300005539 Unclassified 623
77 Ga0070672_100374468 3300005543 Bacteria 1217
78 Ga0070672_100557003 3300005543 Bacteria 996
79 Ga0070672_100565638 3300005543 Unclassified 988
80 Ga0070672_101084199 3300005543 Unclassified 711
81 Ga0070686_100643629 3300005544 Bacteria 840
82 Ga0070686_100940751 3300005544 Unclassified 705
83 Ga0070695_100068640 3300005545 Bacteria 2315
84 Ga0070696_101396827 3300005546 Unclassified 597
85 Ga0070693_100554930 3300005547 Bacteria 823
86 Ga0070693_100967210 3300005547 Unclassified 642
87 Ga0070665_100581001 3300005548 Bacteria 1133
88 Ga0070704_100209517 3300005549 Unclassified 1578
89 Ga0068855_100002398 3300005563 Bacteria 23127
90 Ga0068855_100042894 3300005563 Bacteria 5360
91 Ga0070664_100101688 3300005564 Unclassified 2500
92 Ga0070664_100905437 3300005564 Unclassified 827
93 Ga0068857_100002614 3300005577 Bacteria 14785
94 Ga0068857_100045047 3300005577 Bacteria 3913
95 Ga0068857_100818946 3300005577 Unclassified 890
96 Ga0068857_100910110 3300005577 Bacteria 844
97 Ga0068854_101524095 3300005578 Bacteria 607
98 Ga0068854_101883885 3300005578 Unclassified 549
99 Ga0068856_100002896 3300005614 Bacteria 17567
100 Ga0068856_100190497 3300005614 Bacteria 2064
101 Ga0068856_100224043 3300005614 Bacteria 1896
102 Ga0068856_100936370 3300005614 Bacteria 885
103 Ga0068852_100016230 3300005616 Bacteria 5801
104 Ga0068852_101503261 3300005616 Bacteria 696
105 Ga0068852_101760571 3300005616 Unclassified 642
106 Ga0068859_100029966 3300005617 Bacteria 5459
107 Ga0068859_100114422 3300005617 Bacteria 2762
108 Ga0068864_100381363 3300005618 Unclassified 1336
109 Ga0068864_101229963 3300005618 Bacteria 748
110 Ga0068866_10029142 3300005718 Bacteria 2637
111 Ga0068866_10838534 3300005718 Unclassified 642
112 Ga0068861_100384991 3300005719 Unclassified 1240
113 Ga0068861_101638620 3300005719 Unclassified 635
114 Ga0068861_101725216 3300005719 Unclassified 620
115 Ga0068863_100333765 3300005841 Bacteria 1474
116 Ga0068858_100050546 3300005842 Bacteria 3847
117 Ga0068858_100130854 3300005842 Bacteria 2353
118 Ga0068858_100169416 3300005842 Unclassified 2059
119 Ga0068858_101020434 3300005842 Unclassified 811
120 Ga0068858_101328612 3300005842 Bacteria 708
121 Ga0068860_100288053 3300005843 Bacteria 1606
122 Ga0068860_100753437 3300005843 Bacteria 985
123 Ga0068860_101516245 3300005843 Unclassified 692
124 Ga0068860_102296336 3300005843 Bacteria 560
125 Ga0068862_100664559 3300005844 Unclassified 1006
126 Ga0068862_100878639 3300005844 Unclassified 880
127 Ga0068862_102536640 3300005844 Unclassified 524
128 Ga0081455_10439444 3300005937 Bacteria 894
129 Ga0070716_101098905 3300006173 Unclassified 634
130 Ga0097621_100041387 3300006237 Bacteria 3709
131 Ga0097621_100062979 3300006237 Unclassified 3047
132 Ga0097621_100135104 3300006237 Bacteria 2103
133 Ga0097621_100345369 3300006237 Bacteria 1322
134 Ga0097621_100727926 3300006237 Unclassified 915
135 Ga0068871_100221691 3300006358 Unclassified 1639
136 Ga0068871_100279343 3300006358 Bacteria 1460
137 Ga0068871_101097692 3300006358 Unclassified 744
138 Ga0075428_100373216 3300006844 Bacteria 1529
139 Ga0075428_100458151 3300006844 Bacteria 1366
140 Ga0075431_100228874 3300006847 Unclassified 1895
141 Ga0075431_100488432 3300006847 Bacteria 1223
142 Ga0075433_10015772 3300006852 Bacteria 6209
143 Ga0075433_10414067 3300006852 Unclassified 1189
144 Ga0075434_100083412 3300006871 Bacteria 3194
145 Ga0075434_100098659 3300006871 Bacteria 2927
146 Ga0075434_100213459 3300006871 Unclassified 1950
147 Ga0075434_100331464 3300006871 Bacteria 1542
148 Ga0075434_100741699 3300006871 Bacteria 999
149 Ga0075434_102517709 3300006871 Unclassified 516
150 Ga0075429_100134964 3300006880 Bacteria 2160
151 Ga0075429_100592209 3300006880 Bacteria 972
152 Ga0075429_101259010 3300006880 Unclassified 645
153 Ga0068865_100099271 3300006881 Unclassified 2128
154 Ga0068865_100191571 3300006881 Bacteria 1582
155 Ga0075436_100198364 3300006914 Bacteria 1421
156 Ga0075436_101135741 3300006914 Unclassified 589
157 Ga0097620_100029966 3300006931 Bacteria 5459
