F451955

General Info

Members Datasets Scaffolds Average Seq Length
478 214 956 274

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0055562|Ga0501072_0055562_1845_2816
Length 323
Sequence MNEIPKFAKNITGNCRVQGIFRYKQPFLLNLIKFNFYGKTWSRCCFIPVKISALIFPMKTLPEEIEAYRDRKWRREESRKVETAQQVEEMVDDLGFCLGLTDSRKGLPSVYIAVCGRRDAHMPRNVQKDPEASTAWVLKDEVIARGKVYYAKLVKGHSMFLAPRLVPYFNAIWGVPKTREKDELSENARKVLKVLRKEWEMATSDLRAECGFKDKTDLTKAIDELQKKMKVVPQEVVYVPKFTYIWTLAEGRFPKELAKKVSREEAVRELGRCFLELNGVTLLGDYSRAFGFQRWESGRANHQLVDEGFAERLATGIYQIKNL

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
173 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
174 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
175 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
181 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
182 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
183 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
184 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
185 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
189 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
190 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
191 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
192 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
193 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
194 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
197 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
198 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
199 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
200 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
201 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
204 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.88
Rhizosphere 97.07
Stem 0
Stem Tuber 0
Unclassified 27.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0055562 3300049588 Bacteria 3120
2 CNAas_1000004 3300000532 Bacteria 14982
3 JGI24751J29686_10000149 3300002459 Bacteria 33687
4 JGI25406J46586_10006263 3300003203 Bacteria 5491
5 Ga0065704_10030111 3300005289 Unclassified 1034
6 Ga0065704_10076278 3300005289 Bacteria 5191
7 Ga0065704_10088125 3300005289 Bacteria 2955
8 Ga0065712_10068069 3300005290 Bacteria 15521
9 Ga0065715_10003931 3300005293 Bacteria 5174
10 Ga0065715_10117164 3300005293 Bacteria 2353
11 Ga0065707_10021573 3300005295 Bacteria 1164
12 Ga0065707_10120340 3300005295 Bacteria 2137
13 Ga0070683_100528077 3300005329 Unclassified 1128
14 Ga0070690_100005733 3300005330 Bacteria 6994
15 Ga0070670_100001746 3300005331 Bacteria 17701
16 Ga0070670_100043788 3300005331 Bacteria 3847
17 Ga0070670_100072231 3300005331 Bacteria 2963
18 Ga0070670_100077570 3300005331 Bacteria 2854
19 Ga0070670_100148477 3300005331 Unclassified 2029
20 Ga0070670_100392685 3300005331 Unclassified 1224
21 Ga0068869_100002890 3300005334 Bacteria 10436
22 Ga0068869_100029150 3300005334 Bacteria 3864
23 Ga0068869_100057441 3300005334 Bacteria 2841
24 Ga0068869_100148876 3300005334 Bacteria 1814
25 Ga0070666_10051622 3300005335 Bacteria 2770
26 Ga0070666_10226922 3300005335 Bacteria 1318
27 Ga0070682_100000059 3300005337 Bacteria 106643
28 Ga0070682_100012254 3300005337 Bacteria 4910
29 Ga0068868_100420637 3300005338 Unclassified 1157
30 Ga0070689_100002993 3300005340 Bacteria 11113
31 Ga0070689_100005950 3300005340 Bacteria 8392
32 Ga0070689_100381342 3300005340 Bacteria 1188
33 Ga0070687_100011185 3300005343 Bacteria 3915
34 Ga0070692_10010290 3300005345 Bacteria 4251
