F452072

General Info

Members Datasets Scaffolds Average Seq Length
479 216 958 133

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0021453|Ga0373954_0021453_275_739
Length 154
Sequence MLSGIMLGISYYAANRYDGSVATLGFIEYADASPEVRAVYDDIMATRKTDWINNFWKALARDPVTLRRTWQSVKEIMAPGALDALTKEMIYLAVSATNQCGYCIASHTAAARKAGMTDAMLAELMAVVGMANESNRLASGYQVEIDQRFLATKP

Samples

Sample ID Description Type Environment
1 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
150 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
205 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.25
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 15.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373954_0021453 3300035118 Bacteria 2925
2 Ga0065715_10283575 3300005293 Bacteria 1052
3 Ga0065707_10017435 3300005295 Bacteria 1510
4 Ga0070658_10144264 3300005327 Bacteria 1990
5 Ga0070683_100539149 3300005329 Unclassified 1115
6 Ga0070683_101248450 3300005329 Bacteria 714
7 Ga0068869_100681114 3300005334 Bacteria 875
8 Ga0070666_10009670 3300005335 Bacteria 6021
9 Ga0070680_100000603 3300005336 Bacteria 24867
10 Ga0070680_100198215 3300005336 Bacteria 1693
11 Ga0070660_100199792 3300005339 Bacteria 1622
12 Ga0070689_100399508 3300005340 Unclassified 1161
13 Ga0070692_10277844 3300005345 Unclassified 1014
14 Ga0070671_100172603 3300005355 Bacteria 1829
15 Ga0070673_100337646 3300005364 Bacteria 1334
16 Ga0070709_10061378 3300005434 Bacteria 2393
17 Ga0070709_10244634 3300005434 Bacteria 1289
18 Ga0070709_10443953 3300005434 Bacteria 976
19 Ga0070709_10464447 3300005434 Bacteria 956
20 Ga0070709_10766051 3300005434 Bacteria 755
21 Ga0070714_100001908 3300005435 Bacteria 15192
22 Ga0070714_100063751 3300005435 Bacteria 3170
23 Ga0070714_100881835 3300005435 Unclassified 868
24 Ga0070714_101458614 3300005435 Bacteria 668
25 Ga0070713_100011727 3300005436 Bacteria 6397
26 Ga0070713_100132066 3300005436 Bacteria 2203
27 Ga0070713_100601533 3300005436 Bacteria 1045
28 Ga0070713_101608213 3300005436 Unclassified 631
29 Ga0070711_100426981 3300005439 Bacteria 1081
30 Ga0070705_100170341 3300005440 Bacteria 1465
31 Ga0070705_100674494 3300005440 Bacteria 809
32 Ga0070705_101486522 3300005440 Bacteria 567
33 Ga0070700_100453247 3300005441 Bacteria 976
34 Ga0070694_100410674 3300005444 Bacteria 1062
35 Ga0070681_10046224 3300005458 Bacteria 4353
36 Ga0070681_10160739 3300005458 Bacteria 2170
37 Ga0070681_11593091 3300005458 Bacteria 578
38 Ga0070685_10480816 3300005466 Bacteria 875
39 Ga0070699_100027033 3300005518 Bacteria 4949
40 Ga0070679_100120246 3300005530 Unclassified 2611
41 Ga0070679_100184126 3300005530 Bacteria 2060
42 Ga0070679_100345135 3300005530 Bacteria 1437
43 Ga0070684_100277082 3300005535 Bacteria 1536
44 Ga0070697_100276259 3300005536 Bacteria 1441
45 Ga0070695_100049912 3300005545 Bacteria 2680
46 Ga0070695_101277678 3300005545 Bacteria 606
47 Ga0070696_100001883 3300005546 Bacteria 13769
48 Ga0068855_100024061 3300005563 Bacteria 7291
49 Ga0068855_100038633 3300005563 Bacteria 5671
50 Ga0070664_101087429 3300005564 Unclassified 753
51 Ga0068854_100114737 3300005578 Bacteria 2037
52 Ga0068856_100184532 3300005614 Bacteria 2099
53 Ga0068856_100189223 3300005614 Unclassified 2072
54 Ga0068856_100456820 3300005614 Bacteria 1298
55 Ga0068856_101035113 3300005614 Bacteria 839
56 Ga0068856_101992983 3300005614 Bacteria 591
57 Ga0068852_100048861 3300005616 Unclassified 3617
58 Ga0068852_100050835 3300005616 Bacteria 3554
59 Ga0068852_102202267 3300005616 Unclassified 573
60 Ga0068866_10235562 3300005718 Bacteria 1112
61 Ga0068863_100035022 3300005841 Bacteria 4782
62 Ga0068863_101068604 3300005841 Bacteria 811
63 Ga0068858_100030759 3300005842 Bacteria 4985
64 Ga0068858_101247028 3300005842 Unclassified 731
65 Ga0068860_101908758 3300005843 Bacteria 615
66 Ga0068862_100350422 3300005844 Bacteria 1370
67 Ga0070717_10002621 3300006028 Bacteria 12687
68 Ga0070717_10103727 3300006028 Bacteria 2418
69 Ga0070717_10279654 3300006028 Unclassified 1480
70 Ga0070717_10756918 3300006028 Bacteria 883
71 Ga0070715_10146348 3300006163 Bacteria 1153
72 Ga0070716_100194761 3300006173 Bacteria 1342
73 Ga0070712_100095993 3300006175 Bacteria 2182
74 Ga0070712_100849383 3300006175 Unclassified 785
75 Ga0070712_101876381 3300006175 Bacteria 525
76 Ga0097621_100029509 3300006237 Bacteria 4333
77 Ga0097621_100433861 3300006237 Bacteria 1181
78 Ga0068871_100087229 3300006358 Bacteria 2594
79 Ga0068871_100964856 3300006358 Unclassified 792
80 Ga0068871_101150931 3300006358 Bacteria 727
