F452005

General Info

Members Datasets Scaffolds Average Seq Length
479 277 958 260

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100017917|Ga0070706_1000179177
Length 294
Sequence MSEMPRASAAGRPVRLAASLDGPRRGPVVVLGNSLGTTREIWDPQLLALGDGFRLLRYEHRGHGGSPAPPGPYAIADLAADVLRLLDDFGVERASYCGISLGGMIGMWLAAHVPDRIDVLSLCCTSAYLPPAQGWADRAARVRRAGLASISGPVVGRWFTPAFRDRNPAIPAAFTTALEGIDPEGYAGCCEAIAAMDLRGSLAAITAPTLVISGAEDPSTPPWHGAVIAQGIRNSRLTVVRGAAHLANVSAPGEITAVLRTHLVTAPMAGRAGSPAGSRAIDLPGPQPIRPAAR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
276 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
277 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.25
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0.21
Rhizoplane 6.89
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100017917 3300005467 Bacteria 6533
2 JGI24034J26672_10001269 3300002239 Bacteria 3318
3 JGI25406J46586_10021050 3300003203 Bacteria 2624
4 Ga0070658_10019937 3300005327 Bacteria 5372
5 Ga0070658_10022167 3300005327 Bacteria 5095
6 Ga0070676_10006246 3300005328 Bacteria 6363
7 Ga0070683_100108967 3300005329 Bacteria 2612
8 Ga0070683_100299644 3300005329 Bacteria 1529
9 Ga0070690_100006535 3300005330 Bacteria 6617
10 Ga0070666_10019555 3300005335 Bacteria 4373
11 Ga0070680_100012295 3300005336 Bacteria 6647
12 Ga0070680_100094381 3300005336 Bacteria 2480
13 Ga0070682_100001519 3300005337 Bacteria 12993
14 Ga0070682_100033394 3300005337 Bacteria 3126
15 Ga0068868_100000203 3300005338 Bacteria 40057
16 Ga0070660_100081934 3300005339 Bacteria 2533
17 Ga0070689_100031738 3300005340 Bacteria 4015
18 Ga0070691_10007079 3300005341 Bacteria 5142
19 Ga0070668_100021204 3300005347 Bacteria 4911
20 Ga0070669_100044324 3300005353 Bacteria 3241
21 Ga0070675_100234082 3300005354 Bacteria 1603
22 Ga0070674_100000244 3300005356 Bacteria 26961
23 Ga0070688_100003038 3300005365 Bacteria 8564
24 Ga0070659_100016301 3300005366 Bacteria 5578
25 Ga0070659_100516743 3300005366 Bacteria 1019
26 Ga0070667_100008301 3300005367 Bacteria 8609
27 Ga0070709_10000165 3300005434 Bacteria 41860
28 Ga0070709_10003216 3300005434 Bacteria 8774
29 Ga0070709_10005449 3300005434 Bacteria 6891
30 Ga0070709_10012896 3300005434 Bacteria 4684
31 Ga0070709_10025527 3300005434 Bacteria 3492
32 Ga0070714_100000318 3300005435 Bacteria 36459
33 Ga0070714_100011260 3300005435 Bacteria 7091
34 Ga0070714_100012989 3300005435 Bacteria 6661
35 Ga0070714_100022867 3300005435 Bacteria 5130
36 Ga0070714_100051657 3300005435 Bacteria 3506
37 Ga0070714_100094358 3300005435 Bacteria 2626
38 Ga0070714_100413635 3300005435 Bacteria 1277
39 Ga0070713_100001888 3300005436 Bacteria 13519
40 Ga0070713_100010893 3300005436 Bacteria 6593
41 Ga0070713_100061697 3300005436 Bacteria 3137
42 Ga0070713_100150665 3300005436 Bacteria 2069
43 Ga0070713_100179182 3300005436 Bacteria 1903
44 Ga0070713_100193903 3300005436 Bacteria 1832
45 Ga0070713_100232556 3300005436 Bacteria 1676
46 Ga0070713_100622112 3300005436 Bacteria 1027
47 Ga0070710_10000171 3300005437 Bacteria 29726
48 Ga0070710_10000808 3300005437 Bacteria 15022
49 Ga0070710_10007573 3300005437 Bacteria 5260
50 Ga0070710_10027442 3300005437 Bacteria 3036
51 Ga0070701_10000310 3300005438 Bacteria 15901
52 Ga0070711_100000158 3300005439 Bacteria 36681
53 Ga0070711_100002396 3300005439 Bacteria 10681
54 Ga0070711_100002700 3300005439 Bacteria 10178
55 Ga0070705_100025252 3300005440 Bacteria 3219
56 Ga0070700_100029092 3300005441 Bacteria 3291
57 Ga0070694_100214765 3300005444 Bacteria 1440
58 Ga0070708_100001234 3300005445 Bacteria 19676
59 Ga0070708_100044212 3300005445 Bacteria 3916
60 Ga0070663_100136580 3300005455 Bacteria 1868
61 Ga0070678_100000855 3300005456 Bacteria 15524
62 Ga0070662_100000713 3300005457 Bacteria 20417
63 Ga0070662_100551485 3300005457 Unclassified 966
64 Ga0070681_10037581 3300005458 Bacteria 4858
65 Ga0070681_10159134 3300005458 Bacteria 2182
66 Ga0068867_100001211 3300005459 Bacteria 17725
67 Ga0068867_100210355 3300005459 Bacteria 1562
68 Ga0070685_10161295 3300005466 Bacteria 1429
69 Ga0070706_100001732 3300005467 Bacteria 22598
70 Ga0070706_100002363 3300005467 Bacteria 19041
71 Ga0070706_100185068 3300005467 Bacteria 1946
72 Ga0070707_100000043 3300005468 Bacteria 108893
73 Ga0070707_100002621 3300005468 Bacteria 17098
74 Ga0070707_100020775 3300005468 Bacteria 6198
75 Ga0070698_100000072 3300005471 Bacteria 75715
76 Ga0070698_100000309 3300005471 Bacteria 49509
77 Ga0070698_100024152 3300005471 Bacteria 6343
78 Ga0070698_100090368 3300005471 Bacteria 3046