35 Ga0070669_100001404 3300005353 Bacteria 17383
36 Ga0070669_100002230 3300005353 Bacteria 14029
37 Ga0070669_100010477 3300005353 Bacteria 6584
38 Ga0070671_100059321 3300005355 Bacteria 3184
39 Ga0070673_100011870 3300005364 Bacteria 5963
40 Ga0070673_100012429 3300005364 Bacteria 5844
41 Ga0070673_100141823 3300005364 Unclassified 2027
42 Ga0070659_100137027 3300005366 Bacteria 1991
43 Ga0070667_100015749 3300005367 Bacteria 6252
44 Ga0070703_10002189 3300005406 Bacteria 5684
45 Ga0070701_10076159 3300005438 Bacteria 1805
46 Ga0070705_100004752 3300005440 Bacteria 6613
47 Ga0070705_100033871 3300005440 Bacteria 2851
48 Ga0070700_100006690 3300005441 Bacteria 6173
49 Ga0070700_100063767 3300005441 Bacteria 2331
50 Ga0070700_100101446 3300005441 Bacteria 1896
51 Ga0070694_100043726 3300005444 Bacteria 2996
52 Ga0070694_100145064 3300005444 Unclassified 1728
53 Ga0070694_100440196 3300005444 Unclassified 1027
54 Ga0070708_100022495 3300005445 Bacteria 5348
55 Ga0070708_100285452 3300005445 Bacteria 1553
56 Ga0070663_100043978 3300005455 Bacteria 3146
57 Ga0070678_100374819 3300005456 Bacteria 1230
58 Ga0070662_100104904 3300005457 Bacteria 2145
59 Ga0070662_100319924 3300005457 Unclassified 1265
60 Ga0070662_100344650 3300005457 Bacteria 1219
61 Ga0070681_10044627 3300005458 Unclassified 4438
62 Ga0070681_10072586 3300005458 Unclassified 3404
63 Ga0070681_10082510 3300005458 Unclassified 3170
64 Ga0068867_100283029 3300005459 Viruses 1360
65 Ga0070685_10094845 3300005466 Bacteria 1813
66 Ga0070706_100000088 3300005467 Bacteria 107818
67 Ga0070706_100007621 3300005467 Bacteria 10129
68 Ga0070706_100707494 3300005467 Unclassified 934
69 Ga0070707_100150924 3300005468 Bacteria 2263
70 Ga0070698_100001851 3300005471 Bacteria 23556
71 Ga0070698_100009237 3300005471 Bacteria 10577
72 Ga0070698_100323483 3300005471 Bacteria 1473
73 Ga0070699_100017437 3300005518 Bacteria 6164
74 Ga0070699_100022230 3300005518 Bacteria 5464
75 Ga0070697_100000018 3300005536 Bacteria 140702
76 Ga0070697_100146970 3300005536 Bacteria 1985
77 Ga0070697_100178522 3300005536 Unclassified 1799
78 Ga0070697_100201927 3300005536 Unclassified 1690
79 Ga0068853_100002129 3300005539 Bacteria 14734
80 Ga0070672_100069224 3300005543 Bacteria 2801
81 Ga0070686_100089706 3300005544 Bacteria 2054
82 Ga0070695_100020677 3300005545 Bacteria 4020
83 Ga0070695_100138259 3300005545 Bacteria 1686
84 Ga0070696_100109787 3300005546 Unclassified 1985
85 Ga0070696_100122021 3300005546 Bacteria 1887
86 Ga0070696_100180968 3300005546 Bacteria 1564
87 Ga0070693_100005407 3300005547 Bacteria 6128
88 Ga0070693_100111607 3300005547 Unclassified 1683
89 Ga0070704_100048995 3300005549 Bacteria 2960
90 Ga0068855_100275197 3300005563 Unclassified 1871
91 Ga0070664_100073428 3300005564 Bacteria 2935
92 Ga0070664_100124366 3300005564 Bacteria 2261
93 Ga0070664_100672297 3300005564 Bacteria 963
94 Ga0068857_100026779 3300005577 Bacteria 5084
95 Ga0068857_100255394 3300005577 Bacteria 1607
96 Ga0068857_100372139 3300005577 Unclassified 1325
97 Ga0068854_100115209 3300005578 Bacteria 2033
98 Ga0068854_100306364 3300005578 Bacteria 1287
99 Ga0070702_100016131 3300005615 Bacteria 3827
100 Ga0070702_100023312 3300005615 Bacteria 3287
101 Ga0070702_100054425 3300005615 Bacteria 2302
102 Ga0070702_100138263 3300005615 Bacteria 1548
103 Ga0068852_100132570 3300005616 Bacteria 2296
104 Ga0068859_100002739 3300005617 Bacteria 17881
105 Ga0068859_100079033 3300005617 Unclassified 3329
106 Ga0068859_100113258 3300005617 Bacteria 2776