81 Ga0075428_100168551 3300006844 Bacteria 2375
82 Ga0075428_100399889 3300006844 Bacteria 1472
83 Ga0075430_100050546 3300006846 Bacteria 3505
84 Ga0075431_100198110 3300006847 Bacteria 2056
85 Ga0075433_10016015 3300006852 Bacteria 6167
86 Ga0075433_10159072 3300006852 Bacteria 2010
87 Ga0075433_11175871 3300006852 Bacteria 666
88 Ga0075436_100003331 3300006914 Bacteria 10997
89 Ga0075436_100180882 3300006914 Bacteria 1490
90 Ga0075435_100456843 3300007076 Bacteria 1102
91 Ga0075435_100763751 3300007076 Unclassified 841
92 Ga0099794_10433860 3300007265 Bacteria 688
93 Ga0105240_10031207 3300009093 Bacteria 6914
94 Ga0105240_10163378 3300009093 Unclassified 2643
95 Ga0105240_10570922 3300009093 Bacteria 1249
96 Ga0111539_10011240 3300009094 Bacteria 11247
97 Ga0111539_13103335 3300009094 Bacteria 536
98 Ga0111539_13145430 3300009094 Unclassified 532
99 Ga0105245_10000501 3300009098 Bacteria 35913
100 Ga0105245_10072049 3300009098 Bacteria 3138
101 Ga0105245_10225039 3300009098 Bacteria 1812
102 Ga0105245_10591440 3300009098 Bacteria 1135
103 Ga0105245_10824453 3300009098 Bacteria 967
104 Ga0105247_10166487 3300009101 Bacteria 1463
105 Ga0105247_10236213 3300009101 Bacteria 1243
106 Ga0114129_10023067 3300009147 Bacteria 8829
107 Ga0114129_10898538 3300009147 Bacteria 1122
108 Ga0105243_10574921 3300009148 Bacteria 1081
109 Ga0105241_10576064 3300009174 Bacteria 1014
110 Ga0105241_11035355 3300009174 Bacteria 770
111 Ga0105241_11238113 3300009174 Bacteria 708
112 Ga0105242_10404006 3300009176 Bacteria 1276
113 Ga0105242_10546737 3300009176 Bacteria 1110
114 Ga0105242_10895880 3300009176 Bacteria 887
115 Ga0105242_11203657 3300009176 Bacteria 777
116 Ga0105242_12166584 3300009176 Unclassified 601
117 Ga0105248_10044279 3300009177 Bacteria 4992
118 Ga0105248_10145027 3300009177 Bacteria 2679
119 Ga0105248_10235956 3300009177 Unclassified 2059
120 Ga0105248_10250000 3300009177 Bacteria 1996
121 Ga0105248_11593356 3300009177 Bacteria 740
122 Ga0105248_11856636 3300009177 Unclassified 684
123 Ga0105237_10081667 3300009545 Bacteria 3223
124 Ga0105238_11091683 3300009551 Bacteria 820
125 Ga0105239_10020563 3300010375 Bacteria 7282
126 Ga0105239_10030843 3300010375 Bacteria 5897
127 Ga0105239_10193328 3300010375 Unclassified 2278
128 Ga0157370_10002048 3300013104 Bacteria 24771
129 Ga0157370_10486579 3300013104 Bacteria 1134
130 Ga0157369_10000788 3300013105 Bacteria 40686
131 Ga0157374_10012700 3300013296 Bacteria 7336
132 Ga0157378_10002472 3300013297 Bacteria 16437
133 Ga0157378_11306239 3300013297 Bacteria 767
134 Ga0157378_11605539 3300013297 Bacteria 696
135 Ga0163162_10038360 3300013306 Bacteria 4781
136 Ga0163162_10230624 3300013306 Unclassified 1982
137 Ga0157372_10009195 3300013307 Bacteria 10505
138 Ga0157372_10155957 3300013307 Unclassified 2637
139 Ga0157372_10670139 3300013307 Bacteria 1208
140 Ga0157372_11124616 3300013307 Bacteria 908
141 Ga0157375_10007704 3300013308 Bacteria 9424
142 Ga0163163_10011408 3300014325 Bacteria 8058
143 Ga0163163_10806810 3300014325 Unclassified 1002
144 Ga0163163_10879691 3300014325 Bacteria 959
145 Ga0157380_10244657 3300014326 Unclassified 1619
146 Ga0157380_10316503 3300014326 Bacteria 1445
147 Ga0157379_10284555 3300014968 Bacteria 1505
148 Ga0157376_10084913 3300014969 Bacteria 2727
149 Ga0157376_10239159 3300014969 Bacteria 1691
150 Ga0157376_10917177 3300014969 Bacteria 895
151 Ga0197907_10563520 3300020069 Bacteria 777
152 Ga0206349_1509274 3300020075 Bacteria 1196
153 Ga0206350_10435844 3300020080 Unclassified 1753
154 Ga0213875_10119264 3300021388 Unclassified 1233
155 Ga0213875_10159338 3300021388 Unclassified 1058
156 Ga0224712_10108607 3300022467 Unclassified 1187
157 Ga0228598_1001759 3300024227 Bacteria 4742
158 Ga0207710_10248223 3300025900 Bacteria 889
159 Ga0207699_10057535 3300025906 Bacteria 2322
160 Ga0207699_10177842 3300025906 Unclassified 1428
161 Ga0207699_10387609 3300025906 Bacteria 993
162 Ga0207705_10015894 3300025909 Bacteria 5404
163 Ga0207705_10090709 3300025909 Bacteria 2238
164 Ga0207705_10212891 3300025909 Bacteria 1466
165 Ga0207707_10181674 3300025912 Bacteria 1836
166 Ga0207695_10032470 3300025913 Bacteria 5712
167 Ga0207695_10506704 3300025913 Bacteria 1089
168 Ga0207671_10035863 3300025914 Bacteria 3677
169 Ga0207671_10042114 3300025914 Unclassified 3380
170 Ga0207693_10110278 3300025915 Bacteria 2158
171 Ga0207693_10679346 3300025915 Bacteria 799
172 Ga0207663_10093681 3300025916 Bacteria 2000
173 Ga0207663_10320540 3300025916 Bacteria 1164