79 Ga0070699_100002102 3300005518 Bacteria 18041
80 Ga0070679_100306830 3300005530 Bacteria 1537
81 Ga0070684_100035955 3300005535 Bacteria 4242
82 Ga0070684_100141988 3300005535 Bacteria 2171
83 Ga0070697_100016026 3300005536 Bacteria 5893
84 Ga0070697_100369587 3300005536 Bacteria 1241
85 Ga0068853_100009677 3300005539 Bacteria 7770
86 Ga0070695_100022701 3300005545 Bacteria 3851
87 Ga0070696_100008077 3300005546 Bacteria 7035
88 Ga0070696_100093657 3300005546 Bacteria 2143
89 Ga0070693_100009763 3300005547 Bacteria 4783
90 Ga0070665_100015960 3300005548 Bacteria 7539
91 Ga0070704_100000392 3300005549 Bacteria 20077
92 Ga0070704_100054933 3300005549 Bacteria 2821
93 Ga0068855_100295168 3300005563 Bacteria 1796
94 Ga0068854_100000262 3300005578 Bacteria 35841
95 Ga0068856_100025977 3300005614 Bacteria 5711
96 Ga0068856_100080348 3300005614 Bacteria 3234
97 Ga0068856_100317326 3300005614 Bacteria 1576
98 Ga0068856_100318296 3300005614 Bacteria 1573
99 Ga0070702_100002314 3300005615 Bacteria 8175
100 Ga0068859_100002266 3300005617 Bacteria 19509
101 Ga0068866_10000490 3300005718 Bacteria 18191
102 Ga0068861_100011691 3300005719 Bacteria 6107
103 Ga0068858_100001689 3300005842 Bacteria 22563
104 Ga0068860_100001255 3300005843 Bacteria 27661
105 Ga0068862_100001317 3300005844 Bacteria 23074
106 Ga0081455_10011091 3300005937 Bacteria 9073
107 Ga0081538_10000730 3300005981 Bacteria 35887
108 Ga0081538_10004866 3300005981 Bacteria 12230
109 Ga0081539_10000538 3300005985 Bacteria 78469
110 Ga0070717_10008406 3300006028 Bacteria 7709
111 Ga0070717_10016274 3300006028 Bacteria 5764
112 Ga0070717_10023098 3300006028 Bacteria 4923
113 Ga0070717_10042228 3300006028 Bacteria 3719
114 Ga0070717_10212112 3300006028 Bacteria 1700
115 Ga0070717_10650589 3300006028 Unclassified 957
116 Ga0075364_10004140 3300006051 Bacteria 8311
117 Ga0075432_10089710 3300006058 Bacteria 1124
118 Ga0070715_10001049 3300006163 Bacteria 7805
119 Ga0070715_10001287 3300006163 Bacteria 7186
120 Ga0070715_10018897 3300006163 Bacteria 2634
121 Ga0070716_100000117 3300006173 Bacteria 31350
122 Ga0070716_100001640 3300006173 Bacteria 10102
123 Ga0070716_100015500 3300006173 Bacteria 3917
124 Ga0070712_100000698 3300006175 Bacteria 19829
125 Ga0070712_100001225 3300006175 Bacteria 15514
126 Ga0070712_100006582 3300006175 Bacteria 7216
127 Ga0070712_100096319 3300006175 Bacteria 2179
128 Ga0070712_100134801 3300006175 Bacteria 1876
129 Ga0070712_100421842 3300006175 Bacteria 1106
130 Ga0075369_10091742 3300006186 Bacteria 1356
131 Ga0097621_100154820 3300006237 Bacteria 1967
132 Ga0075433_10024255 3300006852 Bacteria 5117
133 Ga0075433_10061285 3300006852 Bacteria 3295
134 Ga0075434_100039179 3300006871 Bacteria 4696
135 Ga0075434_100050704 3300006871 Bacteria 4123
136 Ga0075434_100200698 3300006871 Bacteria 2014
137 Ga0075429_100030262 3300006880 Bacteria 4703
138 Ga0068865_100000770 3300006881 Bacteria 17965
139 Ga0075436_100073124 3300006914 Bacteria 2372
140 Ga0097620_100002267 3300006931 Bacteria 19509
141 Ga0075435_100007169 3300007076 Bacteria 7928
142 Ga0075435_100054421 3300007076 Bacteria 3229
143 Ga0075435_100096047 3300007076 Bacteria 2451
144 Ga0105250_10019490 3300009092 Bacteria 2742
145 Ga0105240_10647368 3300009093 Bacteria 1159
146 Ga0111539_10408621 3300009094 Bacteria 1581
147 Ga0105245_10001005 3300009098 Bacteria 25622
148 Ga0105247_10000372 3300009101 Bacteria 38190
149 Ga0105243_10000676 3300009148 Bacteria 33249
150 Ga0105242_10000197 3300009176 Bacteria 46948
151 Ga0105248_10003464 3300009177 Bacteria 17524
152 Ga0105237_10118872 3300009545 Bacteria 2637
153 Ga0105249_10003186 3300009553 Bacteria 14200
154 Ga0105239_10004408 3300010375 Bacteria 16853
155 Ga0157370_10067693 3300013104 Bacteria 3375
156 Ga0157369_10006748 3300013105 Bacteria 13245
157 Ga0157369_10034167 3300013105 Bacteria 5583
158 Ga0157369_10046415 3300013105 Bacteria 4721
159 Ga0157369_10645190 3300013105 Bacteria 1092
160 Ga0157378_10002544 3300013297 Bacteria 16230
161 Ga0163162_10002808 3300013306 Bacteria 16565
162 Ga0157372_10005085 3300013307 Bacteria 13986
163 Ga0157372_10504596 3300013307 Bacteria 1410
164 Ga0157375_10001551 3300013308 Bacteria 19772
165 Ga0163163_10221649 3300014325 Bacteria 1940
166 Ga0157380_10000136 3300014326 Bacteria 41118
167 Ga0157377_10079174 3300014745 Bacteria 1917
168 Ga0157379_10002115 3300014968 Bacteria 16461
169 Ga0157376_10070127 3300014969 Bacteria 2974
170 Ga0163161_10005634 3300017792 Bacteria 8685
171 Ga0163161_10278574 3300017792 Bacteria 1311