158 Ga0097620_100114431 3300006931 Bacteria 2762
159 Ga0075435_100257434 3300007076 Bacteria 1486
160 Ga0075435_100374377 3300007076 Bacteria 1223
161 Ga0105250_10272905 3300009092 Unclassified 726
162 Ga0105240_10004307 3300009093 Bacteria 21738
163 Ga0105240_10063077 3300009093 Bacteria 4611
164 Ga0111539_10006791 3300009094 Bacteria 14724
165 Ga0111539_10711037 3300009094 Bacteria 1169
166 Ga0111539_12862702 3300009094 Unclassified 559
167 Ga0105245_10003760 3300009098 Bacteria 13511
168 Ga0105245_10010621 3300009098 Bacteria 8011
169 Ga0105245_10052575 3300009098 Bacteria 3653
170 Ga0105245_10080736 3300009098 Unclassified 2971
171 Ga0105245_10161403 3300009098 Unclassified 2127
172 Ga0105245_10240387 3300009098 Bacteria 1755
173 Ga0105245_10796120 3300009098 Unclassified 983
174 Ga0105245_11254882 3300009098 Bacteria 789
175 Ga0105247_10012173 3300009101 Bacteria 5172
176 Ga0105247_10020363 3300009101 Bacteria 3988
177 Ga0105247_10182091 3300009101 Bacteria 1403
178 Ga0105247_10334454 3300009101 Bacteria 1060
179 Ga0114129_10001513 3300009147 Bacteria 31448
180 Ga0114129_10169974 3300009147 Bacteria 2973
181 Ga0114129_10182277 3300009147 Bacteria 2856
182 Ga0114129_10380437 3300009147 Bacteria 1864
183 Ga0114129_10463227 3300009147 Bacteria 1661
184 Ga0105243_10043542 3300009148 Bacteria 3518
185 Ga0105243_10478910 3300009148 Bacteria 1174
186 Ga0105243_11340273 3300009148 Bacteria 734
187 Ga0105243_11434908 3300009148 Unclassified 712
188 Ga0105241_10001909 3300009174 Bacteria 15778
189 Ga0105241_10013147 3300009174 Bacteria 6071
190 Ga0105241_10278764 3300009174 Bacteria 1427
191 Ga0105241_10767345 3300009174 Bacteria 885
192 Ga0105242_10043054 3300009176 Unclassified 3650
193 Ga0105242_10718837 3300009176 Bacteria 979
194 Ga0105242_11740345 3300009176 Bacteria 660
195 Ga0105242_12632578 3300009176 Unclassified 552
196 Ga0105242_13041210 3300009176 Bacteria 519
197 Ga0105248_10009279 3300009177 Bacteria 10832
198 Ga0105248_10050314 3300009177 Bacteria 4673
199 Ga0105248_10330461 3300009177 Bacteria 1717
200 Ga0105248_10645196 3300009177 Unclassified 1194
201 Ga0105248_10682745 3300009177 Unclassified 1159
202 Ga0105248_10954827 3300009177 Bacteria 968
203 Ga0105237_10008995 3300009545 Bacteria 10742
204 Ga0105237_10030796 3300009545 Bacteria 5446
205 Ga0105237_10204385 3300009545 Bacteria 1975
206 Ga0105237_10934547 3300009545 Bacteria 874
207 Ga0105237_11003638 3300009545 Bacteria 841
208 Ga0105237_11398472 3300009545 Bacteria 706
209 Ga0105238_10008155 3300009551 Bacteria 10480
210 Ga0105238_10017183 3300009551 Bacteria 7348
211 Ga0105238_10048517 3300009551 Bacteria 4279
212 Ga0105238_10051735 3300009551 Bacteria 4130
213 Ga0105238_10098580 3300009551 Bacteria 2906
214 Ga0105249_10019330 3300009553 Bacteria 6076
215 Ga0105249_10029592 3300009553 Unclassified 4948
216 Ga0105249_10164582 3300009553 Bacteria 2146
217 Ga0105249_10365380 3300009553 Bacteria 1465
218 Ga0105249_10668097 3300009553 Unclassified 1097
219 Ga0105249_12665450 3300009553 Unclassified 572
220 Ga0105239_10003289 3300010375 Bacteria 19927
221 Ga0105239_10004635 3300010375 Bacteria 16340
222 Ga0105239_10793742 3300010375 Bacteria 1085
223 Ga0105239_10944733 3300010375 Bacteria 990
224 Ga0105246_10035618 3300011119 Bacteria 3328
225 Ga0105246_10164949 3300011119 Bacteria 1691
226 Ga0105246_10378863 3300011119 Unclassified 1168
227 Ga0105246_11608281 3300011119 Unclassified 614
228 Ga0157371_10076021 3300013102 Bacteria 2378
229 Ga0157370_10004062 3300013104 Bacteria 16964
230 Ga0157370_10010437 3300013104 Bacteria 9790
231 Ga0157369_10006556 3300013105 Bacteria 13475
232 Ga0157369_10011059 3300013105 Bacteria 10267
233 Ga0157369_10197836 3300013105 Unclassified 2110
234 Ga0157369_11750975 3300013105 Bacteria 631
235 Ga0157369_12402320 3300013105 Unclassified 534
236 Ga0157374_10198581 3300013296 Bacteria 1963
237 Ga0157374_10235948 3300013296 Bacteria 1798
238 Ga0157374_10859262 3300013296 Bacteria 924
239 Ga0157374_11650443 3300013296 Bacteria 665
240 Ga0157378_10016114 3300013297 Bacteria 6545