174 Ga0207663_10765390 3300025916 Bacteria 767
175 Ga0207663_11561146 3300025916 Unclassified 531
176 Ga0207660_10003403 3300025917 Bacteria 10371
177 Ga0207657_10003341 3300025919 Bacteria 17156
178 Ga0207657_10275665 3300025919 Bacteria 1336
179 Ga0207652_10250272 3300025921 Unclassified 1598
180 Ga0207652_10875744 3300025921 Bacteria 794
181 Ga0207646_10591176 3300025922 Bacteria 997
182 Ga0207687_10001669 3300025927 Bacteria 15309
183 Ga0207687_11013600 3300025927 Unclassified 712
184 Ga0207687_11088688 3300025927 Bacteria 686
185 Ga0207700_10147949 3300025928 Bacteria 1938
186 Ga0207700_10196703 3300025928 Bacteria 1697
187 Ga0207700_10352590 3300025928 Bacteria 1282
188 Ga0207700_10533985 3300025928 Bacteria 1040
189 Ga0207700_11310583 3300025928 Unclassified 645
190 Ga0207700_11586014 3300025928 Bacteria 579
191 Ga0207664_10012309 3300025929 Bacteria 6111
192 Ga0207664_10057964 3300025929 Bacteria 3080
193 Ga0207644_10153233 3300025931 Unclassified 1785
194 Ga0207686_11382142 3300025934 Bacteria 579
195 Ga0207665_10146174 3300025939 Bacteria 1689
196 Ga0207665_10474169 3300025939 Bacteria 963
197 Ga0207711_10043563 3300025941 Bacteria 3829
198 Ga0207711_10200507 3300025941 Bacteria 1821
199 Ga0207711_10475664 3300025941 Bacteria 1164
200 Ga0207689_10201164 3300025942 Bacteria 1644
201 Ga0207689_10584039 3300025942 Bacteria 939
202 Ga0207661_10035835 3300025944 Bacteria 3869
203 Ga0207679_11206677 3300025945 Unclassified 694
204 Ga0207667_10023206 3300025949 Bacteria 6833
205 Ga0207640_10028460 3300025981 Bacteria 3417
206 Ga0207640_10122309 3300025981 Bacteria 1867
207 Ga0207702_10211982 3300026078 Bacteria 1801
208 Ga0207702_10419884 3300026078 Unclassified 1293
209 Ga0207641_10166418 3300026088 Bacteria 2008
210 Ga0207676_10518739 3300026095 Bacteria 1134
211 Ga0207676_11460229 3300026095 Bacteria 680
212 Ga0207674_10951073 3300026116 Unclassified 828
213 Ga0207675_100624989 3300026118 Bacteria 1082
214 Ga0207698_10124993 3300026142 Unclassified 2185
215 Ga0207698_10202704 3300026142 Bacteria 1778
216 Ga0268265_11887978 3300028380 Unclassified 604
217 Ga0265334_10252615 3300028573 Bacteria 607
218 Ga0265338_10574128 3300028800 Bacteria 787
219 Ga0265338_10869448 3300028800 Bacteria 615
220 Ga0265762_1005136 3300030760 Bacteria 2343
221 Ga0265325_10035636 3300031241 Unclassified 2641
222 Ga0265325_10113208 3300031241 Unclassified 1316
223 Ga0265325_10212198 3300031241 Bacteria 889
224 Ga0265340_10131625 3300031247 Bacteria 1147
225 Ga0265339_10096843 3300031249 Bacteria 1540
226 Ga0265339_10282086 3300031249 Bacteria 796
227 Ga0265331_10003105 3300031250 Bacteria 10874
228 Ga0265331_10268934 3300031250 Bacteria 764
229 Ga0265316_10075159 3300031344 Bacteria 2598
230 Ga0265316_10461069 3300031344 Bacteria 911
231 Ga0265316_10670263 3300031344 Bacteria 732
232 Ga0265313_10000259 3300031595 Bacteria 57603
233 Ga0265313_10236092 3300031595 Bacteria 750
234 Ga0265314_10015752 3300031711 Bacteria 5988
235 Ga0265314_10135923 3300031711 Bacteria 1527
236 Ga0265342_10026347 3300031712 Bacteria 3644
237 Ga0265342_10380503 3300031712 Bacteria 731
238 Ga0373938_0225860 3300034957 Unclassified 527
239 Ga0373926_0019784 3300035083 Bacteria 2322
240 Ga0373926_0092318 3300035083 Bacteria 1126
241 Ga0373934_0000656 3300035086 Bacteria 12305
242 Ga0373934_0151513 3300035086 Bacteria 950
243 Ga0373944_0252394 3300035089 Bacteria 651
244 Ga0373923_0001824 3300035111 Bacteria 6308
245 Ga0373923_0005032 3300035111 Bacteria 4451
246 Ga0373936_0327904 3300035113 Bacteria 694
247 Ga0373945_0014744 3300035116 Bacteria 2623
248 Ga0373945_0217378 3300035116 Bacteria 798
249 Ga0373953_0199182 3300035117 Bacteria 866
250 Ga0373954_0012984 3300035118 Bacteria 3708
251 Ga0373954_0031742 3300035118 Bacteria 2439
252 Ga0373954_0034146 3300035118 Bacteria 2355
253 Ga0373954_0114708 3300035118 Bacteria 1305
254 Ga0373954_0343217 3300035118 Bacteria 737
255 Ga0373956_0147682 3300035119 Bacteria 1105
256 Ga0373956_0225208 3300035119 Unclassified 890
257 Ga0373956_0566471 3300035119 Bacteria 542
258 Ga0373957_0282973 3300035120 Unclassified 701
259 Ga0373943_0006447 3300035170 Bacteria 5271
260 Ga0373943_0011369 3300035170 Bacteria 4005
261 Ga0373943_0327242 3300035170 Bacteria 875
262 Ga0373946_0115002 3300035171 Bacteria 1222
263 Ga0373946_0326708 3300035171 Unclassified 763
264 Ga0373955_0162595 3300035172 Bacteria 1318
265 Ga0373955_0215221 3300035172 Bacteria 1146
266 Ga0373955_0270929 3300035172 Unclassified 1020
267 Ga0373924_0050738 3300035410 Bacteria 1719