172 Ga0206356_11168948 3300020070 Bacteria 1719
173 Ga0206356_11487722 3300020070 Bacteria 2343
174 Ga0206353_11923273 3300020082 Bacteria 3064
175 Ga0213875_10000817 3300021388 Bacteria 23214
176 Ga0224712_10013565 3300022467 Bacteria 2598
177 Ga0224712_10026352 3300022467 Bacteria 2054
178 Ga0207692_10000417 3300025898 Bacteria 14917
179 Ga0207692_10005044 3300025898 Bacteria 5260
180 Ga0207692_10022718 3300025898 Bacteria 2890
181 Ga0207642_10000178 3300025899 Bacteria 18339
182 Ga0207710_10006215 3300025900 Bacteria 5112
183 Ga0207688_10009202 3300025901 Bacteria 5381
184 Ga0207680_10012186 3300025903 Bacteria 4373
185 Ga0207647_10096437 3300025904 Bacteria 1760
186 Ga0207647_10186087 3300025904 Bacteria 1205
187 Ga0207685_10003329 3300025905 Bacteria 3892
188 Ga0207685_10003609 3300025905 Bacteria 3791
189 Ga0207699_10000393 3300025906 Bacteria 22711
190 Ga0207699_10000854 3300025906 Bacteria 14497
191 Ga0207699_10001661 3300025906 Bacteria 10552
192 Ga0207699_10002903 3300025906 Bacteria 8139
193 Ga0207699_10003503 3300025906 Bacteria 7488
194 Ga0207699_10007938 3300025906 Bacteria 5208
195 Ga0207645_10046459 3300025907 Bacteria 2774
196 Ga0207705_10011510 3300025909 Bacteria 6399
197 Ga0207705_10132952 3300025909 Bacteria 1853
198 Ga0207684_10003204 3300025910 Bacteria 16068
199 Ga0207684_10008554 3300025910 Bacteria 9102
200 Ga0207684_10060092 3300025910 Bacteria 3228
201 Ga0207684_10156788 3300025910 Bacteria 1959
202 Ga0207684_10285696 3300025910 Bacteria 1423
203 Ga0207654_10062127 3300025911 Bacteria 2187
204 Ga0207707_10036030 3300025912 Bacteria 4326
205 Ga0207707_10406957 3300025912 Bacteria 1167
206 Ga0207695_10538284 3300025913 Bacteria 1049
207 Ga0207671_10033421 3300025914 Bacteria 3826
208 Ga0207693_10000436 3300025915 Bacteria 38097
209 Ga0207693_10000507 3300025915 Bacteria 35136
210 Ga0207693_10011505 3300025915 Bacteria 7156
211 Ga0207693_10056016 3300025915 Bacteria 3091
212 Ga0207693_10111901 3300025915 Bacteria 2141
213 Ga0207663_10000849 3300025916 Bacteria 13884
214 Ga0207663_10003570 3300025916 Bacteria 7634
215 Ga0207663_10044809 3300025916 Bacteria 2717
216 Ga0207663_10107356 3300025916 Bacteria 1888
217 Ga0207652_10019624 3300025921 Bacteria 5563
218 Ga0207652_10043512 3300025921 Bacteria 3823
219 Ga0207646_10000300 3300025922 Bacteria 67365
220 Ga0207646_10000647 3300025922 Bacteria 45144
221 Ga0207681_10044224 3300025923 Bacteria 2984
222 Ga0207687_10003137 3300025927 Bacteria 11208
223 Ga0207700_10000029 3300025928 Bacteria 132615
224 Ga0207700_10003974 3300025928 Bacteria 8653
225 Ga0207700_10004029 3300025928 Bacteria 8601
226 Ga0207700_10020046 3300025928 Bacteria 4531
227 Ga0207700_10049570 3300025928 Bacteria 3124
228 Ga0207700_10061899 3300025928 Bacteria 2840
229 Ga0207700_10121963 3300025928 Bacteria 2115
230 Ga0207700_10585060 3300025928 Bacteria 993
231 Ga0207664_10000110 3300025929 Bacteria 72637
232 Ga0207664_10006206 3300025929 Bacteria 8207
233 Ga0207664_10006511 3300025929 Bacteria 8038
234 Ga0207664_10006716 3300025929 Bacteria 7942
235 Ga0207664_10010166 3300025929 Bacteria 6641
236 Ga0207664_10055023 3300025929 Bacteria 3156
237 Ga0207664_10055048 3300025929 Bacteria 3155
238 Ga0207664_10126315 3300025929 Bacteria 2148
239 Ga0207664_10367032 3300025929 Bacteria 1276
240 Ga0207664_10374845 3300025929 Bacteria 1262
241 Ga0207644_10222852 3300025931 Bacteria 1496
242 Ga0207690_10041318 3300025932 Bacteria 3021
243 Ga0207690_10115504 3300025932 Bacteria 1940
244 Ga0207706_10001533 3300025933 Bacteria 22933
245 Ga0207706_10394446 3300025933 Bacteria 1200
246 Ga0207709_10025987 3300025935 Bacteria 3359
247 Ga0207670_10003859 3300025936 Bacteria 7989
248 Ga0207669_10030780 3300025937 Bacteria 2987
249 Ga0207704_10008956 3300025938 Bacteria 4810
250 Ga0207665_10000373 3300025939 Bacteria 31019
251 Ga0207665_10000801 3300025939 Bacteria 21278
252 Ga0207665_10001870 3300025939 Bacteria 14190
253 Ga0207665_10007035 3300025939 Bacteria 7450
254 Ga0207665_10132554 3300025939 Bacteria 1771
255 Ga0207711_10011004 3300025941 Bacteria 7517
256 Ga0207661_10002029 3300025944 Bacteria 13962
257 Ga0207661_10294639 3300025944 Bacteria 1453
258 Ga0207661_10675630 3300025944 Bacteria 949
259 Ga0207679_10165174 3300025945 Bacteria 1817
260 Ga0207667_10075468 3300025949 Bacteria 3501
261 Ga0207667_10327252 3300025949 Bacteria 1565
262 Ga0207712_10003191 3300025961 Bacteria 10430
263 Ga0207668_10001538 3300025972 Bacteria 13494
264 Ga0207640_10000827 3300025981 Bacteria 17626
265 Ga0207658_10008136 3300025986 Bacteria 7143