241 Ga0157378_10107221 3300013297 Bacteria 2556
242 Ga0157372_10004450 3300013307 Bacteria 14945
243 Ga0157372_10153933 3300013307 Bacteria 2655
244 Ga0157372_10183300 3300013307 Bacteria 2424
245 Ga0157372_10422504 3300013307 Bacteria 1553
246 Ga0157372_10959336 3300013307 Bacteria 991
247 Ga0157375_11008614 3300013308 Bacteria 972
248 Ga0157375_11251959 3300013308 Unclassified 871
249 Ga0157375_12159034 3300013308 Bacteria 663
250 Ga0163163_10076151 3300014325 Bacteria 3350
251 Ga0163163_10901861 3300014325 Bacteria 947
252 Ga0163163_11707997 3300014325 Bacteria 690
253 Ga0163163_11952505 3300014325 Bacteria 647
254 Ga0157380_10539403 3300014326 Bacteria 1142
255 Ga0157377_10148621 3300014745 Bacteria 1447
256 Ga0157377_10394208 3300014745 Unclassified 941
257 Ga0157379_10129348 3300014968 Bacteria 2272
258 Ga0157379_10353831 3300014968 Bacteria 1345
259 Ga0157376_10048347 3300014969 Bacteria 3517
260 Ga0157376_10083281 3300014969 Bacteria 2751
261 Ga0157376_10220967 3300014969 Bacteria 1754
262 Ga0157376_10342384 3300014969 Bacteria 1428
263 Ga0157376_11762926 3300014969 Unclassified 655
264 Ga0206356_10190112 3300020070 Bacteria 872
265 Ga0206355_1299833 3300020076 Unclassified 787
266 Ga0206351_10495129 3300020077 Unclassified 517
267 Ga0206352_10023914 3300020078 Unclassified 578
268 Ga0206352_10257743 3300020078 Unclassified 552
269 Ga0206352_10400890 3300020078 Unclassified 540
270 Ga0206352_10695832 3300020078 Unclassified 1389
271 Ga0224712_10577567 3300022467 Unclassified 548
272 Ga0224712_10650848 3300022467 Unclassified 516
273 Ga0207692_11030974 3300025898 Unclassified 544
274 Ga0207710_10070550 3300025900 Bacteria 1601
275 Ga0207710_10125677 3300025900 Bacteria 1228
276 Ga0207688_10943901 3300025901 Unclassified 546
277 Ga0207680_11227864 3300025903 Unclassified 534
278 Ga0207680_11304394 3300025903 Bacteria 516
279 Ga0207685_10039617 3300025905 Unclassified 1750
280 Ga0207699_10228609 3300025906 Bacteria 1273
281 Ga0207645_10275021 3300025907 Bacteria 1117
282 Ga0207654_10002731 3300025911 Bacteria 8960
283 Ga0207654_10005087 3300025911 Bacteria 6632
284 Ga0207654_10143130 3300025911 Bacteria 1527
285 Ga0207654_11028341 3300025911 Bacteria 599
286 Ga0207707_10000890 3300025912 Bacteria 29183
287 Ga0207707_11166415 3300025912 Unclassified 625
288 Ga0207695_10000504 3300025913 Bacteria 83019
289 Ga0207695_10011467 3300025913 Bacteria 10731
290 Ga0207695_10463619 3300025913 Bacteria 1150
291 Ga0207695_11217212 3300025913 Bacteria 633
292 Ga0207671_10014853 3300025914 Bacteria 6129
293 Ga0207671_10052786 3300025914 Bacteria 3012
294 Ga0207671_10797264 3300025914 Bacteria 749
295 Ga0207671_11089488 3300025914 Bacteria 628
296 Ga0207663_10170410 3300025916 Bacteria 1546
297 Ga0207663_10337231 3300025916 Bacteria 1138
298 Ga0207663_10725668 3300025916 Bacteria 788
299 Ga0207660_10019893 3300025917 Bacteria 4496
300 Ga0207662_10206938 3300025918 Bacteria 1272
301 Ga0207657_10031064 3300025919 Bacteria 4842
302 Ga0207657_11215190 3300025919 Unclassified 572
303 Ga0207649_10059157 3300025920 Bacteria 2403
304 Ga0207649_10584178 3300025920 Unclassified 858
305 Ga0207652_10024635 3300025921 Bacteria 4993
306 Ga0207652_10072063 3300025921 Bacteria 3003
307 Ga0207646_10010427 3300025922 Bacteria 9084
308 Ga0207681_10087351 3300025923 Bacteria 2219
309 Ga0207694_10003653 3300025924 Bacteria 12182
310 Ga0207694_10018374 3300025924 Bacteria 5285
311 Ga0207694_10105158 3300025924 Bacteria 2240
312 Ga0207694_10112834 3300025924 Unclassified 2163
313 Ga0207694_10479866 3300025924 Bacteria 1040
314 Ga0207659_10089075 3300025926 Bacteria 2300
315 Ga0207659_10615196 3300025926 Bacteria 927
316 Ga0207687_10000549 3300025927 Bacteria 25211
317 Ga0207687_10013746 3300025927 Bacteria 5286
318 Ga0207687_10247087 3300025927 Bacteria 1417
319 Ga0207687_10442280 3300025927 Bacteria 1077
320 Ga0207700_10174627 3300025928 Bacteria 1795
321 Ga0207700_10320667 3300025928 Bacteria 1343
322 Ga0207700_10553877 3300025928 Bacteria 1021
323 Ga0207664_10063797 3300025929 Bacteria 2945
324 Ga0207690_10062412 3300025932 Bacteria 2536