268 Ga0373935_0004015 3300035692 Bacteria 8599
269 Ga0373935_0026368 3300035692 Bacteria 3586
270 Ga0373935_0088172 3300035692 Bacteria 2027
271 Ga0373935_0199219 3300035692 Bacteria 1383
272 Ga0373935_0383555 3300035692 Bacteria 1007
273 Ga0373927_0000410 3300035695 Bacteria 33006
274 Ga0373927_0005229 3300035695 Bacteria 8980
275 Ga0373927_0005901 3300035695 Bacteria 8390
276 Ga0373927_0009485 3300035695 Bacteria 6527
277 Ga0373927_0010048 3300035695 Bacteria 6337
278 Ga0373927_0139764 3300035695 Bacteria 1584
279 Ga0373927_0348297 3300035695 Bacteria 976
280 Ga0373927_0750373 3300035695 Bacteria 645
281 Ga0373927_1185450 3300035695 Bacteria 504
282 Ga0373933_0069145 3300035724 Bacteria 2146
283 Ga0373933_0111916 3300035724 Bacteria 1704
284 Ga0373933_0251647 3300035724 Bacteria 1138
285 Ga0373947_0003516 3300035725 Bacteria 9254
286 Ga0373947_0011522 3300035725 Bacteria 5072
287 Ga0373947_0031310 3300035725 Bacteria 3130
288 Ga0373947_0527239 3300035725 Bacteria 803
289 Ga0373947_0915290 3300035725 Unclassified 599
290 Ga0373937_0012037 3300036401 Bacteria 7591
291 Ga0373937_0073351 3300036401 Bacteria 3157
292 Ga0373937_0073957 3300036401 Bacteria 3144
293 Ga0373937_0158444 3300036401 Bacteria 2122
294 Ga0373937_0235027 3300036401 Bacteria 1726
295 Ga0373937_0312244 3300036401 Bacteria 1487
296 Ga0373937_0638623 3300036401 Bacteria 1010
297 Ga0373937_1357646 3300036401 Unclassified 659
298 Ga0373925_0000290 3300037068 Bacteria 52495
299 Ga0373925_0004817 3300037068 Bacteria 10167
300 Ga0373925_0025869 3300037068 Bacteria 4291
301 Ga0373925_0343060 3300037068 Bacteria 1212
302 Ga0373925_0372926 3300037068 Bacteria 1161
303 Ga0373925_0684695 3300037068 Unclassified 845
304 Ga0395900_0883894 3300037418 Unclassified 818
305 Ga0395898_0089682 3300037466 Bacteria 2959
306 Ga0436364_0461246 3300037853 Unclassified 1233
307 Ga0436364_0946456 3300037853 Unclassified 921
308 Ga0436364_1048407 3300037853 Bacteria 2435
309 Ga0436364_1092360 3300037853 Bacteria 595
310 Ga0436364_1250532 3300037853 Bacteria 570
311 Ga0436365_0663636 3300039437 Bacteria 1200
312 Ga0436365_1876346 3300039437 Bacteria 1356
313 Ga0436360_1311870 3300039438 Bacteria 720
314 Ga0436363_0201106 3300039450 Bacteria 2663
315 Ga0436363_0493904 3300039450 Unclassified 598
316 Ga0436363_1061344 3300039450 Unclassified 822
317 Ga0450917_016348 3300042120 Bacteria 633
318 Ga0450890_092136 3300042127 Bacteria 504
319 Ga0451577_0120995 3300042876 Bacteria 2345
320 Ga0451577_0219187 3300042876 Bacteria 1720
321 Ga0451577_0808030 3300042876 Bacteria 847
322 Ga0453683_0157299 3300044673 Bacteria 1437
323 Ga0451576_0430726 3300045051 Bacteria 1384
324 Ga0451576_0466924 3300045051 Bacteria 1325
325 Ga0451576_1812754 3300045051 Unclassified 631
326 Ga0466958_0967663 3300045836 Bacteria 555
327 Ga0466967_0592799 3300045976 Unclassified 1093
328 Ga0466967_1740688 3300045976 Bacteria 621
329 Ga0495592_0039188 3300046454 Bacteria 3561
330 Ga0495592_0043786 3300046454 Unclassified 3347
331 Ga0495592_0158504 3300046454 Bacteria 1559
332 Ga0495629_0054082 3300046459 Unclassified 2808
333 Ga0495651_0001906 3300046462 Bacteria 16140
334 Ga0495651_0039165 3300046462 Bacteria 3691
335 Ga0495651_0045342 3300046462 Bacteria 3406
336 Ga0495651_0058987 3300046462 Bacteria 2944
337 Ga0495651_0491892 3300046462 Bacteria 786
338 Ga0495651_0743873 3300046462 Bacteria 608
339 Ga0495653_0005284 3300046463 Bacteria 10506
340 Ga0495653_0454744 3300046463 Bacteria 805
341 Ga0495580_0002265 3300046472 Bacteria 16811
342 Ga0495580_0044153 3300046472 Bacteria 3171
343 Ga0495580_0069147 3300046472 Bacteria 2468
344 Ga0495580_0263535 3300046472 Bacteria 1178
345 Ga0495580_0283450 3300046472 Bacteria 1130
346 Ga0495580_0376448 3300046472 Bacteria 959
347 Ga0495580_0418882 3300046472 Bacteria 901
348 Ga0495580_0491574 3300046472 Bacteria 820
349 Ga0495580_0560571 3300046472 Bacteria 758
350 Ga0495662_0026801 3300046476 Bacteria 2783
351 Ga0495664_0092050 3300046477 Bacteria 1823
352 Ga0495594_0161047 3300046499 Bacteria 1276
353 Ga0495608_0020160 3300046511 Bacteria 4582
354 Ga0495608_0667937 3300046511 Bacteria 620
355 Ga0495618_0161778 3300046514 Bacteria 1427
356 Ga0495618_0355772 3300046514 Unclassified 902
357 Ga0495618_0444288 3300046514 Bacteria 788
358 Ga0495618_0566146 3300046514 Bacteria 679
359 Ga0495628_0012711 3300046516 Bacteria 7091
360 Ga0495628_0131916 3300046516 Unclassified 1910
361 Ga0495630_0040898 3300046517 Bacteria 3463
362 Ga0495630_0052245 3300046517 Bacteria 3059