266 Ga0207677_10008246 3300026023 Bacteria 5807
267 Ga0207703_10000920 3300026035 Bacteria 28669
268 Ga0207639_10032434 3300026041 Bacteria 3845
269 Ga0207678_10011888 3300026067 Bacteria 7644
270 Ga0207708_10010331 3300026075 Bacteria 6931
271 Ga0207702_10017807 3300026078 Bacteria 5881
272 Ga0207702_10183337 3300026078 Bacteria 1929
273 Ga0207702_10493675 3300026078 Bacteria 1193
274 Ga0207648_10000929 3300026089 Bacteria 33018
275 Ga0207648_10224146 3300026089 Bacteria 1671
276 Ga0207675_100000544 3300026118 Bacteria 36830
277 Ga0207675_100015044 3300026118 Bacteria 7219
278 Ga0207675_100379710 3300026118 Bacteria 1389
279 Ga0207683_10000335 3300026121 Bacteria 42789
280 Ga0207683_10193352 3300026121 Bacteria 1848
281 Ga0207698_10667019 3300026142 Bacteria 1032
282 Ga0207428_10035182 3300027907 Bacteria 4096
283 Ga0268266_10028987 3300028379 Bacteria 4704
284 Ga0268266_10075054 3300028379 Bacteria 2937
285 Ga0268265_10009821 3300028380 Bacteria 6459
286 Ga0268264_10001041 3300028381 Bacteria 27858
287 Ga0265319_1001850 3300028563 Bacteria 12060
288 Ga0265318_10005487 3300028577 Bacteria 5952
289 Ga0265336_10014517 3300028666 Bacteria 2609
290 Ga0265338_10006264 3300028800 Bacteria 15225
291 Ga0265338_10118336 3300028800 Bacteria 2117
292 Ga0265338_10185814 3300028800 Bacteria 1580
293 Ga0265324_10003291 3300029957 Bacteria 7765
294 Ga0265320_10001741 3300031240 Bacteria 15447
295 Ga0265325_10036261 3300031241 Bacteria 2614
296 Ga0265325_10054396 3300031241 Bacteria 2049
297 Ga0265340_10053543 3300031247 Bacteria 1949
298 Ga0307408_100030456 3300031548 Bacteria 3748
299 Ga0307405_10076639 3300031731 Bacteria 2170
300 Ga0373930_0021630 3300034816 Bacteria 1265
301 Ga0373950_0018999 3300034818 Bacteria 1197
302 Ga0373940_0010606 3300035088 Bacteria 2171
303 Ga0373949_0009621 3300035090 Bacteria 2116
304 Ga0373923_0012276 3300035111 Bacteria 3161
305 Ga0373939_0005170 3300035114 Bacteria 3103
306 Ga0373941_0032277 3300035115 Bacteria 1566
307 Ga0373945_0013174 3300035116 Bacteria 2756
308 Ga0373945_0182696 3300035116 Bacteria 864
309 Ga0373954_0015943 3300035118 Bacteria 3361
310 Ga0373956_0009373 3300035119 Bacteria 3982
311 Ga0373957_0005535 3300035120 Bacteria 3918
312 Ga0373946_0009800 3300035171 Bacteria 3537
313 Ga0373946_0049159 3300035171 Bacteria 1758
314 Ga0373955_0094690 3300035172 Bacteria 1707
315 Ga0373942_0078508 3300035207 Bacteria 976
316 Ga0373961_0006074 3300035241 Bacteria 2901
317 Ga0373931_0018319 3300035691 Bacteria 3481
318 Ga0373931_0151480 3300035691 Bacteria 1352
319 Ga0373935_0002441 3300035692 Bacteria 10636
320 Ga0373935_0099592 3300035692 Bacteria 1914
321 Ga0373935_0354526 3300035692 Bacteria 1046
322 Ga0373933_0003208 3300035724 Bacteria 9128
323 Ga0373947_0112156 3300035725 Bacteria 1724
324 Ga0373937_0513438 3300036401 Bacteria 1138
325 Ga0372808_005321 3300036459 Bacteria 1691
326 Ga0373925_0000186 3300037068 Bacteria 68187
327 Ga0373925_0056446 3300037068 Bacteria 2941
328 Ga0373925_0654756 3300037068 Bacteria 866
329 Ga0395898_0140094 3300037466 Bacteria 2315
330 Ga0436364_0207639 3300037853 Bacteria 28695
331 Ga0436364_0776180 3300037853 Bacteria 4416
332 Ga0451795_0668183 3300041456 Bacteria 1358
333 Ga0466958_0138444 3300045836 Bacteria 1532
334 Ga0466967_0189827 3300045976 Bacteria 1941
335 Ga0495592_0038437 3300046454 Bacteria 3601
336 Ga0495629_0014811 3300046459 Bacteria 5608
337 Ga0495629_0015914 3300046459 Bacteria 5403
338 Ga0495641_0022013 3300046461 Bacteria 3197
339 Ga0495651_0010744 3300046462 Bacteria 7039
340 Ga0495651_0045738 3300046462 Bacteria 3390
341 Ga0495651_0401009 3300046462 Bacteria 895
342 Ga0495653_0006031 3300046463 Bacteria 9924
343 Ga0495580_0012366 3300046472 Bacteria 6548
344 Ga0495582_0003282 3300046473 Bacteria 9087
345 Ga0495639_0033993 3300046475 Bacteria 2279
346 Ga0495639_0092498 3300046475 Bacteria 1420
347 Ga0495662_0005357 3300046476 Bacteria 6420
348 Ga0495662_0033089 3300046476 Bacteria 2498
349 Ga0495664_0052111 3300046477 Bacteria 2430
350 Ga0495608_0033646 3300046511 Bacteria 3461
351 Ga0495608_0044692 3300046511 Bacteria 2955
352 Ga0495608_0162699 3300046511 Bacteria 1418
353 Ga0495618_0014687 3300046514 Bacteria 4775
354 Ga0495618_0027293 3300046514 Bacteria 3555
355 Ga0495618_0030210 3300046514 Bacteria 3383
356 Ga0495618_0054568 3300046514 Bacteria 2529
357 Ga0495628_0005834 3300046516 Bacteria 10788
358 Ga0495628_0053318 3300046516 Bacteria 3191
359 Ga0495630_0011057 3300046517 Bacteria 6529
360 Ga0495652_0013473 3300046529 Bacteria 7360