325 Ga0207706_10136052 3300025933 Bacteria 2162
326 Ga0207686_11751677 3300025934 Bacteria 514
327 Ga0207670_10558720 3300025936 Unclassified 936
328 Ga0207670_10669825 3300025936 Bacteria 857
329 Ga0207704_10004068 3300025938 Bacteria 6665
330 Ga0207704_10298690 3300025938 Bacteria 1233
331 Ga0207691_10476938 3300025940 Bacteria 1060
332 Ga0207691_11038538 3300025940 Unclassified 683
333 Ga0207711_10000454 3300025941 Bacteria 42713
334 Ga0207711_10245290 3300025941 Unclassified 1643
335 Ga0207689_11308883 3300025942 Unclassified 609
336 Ga0207661_10002830 3300025944 Bacteria 11984
337 Ga0207661_10016407 3300025944 Bacteria 5464
338 Ga0207661_10029404 3300025944 Bacteria 4220
339 Ga0207661_10509228 3300025944 Bacteria 1100
340 Ga0207661_10767873 3300025944 Unclassified 887
341 Ga0207667_10000179 3300025949 Bacteria 92219
342 Ga0207667_10018000 3300025949 Bacteria 7935
343 Ga0207667_10056401 3300025949 Bacteria 4127
344 Ga0207651_11491547 3300025960 Unclassified 609
345 Ga0207712_10019429 3300025961 Bacteria 4437
346 Ga0207712_10068984 3300025961 Unclassified 2535
347 Ga0207712_10430577 3300025961 Unclassified 1115
348 Ga0207712_11371004 3300025961 Bacteria 632
349 Ga0207640_10873462 3300025981 Bacteria 784
350 Ga0207677_10988258 3300026023 Unclassified 763
351 Ga0207703_10009531 3300026035 Bacteria 7620
352 Ga0207703_10010375 3300026035 Bacteria 7289
353 Ga0207703_10044271 3300026035 Bacteria 3577
354 Ga0207703_11808488 3300026035 Unclassified 587
355 Ga0207639_10165362 3300026041 Bacteria 1868
356 Ga0207639_10546421 3300026041 Bacteria 1063
357 Ga0207702_10002077 3300026078 Bacteria 19363
358 Ga0207702_10049705 3300026078 Bacteria 3539
359 Ga0207702_10337030 3300026078 Bacteria 1440
360 Ga0207702_10766014 3300026078 Bacteria 953
361 Ga0207648_10089008 3300026089 Unclassified 2696
362 Ga0207648_10164515 3300026089 Bacteria 1960
363 Ga0207648_11720704 3300026089 Unclassified 589
364 Ga0207648_11885174 3300026089 Unclassified 559
365 Ga0207676_10426465 3300026095 Bacteria 1245
366 Ga0207674_10002628 3300026116 Bacteria 22485
367 Ga0207674_10004547 3300026116 Bacteria 16663
368 Ga0207674_10581746 3300026116 Bacteria 1082
369 Ga0207675_100004480 3300026118 Bacteria 13500
370 Ga0207675_100366693 3300026118 Bacteria 1414
371 Ga0207683_10249415 3300026121 Bacteria 1620
372 Ga0207698_10048774 3300026142 Bacteria 3217
373 Ga0207698_10452910 3300026142 Unclassified 1239
374 Ga0209982_1075980 3300027552 Unclassified 552
375 Ga0207428_10068533 3300027907 Unclassified 2790
376 Ga0207428_10084295 3300027907 Bacteria 2477
377 Ga0268265_10453647 3300028380 Bacteria 1198
378 Ga0268265_11549040 3300028380 Unclassified 667
379 Ga0268264_10334649 3300028381 Unclassified 1436
380 Ga0268264_11232956 3300028381 Bacteria 758
381 Ga0265313_10048762 3300031595 Bacteria 2041
382 Ga0265314_10000658 3300031711 Bacteria 42283
383 Ga0373928_0141405 3300035084 Bacteria 660
384 Ga0373934_0002610 3300035086 Bacteria 6637
385 Ga0373934_0044285 3300035086 Bacteria 1759
386 Ga0373934_0475038 3300035086 Unclassified 525
387 Ga0373952_0025251 3300035092 Bacteria 1282
388 Ga0373939_0080377 3300035114 Bacteria 1081
389 Ga0373953_0008362 3300035117 Bacteria 3512
390 Ga0373954_0022048 3300035118 Bacteria 2887
391 Ga0373956_0031640 3300035119 Bacteria 2320
392 Ga0373955_0016762 3300035172 Bacteria 3611
393 Ga0373955_0095433 3300035172 Bacteria 1701
394 Ga0373955_0350940 3300035172 Bacteria 893
395 Ga0373931_0545972 3300035691 Unclassified 752
396 Ga0373935_0204133 3300035692 Bacteria 1367
397 Ga0373935_0594603 3300035692 Bacteria 809
398 Ga0373933_0004463 3300035724 Bacteria 7674
399 Ga0373933_0039189 3300035724 Bacteria 2787
400 Ga0373933_0103848 3300035724 Bacteria 1766
401 Ga0373937_0019719 3300036401 Bacteria 6039
402 Ga0373937_0110261 3300036401 Unclassified 2559
403 Ga0373937_0162331 3300036401 Bacteria 2095
404 Ga0373925_0217900 3300037068 Bacteria 1523
405 Ga0436362_0014410 3300039453 Unclassified 619
406 Ga0439431_0144176 3300041997 Bacteria 674
407 Ga0451577_0639447 3300042876 Bacteria 965
408 Ga0495592_0272740 3300046454 Bacteria 1109