363 Ga0495630_0193938 3300046517 Bacteria 1550
364 Ga0495630_0330284 3300046517 Bacteria 1166
365 Ga0495630_0438181 3300046517 Bacteria 1001
366 Ga0495630_1111444 3300046517 Unclassified 599
367 Ga0495666_0003968 3300046526 Bacteria 7482
368 Ga0495666_0110838 3300046526 Bacteria 1289
369 Ga0495666_0269893 3300046526 Bacteria 773
370 Ga0495652_0140828 3300046529 Bacteria 1897
371 Ga0495652_0146357 3300046529 Bacteria 1851
372 Ga0495652_0237432 3300046529 Bacteria 1359
373 Ga0495665_0031846 3300046531 Bacteria 2821
374 Ga0495665_0319895 3300046531 Bacteria 792
375 Ga0495665_0598459 3300046531 Bacteria 551
376 Ga0495640_0062685 3300046533 Bacteria 2521
377 Ga0495586_0003683 3300046535 Bacteria 8216
378 Ga0495586_0086599 3300046535 Bacteria 1727
379 Ga0495587_0056827 3300046536 Bacteria 2302
380 Ga0495587_0239969 3300046536 Unclassified 1020
381 Ga0495645_0023494 3300046543 Bacteria 4464
382 Ga0495645_0042582 3300046543 Bacteria 3311
383 Ga0495645_0082080 3300046543 Bacteria 2312
384 Ga0495645_0167026 3300046543 Bacteria 1517
385 Ga0495645_0482112 3300046543 Unclassified 778
386 Ga0495645_0689152 3300046543 Bacteria 621
387 Ga0495633_0343793 3300046558 Bacteria 676
388 Ga0495667_0004299 3300046559 Bacteria 9606
389 Ga0495667_0029256 3300046559 Bacteria 3708
390 Ga0495667_0032513 3300046559 Bacteria 3496
391 Ga0495667_0049740 3300046559 Bacteria 2767
392 Ga0495667_0070849 3300046559 Bacteria 2274
393 Ga0495667_0078849 3300046559 Bacteria 2141
394 Ga0495667_0167401 3300046559 Bacteria 1413
395 Ga0495634_0045796 3300046642 Bacteria 2955
396 Ga0495634_0122575 3300046642 Bacteria 1664
397 Ga0495634_0219619 3300046642 Bacteria 1174
398 Ga0495635_0009348 3300046663 Bacteria 6851
399 Ga0495635_0037528 3300046663 Bacteria 3354
400 Ga0495657_0041948 3300046675 Bacteria 3127
401 Ga0495657_0110219 3300046675 Unclassified 1745
402 Ga0495657_0287373 3300046675 Bacteria 983
403 Ga0495657_0872299 3300046675 Bacteria 512
404 Ga0495599_0014337 3300046678 Bacteria 4909
405 Ga0495599_0644148 3300046678 Unclassified 614
406 Ga0495623_0006759 3300046679 Bacteria 7464
407 Ga0495623_0204439 3300046679 Bacteria 1134
408 Ga0495646_0006733 3300046680 Bacteria 7290
409 Ga0495646_0039170 3300046680 Bacteria 2923
410 Ga0495646_0075434 3300046680 Bacteria 1977
411 Ga0495613_0046020 3300046689 Bacteria 3227
412 Ga0495613_0059308 3300046689 Bacteria 2806
413 Ga0495613_0437744 3300046689 Bacteria 887
414 Ga0495613_0497501 3300046689 Bacteria 821
415 Ga0495624_0013022 3300046690 Bacteria 5670
416 Ga0495624_0227421 3300046690 Bacteria 1130
417 Ga0495624_0785521 3300046690 Bacteria 563
418 Ga0495600_0025281 3300046809 Bacteria 3827
419 Ga0495600_0121314 3300046809 Bacteria 1700
420 Ga0495604_0018389 3300047317 Bacteria 5597
421 Ga0495604_0031465 3300047317 Bacteria 4207
422 Ga0495604_0075390 3300047317 Bacteria 2540
423 Ga0495604_0184066 3300047317 Bacteria 1460
424 Ga0495636_0169796 3300047318 Bacteria 986
425 Ga0495674_0015030 3300047319 Bacteria 7244
426 Ga0495674_0027312 3300047319 Bacteria 5216
427 Ga0495674_0197606 3300047319 Bacteria 1669
428 Ga0495674_0342929 3300047319 Bacteria 1214
429 Ga0495680_0003254 3300047322 Bacteria 16125
430 Ga0495680_0154546 3300047322 Bacteria 1670
431 Ga0495680_0244342 3300047322 Bacteria 1274
432 Ga0495675_0005288 3300047444 Bacteria 7861
433 Ga0495675_0162787 3300047444 Bacteria 1373
434 Ga0495675_0170807 3300047444 Bacteria 1335
435 Ga0495675_0196932 3300047444 Bacteria 1228
436 Ga0495675_0299096 3300047444 Bacteria 956
437 Ga0495675_0319644 3300047444 Unclassified 918
438 Ga0495684_0000853 3300047471 Bacteria 24661
439 Ga0495684_0012266 3300047471 Bacteria 6612
440 Ga0495684_0018374 3300047471 Bacteria 5388
441 Ga0495684_0195217 3300047471 Bacteria 1494
442 Ga0495684_0734605 3300047471 Bacteria 651
443 Ga0495593_0004005 3300047673 Bacteria 8781
444 Ga0495602_0042312 3300048088 Bacteria 4152
445 Ga0495602_0072230 3300048088 Bacteria 2943
446 Ga0495602_0086806 3300048088 Bacteria 2611
447 Ga0495602_0538273 3300048088 Bacteria 811
448 Ga0495602_0587672 3300048088 Bacteria 767
449 Ga0495614_0002924 3300048089 Bacteria 7612
450 Ga0495614_0070525 3300048089 Unclassified 1506
451 Ga0496100_1517398 3300048903 Unclassified 529
452 Ga0496104_0278341 3300048907 Bacteria 1586
453 Ga0496108_0804783 3300048911 Bacteria 811
454 Ga0496109_0737597 3300048912 Unclassified 923
455 Ga0496112_0904099 3300048915 Bacteria 805
456 Ga0496115_0046160 3300048918 Bacteria 3481
457 Ga0501299_135011 3300049522 Bacteria 608
458 Ga0501047_0123918 3300049581 Bacteria 2464