361 Ga0495652_0018458 3300046529 Bacteria 6216
362 Ga0495665_0007796 3300046531 Bacteria 5793
363 Ga0495665_0013248 3300046531 Bacteria 4459
364 Ga0495665_0129294 3300046531 Bacteria 1322
365 Ga0495640_0034727 3300046533 Bacteria 3571
366 Ga0495640_0119523 3300046533 Bacteria 1714
367 Ga0495586_0010031 3300046535 Bacteria 5044
368 Ga0495586_0118896 3300046535 Bacteria 1475
369 Ga0495645_0014271 3300046543 Bacteria 5633
370 Ga0495645_0015569 3300046543 Bacteria 5410
371 Ga0495645_0035901 3300046543 Bacteria 3614
372 Ga0495645_0040339 3300046543 Bacteria 3406
373 Ga0495645_0169104 3300046543 Bacteria 1505
374 Ga0495667_0000669 3300046559 Bacteria 21922
375 Ga0495667_0036966 3300046559 Bacteria 3256
376 Ga0495634_0020326 3300046642 Bacteria 4710
377 Ga0495635_0005405 3300046663 Bacteria 8883
378 Ga0495635_0008259 3300046663 Bacteria 7267
379 Ga0495635_0030865 3300046663 Bacteria 3722
380 Ga0495657_0008265 3300046675 Bacteria 7973
381 Ga0495599_0011222 3300046678 Bacteria 5502
382 Ga0495599_0013304 3300046678 Bacteria 5086
383 Ga0495599_0123754 3300046678 Bacteria 1607
384 Ga0495623_0080409 3300046679 Bacteria 2017
385 Ga0495646_0014058 3300046680 Bacteria 5089
386 Ga0495646_0047816 3300046680 Bacteria 2602
387 Ga0495646_0082442 3300046680 Bacteria 1871
388 Ga0495646_0284192 3300046680 Bacteria 878
389 Ga0495658_0009052 3300046683 Bacteria 4950
390 Ga0495658_0021294 3300046683 Bacteria 3417
391 Ga0495658_0023037 3300046683 Bacteria 3302
392 Ga0495613_0015491 3300046689 Bacteria 5669
393 Ga0495624_0022542 3300046690 Bacteria 4160
394 Ga0495600_0006714 3300046809 Bacteria 7013
395 Ga0495581_0007236 3300047315 Bacteria 6420
396 Ga0495604_0023495 3300047317 Bacteria 4918
397 Ga0495674_0009969 3300047319 Bacteria 9006
398 Ga0495674_0042962 3300047319 Bacteria 4027
399 Ga0495676_0067632 3300047321 Bacteria 2763
400 Ga0495680_0001355 3300047322 Bacteria 26607
401 Ga0495680_0006442 3300047322 Bacteria 10909
402 Ga0495680_0040707 3300047322 Bacteria 3700
403 Ga0495675_0006594 3300047444 Bacteria 7107
404 Ga0495675_0049332 3300047444 Bacteria 2676
405 Ga0495684_0019718 3300047471 Bacteria 5196
406 Ga0495684_0069496 3300047471 Bacteria 2678
407 Ga0495684_0194715 3300047471 Bacteria 1497
408 Ga0495593_0007342 3300047673 Bacteria 6453
409 Ga0495593_0010087 3300047673 Bacteria 5467
410 Ga0495602_0012865 3300048088 Bacteria 8577
411 Ga0495614_0044467 3300048089 Bacteria 1905
412 Ga0496100_0000383 3300048903 Bacteria 21527
413 Ga0496101_0015817 3300048904 Bacteria 5091
414 Ga0496101_0048231 3300048904 Bacteria 3060
415 Ga0496101_0231524 3300048904 Bacteria 1436
416 Ga0496102_0003043 3300048905 Bacteria 14207
417 Ga0496102_0075254 3300048905 Bacteria 3104
418 Ga0496103_0001173 3300048906 Bacteria 18017
419 Ga0496103_0171849 3300048906 Bacteria 1392
420 Ga0496104_0004060 3300048907 Bacteria 12694
421 Ga0496105_0002764 3300048908 Bacteria 12815
422 Ga0496105_0085406 3300048908 Bacteria 2607
423 Ga0496106_0000615 3300048909 Bacteria 25459
424 Ga0496106_0032656 3300048909 Bacteria 3882
425 Ga0496106_0359817 3300048909 Bacteria 1169
426 Ga0496107_0001171 3300048910 Bacteria 15903
427 Ga0496108_0012275 3300048911 Bacteria 6968
428 Ga0496108_0365223 3300048911 Bacteria 1260
429 Ga0496109_0013300 3300048912 Bacteria 7130
430 Ga0496109_0180566 3300048912 Bacteria 1982
431 Ga0496110_0022288 3300048913 Bacteria 5377
432 Ga0496112_0019413 3300048915 Bacteria 6416
433 Ga0496112_0127601 3300048915 Bacteria 2514
434 Ga0496112_0213456 3300048915 Bacteria 1887
435 Ga0496113_0054905 3300048916 Bacteria 2984
436 Ga0496113_0280310 3300048916 Bacteria 1333
437 Ga0496114_0000517 3300048917 Bacteria 28403
438 Ga0496114_0020996 3300048917 Bacteria 5305
439 Ga0496114_0441824 3300048917 Bacteria 1152
440 Ga0496115_0002572 3300048918 Bacteria 13028
441 Ga0496115_0022808 3300048918 Bacteria 4853
442 Ga0496115_0036854 3300048918 Bacteria 3873
443 Ga0496115_0071692 3300048918 Bacteria 2810
444 Ga0496119_0010545 3300048922 Bacteria 7760
445 Ga0496126_0013912 3300048929 Bacteria 8163
446 Ga0501036_0043907 3300049572 Bacteria 3785
447 Ga0501047_0000744 3300049581 Bacteria 33946
448 Ga0501047_0337804 3300049581 Bacteria 1344
449 Ga0501048_0121687 3300049582 Bacteria 1844
450 Ga0501068_0016165 3300049584 Bacteria 4299
451 Ga0501070_0364101 3300049586 Bacteria 1173
452 Ga0501072_0039279 3300049588 Bacteria 3716
453 Ga0501077_0312659 3300049593 Bacteria 1001
454 Ga0501079_0043753 3300049741 Bacteria 3457
455 Ga0501080_0098475 3300049742 Bacteria 2714
456 Ga0501045_0538405 3300049824 Bacteria 866