409 Ga0495651_0120515 3300046462 Bacteria 1928
410 Ga0495651_0269089 3300046462 Unclassified 1156
411 Ga0495580_0042603 3300046472 Bacteria 3233
412 Ga0495582_0003549 3300046473 Bacteria 8792
413 Ga0495639_0343824 3300046475 Bacteria 748
414 Ga0495664_0319122 3300046477 Bacteria 937
415 Ga0495594_0024353 3300046499 Bacteria 3251
416 Ga0495608_0071540 3300046511 Bacteria 2263
417 Ga0495630_0236692 3300046517 Unclassified 1395
418 Ga0495666_0259652 3300046526 Bacteria 790
419 Ga0495652_0852101 3300046529 Bacteria 604
420 Ga0495586_0035602 3300046535 Bacteria 2675
421 Ga0495586_0122544 3300046535 Unclassified 1453
422 Ga0495586_0631218 3300046535 Bacteria 619
423 Ga0495587_0208119 3300046536 Bacteria 1105
424 Ga0495645_0122149 3300046543 Bacteria 1833
425 Ga0495667_0177200 3300046559 Bacteria 1369
426 Ga0495667_0610826 3300046559 Bacteria 679
427 Ga0495634_0153348 3300046642 Bacteria 1456
428 Ga0495635_0224825 3300046663 Bacteria 1269
429 Ga0495599_0016853 3300046678 Bacteria 4538
430 Ga0495599_0261700 3300046678 Bacteria 1051
431 Ga0495623_0052826 3300046679 Bacteria 2567
432 Ga0495623_0285521 3300046679 Unclassified 916
433 Ga0495658_0011495 3300046683 Bacteria 4454
434 Ga0495658_0264969 3300046683 Unclassified 1082
435 Ga0495669_0251183 3300046684 Bacteria 849
436 Ga0495600_0852169 3300046809 Unclassified 540
437 Ga0495636_0162713 3300047318 Bacteria 1006
438 Ga0495674_0757589 3300047319 Bacteria 758
439 Ga0495680_0206450 3300047322 Bacteria 1408
440 Ga0495680_0869110 3300047322 Bacteria 585
441 Ga0495684_0058209 3300047471 Bacteria 2944
442 Ga0495684_0591051 3300047471 Bacteria 750
443 Ga0495602_0000399 3300048088 Bacteria 40598
444 Ga0495602_0155818 3300048088 Bacteria 1789
445 Ga0496102_0307806 3300048905 Bacteria 1493
446 Ga0496104_0645805 3300048907 Bacteria 967
447 Ga0496104_0813008 3300048907 Bacteria 841
448 Ga0496108_0666583 3300048911 Bacteria 904
449 Ga0496112_0731613 3300048915 Unclassified 916
450 Ga0496115_0981995 3300048918 Unclassified 646
451 nmdc:mga05p37_1145352_c1 3300050507 Unclassified 810
452 nmdc:mga05p37_17482_c1 3300050507 Bacteria 8655
453 nmdc:mga05p37_215318_c1 3300050507 Bacteria 2320
454 nmdc:mga05p37_3907_c1 3300050507 Bacteria 17443
455 nmdc:mga09592_1450410_c1 3300050508 Unclassified 560
456 nmdc:mga09592_87651_c1 3300050508 Bacteria 2657
457 nmdc:mga0qj67_493083_c1 3300050509 Unclassified 985
458 nmdc:mga06r32_311367_c1 3300050510 Bacteria 1560
459 nmdc:mga06r32_748535_c1 3300050510 Unclassified 940
460 nmdc:mga08y16_19796_c1 3300050511 Bacteria 2793
461 nmdc:mga08y16_50620_c1 3300050511 Bacteria 4347
462 nmdc:mga0n895_2000226_c1 3300050512 Unclassified 537
463 nmdc:mga0n895_278021_c1 3300050512 Bacteria 1698
464 nmdc:mga0n895_434449_c1 3300050512 Unclassified 1326
465 nmdc:mga0n895_7026_c1 3300050512 Bacteria 9616
466 nmdc:mga0n895_73943_c1 3300050512 Bacteria 3384
467 nmdc:mga0rr50_332202_c1 3300050513 Bacteria 1276
468 nmdc:mga0rr50_666888_c1 3300050513 Unclassified 887
469 nmdc:mga0rr50_715183_c1 3300050513 Unclassified 855
470 nmdc:mga08x19_1050455_c1 3300050514 Unclassified 578
471 nmdc:mga08x19_205613_c1 3300050514 Bacteria 1350
472 nmdc:mga08x19_537822_c1 3300050514 Unclassified 826
473 nmdc:mga0a205_326737_c1 3300050515 Bacteria 1404
474 nmdc:mga0a205_34516_c1 3300050515 Bacteria 4852
475 Ga0495601_0296764 3300053077 Bacteria 1053
476 Ga0495595_0332855 3300053084 Bacteria 765
477 Ga0500559_0479451 3300053136 Unclassified 573
478 Ga0587092_079496 3300059512 Unclassified 645
479 Ga0587109_156814 3300059624 Unclassified 567
480 Ga0587117_085491 3300059627 Unclassified 581
481 Ga0500637_0192044
482 Ga0058861_10058785
483 Ga0058862_11967786
484 Ga0058862_11967849
485 Ga0065707_10521604
486 Ga0070658_11005982
487 Ga0070683_100001747
488 Ga0070683_100009996
489 Ga0070683_100078358
490 Ga0070683_100121633
491 Ga0070683_100476658
492 Ga0070683_101081850
493 Ga0070690_100577759
494 Ga0070690_100951269
495 Ga0070690_101236373
496 Ga0070670_100304313
497 Ga0070677_10396381
498 Ga0068869_100453940
499 Ga0068869_100566607
500 Ga0070666_10335448