459 Ga0501070_0037888 3300049586 Bacteria 4024
460 Ga0501208_106951 3300049655 Bacteria 605
461 Ga0501210_036691 3300049657 Bacteria 526
462 Ga0501044_0007708 3300049823 Bacteria 11840
463 Ga0501044_0008607 3300049823 Bacteria 11173
464 nmdc:mga0qj67_1364825_c1 3300050509 Unclassified 548
465 nmdc:mga06r32_97580_c1 3300050510 Bacteria 2880
466 nmdc:mga06r32_97711_c1 3300050510 Unclassified 2878
467 nmdc:mga0rr50_319968_c1 3300050513 Bacteria 1300
468 nmdc:mga0rr50_995544_c1 3300050513 Unclassified 714
469 nmdc:mga08x19_1002106_c1 3300050514 Bacteria 593
470 nmdc:mga08x19_1749_c1 3300050514 Bacteria 13388
471 nmdc:mga08x19_814734_c1 3300050514 Bacteria 663
472 nmdc:mga0a205_794470_c1 3300050515 Bacteria 794
473 Ga0495601_0052670 3300053077 Bacteria 2571
474 Ga0495601_0220499 3300053077 Unclassified 1239
475 Ga0495601_1039129 3300053077 Bacteria 514
476 Ga0495612_0007769 3300053078 Bacteria 4377
477 Ga0495595_0202638 3300053084 Bacteria 988
478 Ga0587073_0068022 3300059492 Bacteria 853
479 Ga0587067_005530 3300059640 Unclassified 1718
480 Ga0373954_0021453
481 Ga0065715_10283575
482 Ga0065707_10017435
483 Ga0070658_10144264
484 Ga0070683_100539149
485 Ga0070683_101248450
486 Ga0068869_100681114
487 Ga0070666_10009670
488 Ga0070680_100000603
489 Ga0070680_100198215
490 Ga0070660_100199792
491 Ga0070689_100399508
492 Ga0070692_10277844
493 Ga0070671_100172603
494 Ga0070673_100337646
495 Ga0070709_10061378
496 Ga0070709_10244634
497 Ga0070709_10443953
498 Ga0070709_10464447
499 Ga0070709_10766051
500 Ga0070714_100001908
501 Ga0070714_100063751
502 Ga0070714_100881835
503 Ga0070714_101458614
504 Ga0070713_100011727
505 Ga0070713_100132066
506 Ga0070713_100601533
507 Ga0070713_101608213
508 Ga0070711_100426981
509 Ga0070705_100170341
510 Ga0070705_100674494
511 Ga0070705_101486522
512 Ga0070700_100453247
513 Ga0070694_100410674
514 Ga0070681_10046224
515 Ga0070681_10160739
516 Ga0070681_11593091
517 Ga0070685_10480816
518 Ga0070699_100027033
519 Ga0070679_100120246
520 Ga0070679_100184126
521 Ga0070679_100345135
522 Ga0070684_100277082
523 Ga0070697_100276259
524 Ga0070695_100049912
525 Ga0070695_101277678
526 Ga0070696_100001883
527 Ga0068855_100024061
528 Ga0068855_100038633
529 Ga0070664_101087429
530 Ga0068854_100114737
531 Ga0068856_100184532
532 Ga0068856_100189223
533 Ga0068856_100456820
534 Ga0068856_101035113
535 Ga0068856_101992983
536 Ga0068852_100048861
537 Ga0068852_100050835
538 Ga0068852_102202267
539 Ga0068866_10235562
540 Ga0068863_100035022
541 Ga0068863_101068604
542 Ga0068858_100030759
543 Ga0068858_101247028
544 Ga0068860_101908758
545 Ga0068862_100350422
546 Ga0070717_10002621
547 Ga0070717_10103727
548 Ga0070717_10279654
549 Ga0070717_10756918
550 Ga0070715_10146348
551 Ga0070716_100194761
552 Ga0070712_100095993
553 Ga0070712_100849383
554 Ga0070712_101876381
555 Ga0097621_100029509
556 Ga0097621_100433861
557 Ga0068871_100087229
558 Ga0068871_100964856
559 Ga0068871_101150931
560 Ga0075428_100168551
561 Ga0075428_100399889
562 Ga0075430_100050546
563 Ga0075431_100198110
564 Ga0075433_10016015
565 Ga0075433_10159072
566 Ga0075433_11175871
567 Ga0075436_100003331
568 Ga0075436_100180882
569 Ga0075435_100456843
570 Ga0075435_100763751
571 Ga0099794_10433860
572 Ga0105240_10031207
573 Ga0105240_10163378
574 Ga0105240_10570922
575 Ga0111539_10011240
576 Ga0111539_13103335
577 Ga0111539_13145430
578 Ga0105245_10000501
579 Ga0105245_10072049
580 Ga0105245_10225039
581 Ga0105245_10591440
582 Ga0105245_10824453
583 Ga0105247_10166487
584 Ga0105247_10236213
585 Ga0114129_10023067
586 Ga0114129_10898538
587 Ga0105243_10574921
588 Ga0105241_10576064
589 Ga0105241_11035355
590 Ga0105241_11238113
591 Ga0105242_10404006
592 Ga0105242_10546737
593 Ga0105242_10895880
594 Ga0105242_11203657
595 Ga0105242_12166584
596 Ga0105248_10044279
597 Ga0105248_10145027
598 Ga0105248_10235956
599 Ga0105248_10250000
600 Ga0105248_11593356
601 Ga0105248_11856636
602 Ga0105237_10081667
603 Ga0105238_11091683
604 Ga0105239_10020563
605 Ga0105239_10030843
606 Ga0105239_10193328
607 Ga0157370_10002048
608 Ga0157370_10486579
609 Ga0157369_10000788
610 Ga0157374_10012700
611 Ga0157378_10002472
612 Ga0157378_11306239
613 Ga0157378_11605539
614 Ga0163162_10038360
615 Ga0163162_10230624
616 Ga0157372_10009195
617 Ga0157372_10155957
618 Ga0157372_10670139
619 Ga0157372_11124616
620 Ga0157375_10007704
621 Ga0163163_10011408
622 Ga0163163_10806810
623 Ga0163163_10879691
624 Ga0157380_10244657
625 Ga0157380_10316503
626 Ga0157379_10284555