457 nmdc:mga00v17_7094_c2 3300050491 Bacteria 5683
458 nmdc:mga05p37_172666_c1 3300050507 Bacteria 2636
459 nmdc:mga08y16_566419_c1 3300050511 Bacteria 1148
460 nmdc:mga0n895_103219_c1 3300050512 Bacteria 2863
461 nmdc:mga0n895_159955_c1 3300050512 Bacteria 2284
462 nmdc:mga0rr50_33338_c1 3300050513 Bacteria 3678
463 nmdc:mga0rr50_62340_c1 3300050513 Bacteria 2813
464 nmdc:mga08x19_23217_c1 3300050514 Bacteria 3847
465 nmdc:mga0a205_12356_c1 3300050515 Bacteria 7898
466 nmdc:mga0a205_30481_c1 3300050515 Bacteria 5165
467 nmdc:mga0a205_81920_c1 3300050515 Bacteria 3117
468 Ga0495601_0213425 3300053077 Bacteria 1261
469 Ga0495612_0015960 3300053078 Bacteria 3009
470 Ga0495612_0096658 3300053078 Bacteria 1255
471 Ga0495595_0026376 3300053084 Bacteria 2581
472 Ga0495619_0006835 3300053085 Bacteria 7211
473 Ga0495619_0068652 3300053085 Bacteria 2368
474 Ga0495619_0215301 3300053085 Bacteria 1330
475 Ga0501084_0062090 3300054114 Bacteria 3128
476 Ga0530510_0067691 3300061734 Bacteria 2590
477 2676486738 2675903059 Bacteria 8644972
478 2842137125 2842134933 Bacteria 5847019
479 2902814764 2902810491 Bacteria 6794147
480 Ga0070706_100017917
481 JGI24034J26672_10001269
482 JGI25406J46586_10021050
483 Ga0070658_10019937
484 Ga0070658_10022167
485 Ga0070676_10006246
486 Ga0070683_100108967
487 Ga0070683_100299644
488 Ga0070690_100006535
489 Ga0070666_10019555
490 Ga0070680_100012295
491 Ga0070680_100094381
492 Ga0070682_100001519
493 Ga0070682_100033394
494 Ga0068868_100000203
495 Ga0070660_100081934
496 Ga0070689_100031738
497 Ga0070691_10007079
498 Ga0070668_100021204
499 Ga0070669_100044324
500 Ga0070675_100234082
501 Ga0070674_100000244
502 Ga0070688_100003038
503 Ga0070659_100016301
504 Ga0070659_100516743
505 Ga0070667_100008301
506 Ga0070709_10000165
507 Ga0070709_10003216
508 Ga0070709_10005449
509 Ga0070709_10012896
510 Ga0070709_10025527
511 Ga0070714_100000318
512 Ga0070714_100011260
513 Ga0070714_100012989
514 Ga0070714_100022867
515 Ga0070714_100051657
516 Ga0070714_100094358
517 Ga0070714_100413635
518 Ga0070713_100001888
519 Ga0070713_100010893
520 Ga0070713_100061697
521 Ga0070713_100150665
522 Ga0070713_100179182
523 Ga0070713_100193903
524 Ga0070713_100232556
525 Ga0070713_100622112
526 Ga0070710_10000171
527 Ga0070710_10000808
528 Ga0070710_10007573
529 Ga0070710_10027442
530 Ga0070701_10000310
531 Ga0070711_100000158
532 Ga0070711_100002396
533 Ga0070711_100002700
534 Ga0070705_100025252
535 Ga0070700_100029092
536 Ga0070694_100214765
537 Ga0070708_100001234
538 Ga0070708_100044212
539 Ga0070663_100136580
540 Ga0070678_100000855
541 Ga0070662_100000713
542 Ga0070662_100551485
543 Ga0070681_10037581
544 Ga0070681_10159134
545 Ga0068867_100001211
546 Ga0068867_100210355
547 Ga0070685_10161295
548 Ga0070706_100001732
549 Ga0070706_100002363
550 Ga0070706_100185068
551 Ga0070707_100000043
552 Ga0070707_100002621
553 Ga0070707_100020775
554 Ga0070698_100000072
555 Ga0070698_100000309
556 Ga0070698_100024152
557 Ga0070698_100090368
558 Ga0070699_100002102
559 Ga0070679_100306830
560 Ga0070684_100035955
561 Ga0070684_100141988
562 Ga0070697_100016026
563 Ga0070697_100369587
564 Ga0068853_100009677
565 Ga0070695_100022701
566 Ga0070696_100008077
567 Ga0070696_100093657
568 Ga0070693_100009763
569 Ga0070665_100015960
570 Ga0070704_100000392
571 Ga0070704_100054933
572 Ga0068855_100295168
573 Ga0068854_100000262
574 Ga0068856_100025977
575 Ga0068856_100080348
576 Ga0068856_100317326
577 Ga0068856_100318296
578 Ga0070702_100002314
579 Ga0068859_100002266
580 Ga0068866_10000490
581 Ga0068861_100011691
582 Ga0068858_100001689
583 Ga0068860_100001255
584 Ga0068862_100001317
585 Ga0081455_10011091
586 Ga0081538_10000730
587 Ga0081538_10004866
588 Ga0081539_10000538
589 Ga0070717_10008406
590 Ga0070717_10016274
591 Ga0070717_10023098
592 Ga0070717_10042228
593 Ga0070717_10212112
594 Ga0070717_10650589
595 Ga0075364_10004140
596 Ga0075432_10089710
597 Ga0070715_10001049
598 Ga0070715_10001287
599 Ga0070715_10018897
600 Ga0070716_100000117
601 Ga0070716_100001640
602 Ga0070716_100015500
603 Ga0070712_100000698
604 Ga0070712_100001225
605 Ga0070712_100006582
606 Ga0070712_100096319
607 Ga0070712_100134801
608 Ga0070712_100421842
609 Ga0075369_10091742
610 Ga0097621_100154820
611 Ga0075433_10024255
612 Ga0075433_10061285
613 Ga0075434_100039179
614 Ga0075434_100050704
615 Ga0075434_100200698
616 Ga0075429_100030262
617 Ga0068865_100000770
618 Ga0075436_100073124
619 Ga0097620_100002267
620 Ga0075435_100007169
621 Ga0075435_100054421