501 Ga0070680_100018542
502 Ga0068868_100467183
503 Ga0068868_100513692
504 Ga0068868_101150066
505 Ga0068868_101456947
506 Ga0070660_100050352
507 Ga0070660_101711159
508 Ga0070689_100065420
509 Ga0070689_100273058
510 Ga0070689_101040061
511 Ga0070691_10012873
512 Ga0070687_100170110
513 Ga0070661_100161372
514 Ga0070661_100316036
515 Ga0070661_101353026
516 Ga0070692_10025044
517 Ga0070668_100730025
518 Ga0070675_100114185
519 Ga0070675_100190758
520 Ga0070675_100620729
521 Ga0070675_101381288
522 Ga0070671_100345762
523 Ga0070674_100440475
524 Ga0070674_100922057
525 Ga0070673_100753535
526 Ga0070673_101329184
527 Ga0070659_100069998
528 Ga0070709_10861211
529 Ga0070714_100095483
530 Ga0070713_100055125
531 Ga0070713_100668876
532 Ga0070710_10316003
533 Ga0070711_100073929
534 Ga0070711_100182538
535 Ga0070678_100269115
536 Ga0070662_100042994
537 Ga0070662_101980520
538 Ga0070681_10004773
539 Ga0070681_10260958
540 Ga0070681_11766440
541 Ga0068867_100147525
542 Ga0068867_100178084
543 Ga0068867_100255429
544 Ga0068867_101566150
545 Ga0070707_100008126
546 Ga0070679_100002792
547 Ga0070679_100376208
548 Ga0070684_100000613
549 Ga0070684_100012249
550 Ga0070684_100021656
551 Ga0070684_100263417
552 Ga0070684_100377820
553 Ga0070684_100388186
554 Ga0070697_101021509
555 Ga0068853_100224413
556 Ga0068853_101641122
557 Ga0070672_100374468
558 Ga0070672_100557003
559 Ga0070672_100565638
560 Ga0070672_101084199
561 Ga0070686_100643629
562 Ga0070686_100940751
563 Ga0070695_100068640
564 Ga0070696_101396827
565 Ga0070693_100554930
566 Ga0070693_100967210
567 Ga0070665_100581001
568 Ga0070704_100209517
569 Ga0068855_100002398
570 Ga0068855_100042894
571 Ga0070664_100101688
572 Ga0070664_100905437
573 Ga0068857_100002614
574 Ga0068857_100045047
575 Ga0068857_100818946
576 Ga0068857_100910110
577 Ga0068854_101524095
578 Ga0068854_101883885
579 Ga0068856_100002896
580 Ga0068856_100190497
581 Ga0068856_100224043
582 Ga0068856_100936370
583 Ga0068852_100016230
584 Ga0068852_101503261
585 Ga0068852_101760571
586 Ga0068859_100029966
587 Ga0068859_100114422
588 Ga0068864_100381363
589 Ga0068864_101229963
590 Ga0068866_10029142
591 Ga0068866_10838534
592 Ga0068861_100384991
593 Ga0068861_101638620
594 Ga0068861_101725216
595 Ga0068863_100333765
596 Ga0068858_100050546
597 Ga0068858_100130854
598 Ga0068858_100169416
599 Ga0068858_101020434
600 Ga0068858_101328612
601 Ga0068860_100288053
602 Ga0068860_100753437
603 Ga0068860_101516245
604 Ga0068860_102296336
605 Ga0068862_100664559
606 Ga0068862_100878639
607 Ga0068862_102536640
608 Ga0081455_10439444
609 Ga0070716_101098905
610 Ga0097621_100041387
611 Ga0097621_100062979
612 Ga0097621_100135104
613 Ga0097621_100345369
614 Ga0097621_100727926
615 Ga0068871_100221691
616 Ga0068871_100279343
617 Ga0068871_101097692
618 Ga0075428_100373216
619 Ga0075428_100458151
620 Ga0075431_100228874
621 Ga0075431_100488432
622 Ga0075433_10015772
623 Ga0075433_10414067
624 Ga0075434_100083412
625 Ga0075434_100098659
626 Ga0075434_100213459
627 Ga0075434_100331464
628 Ga0075434_100741699
629 Ga0075434_102517709
630 Ga0075429_100134964
631 Ga0075429_100592209
632 Ga0075429_101259010
633 Ga0068865_100099271
634 Ga0068865_100191571
635 Ga0075436_100198364
636 Ga0075436_101135741
637 Ga0097620_100029966
638 Ga0097620_100114431
639 Ga0075435_100257434
640 Ga0075435_100374377
641 Ga0105250_10272905
642 Ga0105240_10004307
643 Ga0105240_10063077
644 Ga0111539_10006791
645 Ga0111539_10711037
646 Ga0111539_12862702
647 Ga0105245_10003760
648 Ga0105245_10010621
649 Ga0105245_10052575
650 Ga0105245_10080736
651 Ga0105245_10161403
652 Ga0105245_10240387
653 Ga0105245_10796120
654 Ga0105245_11254882
655 Ga0105247_10012173
656 Ga0105247_10020363
657 Ga0105247_10182091
658 Ga0105247_10334454
659 Ga0114129_10001513
660 Ga0114129_10169974
661 Ga0114129_10182277
662 Ga0114129_10380437
663 Ga0114129_10463227
664 Ga0105243_10043542
665 Ga0105243_10478910
666 Ga0105243_11340273
667 Ga0105243_11434908
668 Ga0105241_10001909
669 Ga0105241_10013147
670 Ga0105241_10278764
671 Ga0105241_10767345
672 Ga0105242_10043054