627 Ga0157376_10084913
628 Ga0157376_10239159
629 Ga0157376_10917177
630 Ga0197907_10563520
631 Ga0206349_1509274
632 Ga0206350_10435844
633 Ga0213875_10119264
634 Ga0213875_10159338
635 Ga0224712_10108607
636 Ga0228598_1001759
637 Ga0207710_10248223
638 Ga0207699_10057535
639 Ga0207699_10177842
640 Ga0207699_10387609
641 Ga0207705_10015894
642 Ga0207705_10090709
643 Ga0207705_10212891
644 Ga0207707_10181674
645 Ga0207695_10032470
646 Ga0207695_10506704
647 Ga0207671_10035863
648 Ga0207671_10042114
649 Ga0207693_10110278
650 Ga0207693_10679346
651 Ga0207663_10093681
652 Ga0207663_10320540
653 Ga0207663_10765390
654 Ga0207663_11561146
655 Ga0207660_10003403
656 Ga0207657_10003341
657 Ga0207657_10275665
658 Ga0207652_10250272
659 Ga0207652_10875744
660 Ga0207646_10591176
661 Ga0207687_10001669
662 Ga0207687_11013600
663 Ga0207687_11088688
664 Ga0207700_10147949
665 Ga0207700_10196703
666 Ga0207700_10352590
667 Ga0207700_10533985
668 Ga0207700_11310583
669 Ga0207700_11586014
670 Ga0207664_10012309
671 Ga0207664_10057964
672 Ga0207644_10153233
673 Ga0207686_11382142
674 Ga0207665_10146174
675 Ga0207665_10474169
676 Ga0207711_10043563
677 Ga0207711_10200507
678 Ga0207711_10475664
679 Ga0207689_10201164
680 Ga0207689_10584039
681 Ga0207661_10035835
682 Ga0207679_11206677
683 Ga0207667_10023206
684 Ga0207640_10028460
685 Ga0207640_10122309
686 Ga0207702_10211982
687 Ga0207702_10419884
688 Ga0207641_10166418
689 Ga0207676_10518739
690 Ga0207676_11460229
691 Ga0207674_10951073
692 Ga0207675_100624989
693 Ga0207698_10124993
694 Ga0207698_10202704
695 Ga0268265_11887978
696 Ga0265334_10252615
697 Ga0265338_10574128
698 Ga0265338_10869448
699 Ga0265762_1005136
700 Ga0265325_10035636
701 Ga0265325_10113208
702 Ga0265325_10212198
703 Ga0265340_10131625
704 Ga0265339_10096843
705 Ga0265339_10282086
706 Ga0265331_10003105
707 Ga0265331_10268934
708 Ga0265316_10075159
709 Ga0265316_10461069
710 Ga0265316_10670263
711 Ga0265313_10000259
712 Ga0265313_10236092
713 Ga0265314_10015752
714 Ga0265314_10135923
715 Ga0265342_10026347
716 Ga0265342_10380503
717 Ga0373938_0225860
718 Ga0373926_0019784
719 Ga0373926_0092318
720 Ga0373934_0000656
721 Ga0373934_0151513
722 Ga0373944_0252394
723 Ga0373923_0001824
724 Ga0373923_0005032
725 Ga0373936_0327904
726 Ga0373945_0014744
727 Ga0373945_0217378
728 Ga0373953_0199182
729 Ga0373954_0012984
730 Ga0373954_0031742
731 Ga0373954_0034146
732 Ga0373954_0114708
733 Ga0373954_0343217
734 Ga0373956_0147682
735 Ga0373956_0225208
736 Ga0373956_0566471
737 Ga0373957_0282973
738 Ga0373943_0006447
739 Ga0373943_0011369
740 Ga0373943_0327242
741 Ga0373946_0115002
742 Ga0373946_0326708
743 Ga0373955_0162595
744 Ga0373955_0215221
745 Ga0373955_0270929
746 Ga0373924_0050738
747 Ga0373935_0004015
748 Ga0373935_0026368
749 Ga0373935_0088172
750 Ga0373935_0199219
751 Ga0373935_0383555
752 Ga0373927_0000410
753 Ga0373927_0005229
754 Ga0373927_0005901
755 Ga0373927_0009485
756 Ga0373927_0010048
757 Ga0373927_0139764
758 Ga0373927_0348297
759 Ga0373927_0750373
760 Ga0373927_1185450
761 Ga0373933_0069145
762 Ga0373933_0111916
763 Ga0373933_0251647
764 Ga0373947_0003516
765 Ga0373947_0011522
766 Ga0373947_0031310
767 Ga0373947_0527239
768 Ga0373947_0915290
769 Ga0373937_0012037
770 Ga0373937_0073351
771 Ga0373937_0073957
772 Ga0373937_0158444
773 Ga0373937_0235027
774 Ga0373937_0312244
775 Ga0373937_0638623
776 Ga0373937_1357646
777 Ga0373925_0000290
778 Ga0373925_0004817
779 Ga0373925_0025869
780 Ga0373925_0343060
781 Ga0373925_0372926
782 Ga0373925_0684695
783 Ga0395900_0883894
784 Ga0395898_0089682
785 Ga0436364_0461246
786 Ga0436364_0946456
787 Ga0436364_1048407
788 Ga0436364_1092360
789 Ga0436364_1250532
790 Ga0436365_0663636
791 Ga0436365_1876346
792 Ga0436360_1311870
793 Ga0436363_0201106
794 Ga0436363_0493904
795 Ga0436363_1061344
796 Ga0450917_016348
797 Ga0450890_092136
798 Ga0451577_0120995
799 Ga0451577_0219187
800 Ga0451577_0808030
801 Ga0453683_0157299
802 Ga0451576_0430726
803 Ga0451576_0466924
804 Ga0451576_1812754
805 Ga0466958_0967663
806 Ga0466967_0592799
807 Ga0466967_1740688
808 Ga0495592_0039188
809 Ga0495592_0043786
810 Ga0495592_0158504
811 Ga0495629_0054082
812 Ga0495651_0001906
813 Ga0495651_0039165
814 Ga0495651_0045342
815 Ga0495651_0058987
816 Ga0495651_0491892
817 Ga0495651_0743873
818 Ga0495653_0005284
819 Ga0495653_0454744
820 Ga0495580_0002265
821 Ga0495580_0044153
822 Ga0495580_0069147
823 Ga0495580_0263535
824 Ga0495580_0283450
825 Ga0495580_0376448
826 Ga0495580_0418882
827 Ga0495580_0491574