622 Ga0075435_100096047
623 Ga0105250_10019490
624 Ga0105240_10647368
625 Ga0111539_10408621
626 Ga0105245_10001005
627 Ga0105247_10000372
628 Ga0105243_10000676
629 Ga0105242_10000197
630 Ga0105248_10003464
631 Ga0105237_10118872
632 Ga0105249_10003186
633 Ga0105239_10004408
634 Ga0157370_10067693
635 Ga0157369_10006748
636 Ga0157369_10034167
637 Ga0157369_10046415
638 Ga0157369_10645190
639 Ga0157378_10002544
640 Ga0163162_10002808
641 Ga0157372_10005085
642 Ga0157372_10504596
643 Ga0157375_10001551
644 Ga0163163_10221649
645 Ga0157380_10000136
646 Ga0157377_10079174
647 Ga0157379_10002115
648 Ga0157376_10070127
649 Ga0163161_10005634
650 Ga0163161_10278574
651 Ga0206356_11168948
652 Ga0206356_11487722
653 Ga0206353_11923273
654 Ga0213875_10000817
655 Ga0224712_10013565
656 Ga0224712_10026352
657 Ga0207692_10000417
658 Ga0207692_10005044
659 Ga0207692_10022718
660 Ga0207642_10000178
661 Ga0207710_10006215
662 Ga0207688_10009202
663 Ga0207680_10012186
664 Ga0207647_10096437
665 Ga0207647_10186087
666 Ga0207685_10003329
667 Ga0207685_10003609
668 Ga0207699_10000393
669 Ga0207699_10000854
670 Ga0207699_10001661
671 Ga0207699_10002903
672 Ga0207699_10003503
673 Ga0207699_10007938
674 Ga0207645_10046459
675 Ga0207705_10011510
676 Ga0207705_10132952
677 Ga0207684_10003204
678 Ga0207684_10008554
679 Ga0207684_10060092
680 Ga0207684_10156788
681 Ga0207684_10285696
682 Ga0207654_10062127
683 Ga0207707_10036030
684 Ga0207707_10406957
685 Ga0207695_10538284
686 Ga0207671_10033421
687 Ga0207693_10000436
688 Ga0207693_10000507
689 Ga0207693_10011505
690 Ga0207693_10056016
691 Ga0207693_10111901
692 Ga0207663_10000849
693 Ga0207663_10003570
694 Ga0207663_10044809
695 Ga0207663_10107356
696 Ga0207652_10019624
697 Ga0207652_10043512
698 Ga0207646_10000300
699 Ga0207646_10000647
700 Ga0207681_10044224
701 Ga0207687_10003137
702 Ga0207700_10000029
703 Ga0207700_10003974
704 Ga0207700_10004029
705 Ga0207700_10020046
706 Ga0207700_10049570
707 Ga0207700_10061899
708 Ga0207700_10121963
709 Ga0207700_10585060
710 Ga0207664_10000110
711 Ga0207664_10006206
712 Ga0207664_10006511
713 Ga0207664_10006716
714 Ga0207664_10010166
715 Ga0207664_10055023
716 Ga0207664_10055048
717 Ga0207664_10126315
718 Ga0207664_10367032
719 Ga0207664_10374845
720 Ga0207644_10222852
721 Ga0207690_10041318
722 Ga0207690_10115504
723 Ga0207706_10001533
724 Ga0207706_10394446
725 Ga0207709_10025987
726 Ga0207670_10003859
727 Ga0207669_10030780
728 Ga0207704_10008956
729 Ga0207665_10000373
730 Ga0207665_10000801
731 Ga0207665_10001870
732 Ga0207665_10007035
733 Ga0207665_10132554
734 Ga0207711_10011004
735 Ga0207661_10002029
736 Ga0207661_10294639
737 Ga0207661_10675630
738 Ga0207679_10165174
739 Ga0207667_10075468
740 Ga0207667_10327252
741 Ga0207712_10003191
742 Ga0207668_10001538
743 Ga0207640_10000827
744 Ga0207658_10008136
745 Ga0207677_10008246
746 Ga0207703_10000920
747 Ga0207639_10032434
748 Ga0207678_10011888
749 Ga0207708_10010331
750 Ga0207702_10017807
751 Ga0207702_10183337
752 Ga0207702_10493675
753 Ga0207648_10000929
754 Ga0207648_10224146
755 Ga0207675_100000544
756 Ga0207675_100015044
757 Ga0207675_100379710
758 Ga0207683_10000335
759 Ga0207683_10193352
760 Ga0207698_10667019
761 Ga0207428_10035182
762 Ga0268266_10028987
763 Ga0268266_10075054
764 Ga0268265_10009821
765 Ga0268264_10001041
766 Ga0265319_1001850
767 Ga0265318_10005487
768 Ga0265336_10014517
769 Ga0265338_10006264
770 Ga0265338_10118336
771 Ga0265338_10185814
772 Ga0265324_10003291
773 Ga0265320_10001741
774 Ga0265325_10036261
775 Ga0265325_10054396
776 Ga0265340_10053543
777 Ga0307408_100030456
778 Ga0307405_10076639
779 Ga0373930_0021630
780 Ga0373950_0018999
781 Ga0373940_0010606
782 Ga0373949_0009621
783 Ga0373923_0012276
784 Ga0373939_0005170
785 Ga0373941_0032277
786 Ga0373945_0013174
787 Ga0373945_0182696
788 Ga0373954_0015943
789 Ga0373956_0009373
790 Ga0373957_0005535
791 Ga0373946_0009800
792 Ga0373946_0049159
793 Ga0373955_0094690
794 Ga0373942_0078508
795 Ga0373961_0006074
796 Ga0373931_0018319
797 Ga0373931_0151480
798 Ga0373935_0002441
799 Ga0373935_0099592
800 Ga0373935_0354526
801 Ga0373933_0003208
802 Ga0373947_0112156
803 Ga0373937_0513438
804 Ga0372808_005321
805 Ga0373925_0000186
806 Ga0373925_0056446
807 Ga0373925_0654756
808 Ga0395898_0140094
809 Ga0436364_0207639
810 Ga0436364_0776180
811 Ga0451795_0668183
812 Ga0466958_0138444
813 Ga0466967_0189827
814 Ga0495592_0038437
815 Ga0495629_0014811
816 Ga0495629_0015914
817 Ga0495641_0022013
818 Ga0495651_0010744
819 Ga0495651_0045738