673 Ga0105242_10718837
674 Ga0105242_11740345
675 Ga0105242_12632578
676 Ga0105242_13041210
677 Ga0105248_10009279
678 Ga0105248_10050314
679 Ga0105248_10330461
680 Ga0105248_10645196
681 Ga0105248_10682745
682 Ga0105248_10954827
683 Ga0105237_10008995
684 Ga0105237_10030796
685 Ga0105237_10204385
686 Ga0105237_10934547
687 Ga0105237_11003638
688 Ga0105237_11398472
689 Ga0105238_10008155
690 Ga0105238_10017183
691 Ga0105238_10048517
692 Ga0105238_10051735
693 Ga0105238_10098580
694 Ga0105249_10019330
695 Ga0105249_10029592
696 Ga0105249_10164582
697 Ga0105249_10365380
698 Ga0105249_10668097
699 Ga0105249_12665450
700 Ga0105239_10003289
701 Ga0105239_10004635
702 Ga0105239_10793742
703 Ga0105239_10944733
704 Ga0105246_10035618
705 Ga0105246_10164949
706 Ga0105246_10378863
707 Ga0105246_11608281
708 Ga0157371_10076021
709 Ga0157370_10004062
710 Ga0157370_10010437
711 Ga0157369_10006556
712 Ga0157369_10011059
713 Ga0157369_10197836
714 Ga0157369_11750975
715 Ga0157369_12402320
716 Ga0157374_10198581
717 Ga0157374_10235948
718 Ga0157374_10859262
719 Ga0157374_11650443
720 Ga0157378_10016114
721 Ga0157378_10107221
722 Ga0157372_10004450
723 Ga0157372_10153933
724 Ga0157372_10183300
725 Ga0157372_10422504
726 Ga0157372_10959336
727 Ga0157375_11008614
728 Ga0157375_11251959
729 Ga0157375_12159034
730 Ga0163163_10076151
731 Ga0163163_10901861
732 Ga0163163_11707997
733 Ga0163163_11952505
734 Ga0157380_10539403
735 Ga0157377_10148621
736 Ga0157377_10394208
737 Ga0157379_10129348
738 Ga0157379_10353831
739 Ga0157376_10048347
740 Ga0157376_10083281
741 Ga0157376_10220967
742 Ga0157376_10342384
743 Ga0157376_11762926
744 Ga0206356_10190112
745 Ga0206355_1299833
746 Ga0206351_10495129
747 Ga0206352_10023914
748 Ga0206352_10257743
749 Ga0206352_10400890
750 Ga0206352_10695832
751 Ga0224712_10577567
752 Ga0224712_10650848
753 Ga0207692_11030974
754 Ga0207710_10070550
755 Ga0207710_10125677
756 Ga0207688_10943901
757 Ga0207680_11227864
758 Ga0207680_11304394
759 Ga0207685_10039617
760 Ga0207699_10228609
761 Ga0207645_10275021
762 Ga0207654_10002731
763 Ga0207654_10005087
764 Ga0207654_10143130
765 Ga0207654_11028341
766 Ga0207707_10000890
767 Ga0207707_11166415
768 Ga0207695_10000504
769 Ga0207695_10011467
770 Ga0207695_10463619
771 Ga0207695_11217212
772 Ga0207671_10014853
773 Ga0207671_10052786
774 Ga0207671_10797264
775 Ga0207671_11089488
776 Ga0207663_10170410
777 Ga0207663_10337231
778 Ga0207663_10725668
779 Ga0207660_10019893
780 Ga0207662_10206938
781 Ga0207657_10031064
782 Ga0207657_11215190
783 Ga0207649_10059157
784 Ga0207649_10584178
785 Ga0207652_10024635
786 Ga0207652_10072063
787 Ga0207646_10010427
788 Ga0207681_10087351
789 Ga0207694_10003653
790 Ga0207694_10018374
791 Ga0207694_10105158
792 Ga0207694_10112834
793 Ga0207694_10479866
794 Ga0207659_10089075
795 Ga0207659_10615196
796 Ga0207687_10000549
797 Ga0207687_10013746
798 Ga0207687_10247087
799 Ga0207687_10442280
800 Ga0207700_10174627
801 Ga0207700_10320667
802 Ga0207700_10553877
803 Ga0207664_10063797
804 Ga0207690_10062412
805 Ga0207706_10136052
806 Ga0207686_11751677
807 Ga0207670_10558720
808 Ga0207670_10669825
809 Ga0207704_10004068
810 Ga0207704_10298690
811 Ga0207691_10476938
812 Ga0207691_11038538
813 Ga0207711_10000454
814 Ga0207711_10245290
815 Ga0207689_11308883
816 Ga0207661_10002830
817 Ga0207661_10016407
818 Ga0207661_10029404
819 Ga0207661_10509228
820 Ga0207661_10767873
821 Ga0207667_10000179
822 Ga0207667_10018000
823 Ga0207667_10056401
824 Ga0207651_11491547
825 Ga0207712_10019429
826 Ga0207712_10068984
827 Ga0207712_10430577
828 Ga0207712_11371004
829 Ga0207640_10873462
830 Ga0207677_10988258
831 Ga0207703_10009531
832 Ga0207703_10010375
833 Ga0207703_10044271
834 Ga0207703_11808488
835 Ga0207639_10165362
836 Ga0207639_10546421
837 Ga0207702_10002077
838 Ga0207702_10049705
839 Ga0207702_10337030
840 Ga0207702_10766014
841 Ga0207648_10089008
842 Ga0207648_10164515
843 Ga0207648_11720704
844 Ga0207648_11885174
845 Ga0207676_10426465
846 Ga0207674_10002628
847 Ga0207674_10004547
848 Ga0207674_10581746
849 Ga0207675_100004480