828 Ga0495580_0560571
829 Ga0495662_0026801
830 Ga0495664_0092050
831 Ga0495594_0161047
832 Ga0495608_0020160
833 Ga0495608_0667937
834 Ga0495618_0161778
835 Ga0495618_0355772
836 Ga0495618_0444288
837 Ga0495618_0566146
838 Ga0495628_0012711
839 Ga0495628_0131916
840 Ga0495630_0040898
841 Ga0495630_0052245
842 Ga0495630_0193938
843 Ga0495630_0330284
844 Ga0495630_0438181
845 Ga0495630_1111444
846 Ga0495666_0003968
847 Ga0495666_0110838
848 Ga0495666_0269893
849 Ga0495652_0140828
850 Ga0495652_0146357
851 Ga0495652_0237432
852 Ga0495665_0031846
853 Ga0495665_0319895
854 Ga0495665_0598459
855 Ga0495640_0062685
856 Ga0495586_0003683
857 Ga0495586_0086599
858 Ga0495587_0056827
859 Ga0495587_0239969
860 Ga0495645_0023494
861 Ga0495645_0042582
862 Ga0495645_0082080
863 Ga0495645_0167026
864 Ga0495645_0482112
865 Ga0495645_0689152
866 Ga0495633_0343793
867 Ga0495667_0004299
868 Ga0495667_0029256
869 Ga0495667_0032513
870 Ga0495667_0049740
871 Ga0495667_0070849
872 Ga0495667_0078849
873 Ga0495667_0167401
874 Ga0495634_0045796
875 Ga0495634_0122575
876 Ga0495634_0219619
877 Ga0495635_0009348
878 Ga0495635_0037528
879 Ga0495657_0041948
880 Ga0495657_0110219
881 Ga0495657_0287373
882 Ga0495657_0872299
883 Ga0495599_0014337
884 Ga0495599_0644148
885 Ga0495623_0006759
886 Ga0495623_0204439
887 Ga0495646_0006733
888 Ga0495646_0039170
889 Ga0495646_0075434
890 Ga0495613_0046020
891 Ga0495613_0059308
892 Ga0495613_0437744
893 Ga0495613_0497501
894 Ga0495624_0013022
895 Ga0495624_0227421
896 Ga0495624_0785521
897 Ga0495600_0025281
898 Ga0495600_0121314
899 Ga0495604_0018389
900 Ga0495604_0031465
901 Ga0495604_0075390
902 Ga0495604_0184066
903 Ga0495636_0169796
904 Ga0495674_0015030
905 Ga0495674_0027312
906 Ga0495674_0197606
907 Ga0495674_0342929
908 Ga0495680_0003254
909 Ga0495680_0154546
910 Ga0495680_0244342
911 Ga0495675_0005288
912 Ga0495675_0162787
913 Ga0495675_0170807
914 Ga0495675_0196932
915 Ga0495675_0299096
916 Ga0495675_0319644
917 Ga0495684_0000853
918 Ga0495684_0012266
919 Ga0495684_0018374
920 Ga0495684_0195217
921 Ga0495684_0734605
922 Ga0495593_0004005
923 Ga0495602_0042312
924 Ga0495602_0072230
925 Ga0495602_0086806
926 Ga0495602_0538273
927 Ga0495602_0587672
928 Ga0495614_0002924
929 Ga0495614_0070525
930 Ga0496100_1517398
931 Ga0496104_0278341
932 Ga0496108_0804783
933 Ga0496109_0737597
934 Ga0496112_0904099
935 Ga0496115_0046160
936 Ga0501299_135011
937 Ga0501047_0123918
938 Ga0501070_0037888
939 Ga0501208_106951
940 Ga0501210_036691
941 Ga0501044_0007708
942 Ga0501044_0008607
943 nmdc:mga0qj67_1364825_c1
944 nmdc:mga06r32_97580_c1
945 nmdc:mga06r32_97711_c1
946 nmdc:mga0rr50_319968_c1
947 nmdc:mga0rr50_995544_c1
948 nmdc:mga08x19_1002106_c1
949 nmdc:mga08x19_1749_c1
950 nmdc:mga08x19_814734_c1
951 nmdc:mga0a205_794470_c1
952 Ga0495601_0052670
953 Ga0495601_0220499
954 Ga0495601_1039129
955 Ga0495612_0007769
956 Ga0495595_0202638
957 Ga0587073_0068022
958 Ga0587067_005530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

63

143

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.9472 1 131
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.9403 1 131
3bey-assembly1.cif.gz_A crystal structure of the protein o27018 from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt217 0.9189 39 122
3bey-assembly1.cif.gz_F crystal structure of the protein o27018 from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt217 0.8791 39 123
2qeu-assembly1.cif.gz_B crystal structure of putative carboxymuconolactone decarboxylase (yp_555818.1) from burkholderia xenovorans lb400 at 1.65 a resolution 0.8767 16 111
ID Description Score Start End Superfamily
2ouwA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9393 1 131 1.20.1290.10
2ouwA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9323 1 131 1.20.1290.10
af_A0F081_38_194_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9118 30 101 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8937 35 104 1.20.1290.10
af_Q4CNP1_460_605_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8812 22 93 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A382DCX8-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9946 6 129 GO:0051920
AF-A0A3N1M8B8-F1-model_v4 AhpD family alkylhydroperoxidase 0.9935 4 129 GO:0051920
AF-A0A4Q4CUE4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9926 4 129 GO:0051920
AF-C6K8C8-F1-model_v4 Alkylhydroperoxidase D-like superfamily protein 0.9914 1 128 GO:0051920
AF-A0A3C1N5R4-F1-model_v4 Alkylhydroperoxidase 0.9905 5 95 GO:0051920

Map