820 Ga0495651_0401009
821 Ga0495653_0006031
822 Ga0495580_0012366
823 Ga0495582_0003282
824 Ga0495639_0033993
825 Ga0495639_0092498
826 Ga0495662_0005357
827 Ga0495662_0033089
828 Ga0495664_0052111
829 Ga0495608_0033646
830 Ga0495608_0044692
831 Ga0495608_0162699
832 Ga0495618_0014687
833 Ga0495618_0027293
834 Ga0495618_0030210
835 Ga0495618_0054568
836 Ga0495628_0005834
837 Ga0495628_0053318
838 Ga0495630_0011057
839 Ga0495652_0013473
840 Ga0495652_0018458
841 Ga0495665_0007796
842 Ga0495665_0013248
843 Ga0495665_0129294
844 Ga0495640_0034727
845 Ga0495640_0119523
846 Ga0495586_0010031
847 Ga0495586_0118896
848 Ga0495645_0014271
849 Ga0495645_0015569
850 Ga0495645_0035901
851 Ga0495645_0040339
852 Ga0495645_0169104
853 Ga0495667_0000669
854 Ga0495667_0036966
855 Ga0495634_0020326
856 Ga0495635_0005405
857 Ga0495635_0008259
858 Ga0495635_0030865
859 Ga0495657_0008265
860 Ga0495599_0011222
861 Ga0495599_0013304
862 Ga0495599_0123754
863 Ga0495623_0080409
864 Ga0495646_0014058
865 Ga0495646_0047816
866 Ga0495646_0082442
867 Ga0495646_0284192
868 Ga0495658_0009052
869 Ga0495658_0021294
870 Ga0495658_0023037
871 Ga0495613_0015491
872 Ga0495624_0022542
873 Ga0495600_0006714
874 Ga0495581_0007236
875 Ga0495604_0023495
876 Ga0495674_0009969
877 Ga0495674_0042962
878 Ga0495676_0067632
879 Ga0495680_0001355
880 Ga0495680_0006442
881 Ga0495680_0040707
882 Ga0495675_0006594
883 Ga0495675_0049332
884 Ga0495684_0019718
885 Ga0495684_0069496
886 Ga0495684_0194715
887 Ga0495593_0007342
888 Ga0495593_0010087
889 Ga0495602_0012865
890 Ga0495614_0044467
891 Ga0496100_0000383
892 Ga0496101_0015817
893 Ga0496101_0048231
894 Ga0496101_0231524
895 Ga0496102_0003043
896 Ga0496102_0075254
897 Ga0496103_0001173
898 Ga0496103_0171849
899 Ga0496104_0004060
900 Ga0496105_0002764
901 Ga0496105_0085406
902 Ga0496106_0000615
903 Ga0496106_0032656
904 Ga0496106_0359817
905 Ga0496107_0001171
906 Ga0496108_0012275
907 Ga0496108_0365223
908 Ga0496109_0013300
909 Ga0496109_0180566
910 Ga0496110_0022288
911 Ga0496112_0019413
912 Ga0496112_0127601
913 Ga0496112_0213456
914 Ga0496113_0054905
915 Ga0496113_0280310
916 Ga0496114_0000517
917 Ga0496114_0020996
918 Ga0496114_0441824
919 Ga0496115_0002572
920 Ga0496115_0022808
921 Ga0496115_0036854
922 Ga0496115_0071692
923 Ga0496119_0010545
924 Ga0496126_0013912
925 Ga0501036_0043907
926 Ga0501047_0000744
927 Ga0501047_0337804
928 Ga0501048_0121687
929 Ga0501068_0016165
930 Ga0501070_0364101
931 Ga0501072_0039279
932 Ga0501077_0312659
933 Ga0501079_0043753
934 Ga0501080_0098475
935 Ga0501045_0538405
936 nmdc:mga00v17_7094_c2
937 nmdc:mga05p37_172666_c1
938 nmdc:mga08y16_566419_c1
939 nmdc:mga0n895_103219_c1
940 nmdc:mga0n895_159955_c1
941 nmdc:mga0rr50_33338_c1
942 nmdc:mga0rr50_62340_c1
943 nmdc:mga08x19_23217_c1
944 nmdc:mga0a205_12356_c1
945 nmdc:mga0a205_30481_c1
946 nmdc:mga0a205_81920_c1
947 Ga0495601_0213425
948 Ga0495612_0015960
949 Ga0495612_0096658
950 Ga0495595_0026376
951 Ga0495619_0006835
952 Ga0495619_0068652
953 Ga0495619_0215301
954 Ga0501084_0062090
955 Ga0530510_0067691
956 2676486738
957 2842137125
958 2902814764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

27

252

0.91

PF08386

Abhydrolase_4

TAP-like protein

192

274

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

48

247

0.72

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

28

258

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9792 3 252
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9639 3 252
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9519 3 252
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.9481 3 250
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9373 3 252
ID Description Score Start End Superfamily
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9685 3 252 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9542 3 252 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9499 3 112 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9474 3 250 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9347 3 252 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1G6W3E4-F1-model_v4 3-oxoadipate enol-lactonase 0.9884 1 253
AF-A0A2D7Z661-F1-model_v4 3-oxoadipate enol-lactonase 0.9831 3 205 GO:0016020
GO:0042952
GO:0047570
AF-A0A2E5KLY8-F1-model_v4 3-oxoadipate enol-lactonase 0.9792 3 251
AF-A0A2Z4GHL9-F1-model_v4 3-oxoadipate enol-lactonase 0.9783 1 253 GO:0016020
GO:0042952
GO:0047570
AF-A0A2N5C326-F1-model_v4 AraC family transcriptional regulator 0.9778 3 250 GO:0042952
GO:0047570
GO:0051920

Map