850 Ga0207675_100366693
851 Ga0207683_10249415
852 Ga0207698_10048774
853 Ga0207698_10452910
854 Ga0209982_1075980
855 Ga0207428_10068533
856 Ga0207428_10084295
857 Ga0268265_10453647
858 Ga0268265_11549040
859 Ga0268264_10334649
860 Ga0268264_11232956
861 Ga0265313_10048762
862 Ga0265314_10000658
863 Ga0373928_0141405
864 Ga0373934_0002610
865 Ga0373934_0044285
866 Ga0373934_0475038
867 Ga0373952_0025251
868 Ga0373939_0080377
869 Ga0373953_0008362
870 Ga0373954_0022048
871 Ga0373956_0031640
872 Ga0373955_0016762
873 Ga0373955_0095433
874 Ga0373955_0350940
875 Ga0373931_0545972
876 Ga0373935_0204133
877 Ga0373935_0594603
878 Ga0373933_0004463
879 Ga0373933_0039189
880 Ga0373933_0103848
881 Ga0373937_0019719
882 Ga0373937_0110261
883 Ga0373937_0162331
884 Ga0373925_0217900
885 Ga0436362_0014410
886 Ga0439431_0144176
887 Ga0451577_0639447
888 Ga0495592_0272740
889 Ga0495651_0120515
890 Ga0495651_0269089
891 Ga0495580_0042603
892 Ga0495582_0003549
893 Ga0495639_0343824
894 Ga0495664_0319122
895 Ga0495594_0024353
896 Ga0495608_0071540
897 Ga0495630_0236692
898 Ga0495666_0259652
899 Ga0495652_0852101
900 Ga0495586_0035602
901 Ga0495586_0122544
902 Ga0495586_0631218
903 Ga0495587_0208119
904 Ga0495645_0122149
905 Ga0495667_0177200
906 Ga0495667_0610826
907 Ga0495634_0153348
908 Ga0495635_0224825
909 Ga0495599_0016853
910 Ga0495599_0261700
911 Ga0495623_0052826
912 Ga0495623_0285521
913 Ga0495658_0011495
914 Ga0495658_0264969
915 Ga0495669_0251183
916 Ga0495600_0852169
917 Ga0495636_0162713
918 Ga0495674_0757589
919 Ga0495680_0206450
920 Ga0495680_0869110
921 Ga0495684_0058209
922 Ga0495684_0591051
923 Ga0495602_0000399
924 Ga0495602_0155818
925 Ga0496102_0307806
926 Ga0496104_0645805
927 Ga0496104_0813008
928 Ga0496108_0666583
929 Ga0496112_0731613
930 Ga0496115_0981995
931 nmdc:mga05p37_1145352_c1
932 nmdc:mga05p37_17482_c1
933 nmdc:mga05p37_215318_c1
934 nmdc:mga05p37_3907_c1
935 nmdc:mga09592_1450410_c1
936 nmdc:mga09592_87651_c1
937 nmdc:mga0qj67_493083_c1
938 nmdc:mga06r32_311367_c1
939 nmdc:mga06r32_748535_c1
940 nmdc:mga08y16_19796_c1
941 nmdc:mga08y16_50620_c1
942 nmdc:mga0n895_2000226_c1
943 nmdc:mga0n895_278021_c1
944 nmdc:mga0n895_434449_c1
945 nmdc:mga0n895_7026_c1
946 nmdc:mga0n895_73943_c1
947 nmdc:mga0rr50_332202_c1
948 nmdc:mga0rr50_666888_c1
949 nmdc:mga0rr50_715183_c1
950 nmdc:mga08x19_1050455_c1
951 nmdc:mga08x19_205613_c1
952 nmdc:mga08x19_537822_c1
953 nmdc:mga0a205_326737_c1
954 nmdc:mga0a205_34516_c1
955 Ga0495601_0296764
956 Ga0495595_0332855
957 Ga0500559_0479451
958 Ga0587092_079496
959 Ga0587109_156814
960 Ga0587117_085491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

15

115

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eqv-assembly1.cif.gz_A 1.45 angstrom crystal structure of bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein from yersinia pestis with phosphate bound to the active site 0.8032 50 73
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7924 38 72
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7911 38 72
3jyf-assembly1.cif.gz_A the crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.787 50 73
1l1o-assembly1.cif.gz_E structure of the human replication protein a (rpa) trimerization core 0.7792 35 115
ID Description Score Start End Superfamily
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8491 37 95 2.40.50.140
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8438 41 69 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8269 42 67 2.30.29.30
af_C3JXD8_846_1160_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8183 42 74 3.90.190.10
af_Q54S93_1_135_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.8078 51 72 3.40.20.10
ID Description Score Start End GO Terms
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9872 29 122
AF-A0A2V8DL04-F1-model_v4 DUF5666 domain-containing protein 0.9798 36 122
AF-A0A7X4ETN3-F1-model_v4 DUF5666 domain-containing protein 0.9759 36 121
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9732 29 122
AF-A0A523MDR3-F1-model_v4 Uncharacterized protein 0.966 24 122

Map