107 Ga0068859_100288925 3300005617 Bacteria 1732
108 Ga0068859_100295937 3300005617 Bacteria 1712
109 Ga0068859_100297388 3300005617 Unclassified 1707
110 Ga0068859_100361531 3300005617 Bacteria 1547
111 Ga0068859_100411487 3300005617 Unclassified 1448
112 Ga0068859_100825918 3300005617 Unclassified 1013
113 Ga0068864_100009377 3300005618 Bacteria 8075
114 Ga0068864_100081449 3300005618 Bacteria 2838
115 Ga0068864_100158598 3300005618 Unclassified 2055
116 Ga0068864_100247397 3300005618 Bacteria 1654
117 Ga0068866_10208892 3300005718 Unclassified 1171
118 Ga0068861_100017567 3300005719 Bacteria 5082
119 Ga0068861_100091327 3300005719 Bacteria 2404
120 Ga0068861_100521502 3300005719 Bacteria 1078
121 Ga0068870_10180853 3300005840 Bacteria 1266
122 Ga0068870_10198835 3300005840 Bacteria 1214
123 Ga0068863_100048525 3300005841 Unclassified 4026
124 Ga0068863_100366412 3300005841 Unclassified 1405
125 Ga0068858_100140903 3300005842 Bacteria 2264
126 Ga0068858_100143581 3300005842 Bacteria 2241
127 Ga0068858_100149577 3300005842 Bacteria 2195
128 Ga0068858_100173651 3300005842 Bacteria 2033
129 Ga0068858_100216036 3300005842 Bacteria 1815
130 Ga0068858_100304109 3300005842 Unclassified 1522
131 Ga0068860_100030469 3300005843 Bacteria 5188
132 Ga0068860_100045947 3300005843 Bacteria 4165
133 Ga0068860_100061516 3300005843 Bacteria 3567
134 Ga0068860_100111309 3300005843 Bacteria 2618
135 Ga0068860_100157253 3300005843 Bacteria 2191
136 Ga0068860_100249471 3300005843 Unclassified 1728
137 Ga0068862_100078982 3300005844 Bacteria 2852
138 Ga0068862_100133802 3300005844 Bacteria 2195
139 Ga0068862_100153541 3300005844 Bacteria 2050
140 Ga0081539_10000043 3300005985 Bacteria 288108
141 Ga0081539_10002203 3300005985 Bacteria 28490
142 Ga0097621_100045854 3300006237 Bacteria 3533
143 Ga0097621_100077638 3300006237 Bacteria 2757
144 Ga0097621_100154479 3300006237 Bacteria 1969
145 Ga0075428_100320679 3300006844 Bacteria 1665
146 Ga0075430_100037954 3300006846 Bacteria 4083
147 Ga0075431_100140812 3300006847 Bacteria 2486
148 Ga0075433_10020255 3300006852 Bacteria 5558
149 Ga0075433_10022972 3300006852 Bacteria 5243
150 Ga0075434_100073385 3300006871 Bacteria 3414
151 Ga0075434_100193993 3300006871 Bacteria 2051
152 Ga0075429_100053523 3300006880 Bacteria 3512
153 Ga0075429_100056224 3300006880 Bacteria 3425
154 Ga0068865_100224160 3300006881 Unclassified 1471
155 Ga0097620_100002739 3300006931 Bacteria 17881
156 Ga0097620_100079032 3300006931 Unclassified 3329
157 Ga0097620_100113240 3300006931 Bacteria 2776
158 Ga0097620_100288929 3300006931 Bacteria 1732
159 Ga0097620_100295926 3300006931 Bacteria 1712
160 Ga0097620_100297388 3300006931 Unclassified 1707
161 Ga0097620_100361523 3300006931 Bacteria 1547
162 Ga0097620_100411514 3300006931 Unclassified 1448
163 Ga0097620_100825928 3300006931 Unclassified 1013
164 Ga0075435_100010257 3300007076 Bacteria 6846
165 Ga0105240_10229057 3300009093 Bacteria 2161
166 Ga0105240_10240142 3300009093 Unclassified 2101
167 Ga0105240_10339343 3300009093 Unclassified 1707
168 Ga0111539_10012727 3300009094 Bacteria 10536
169 Ga0111539_10024482 3300009094 Bacteria 7405
170 Ga0111539_10237986 3300009094 Bacteria 2119
171 Ga0105245_10551120 3300009098 Bacteria 1175
172 Ga0105247_10000592 3300009101 Bacteria 29439
173 Ga0114129_10055425 3300009147 Bacteria 5556
174 Ga0114129_10086189 3300009147 Unclassified 4356
175 Ga0114129_10705332 3300009147 Bacteria 1296
176 Ga0105243_10602006 3300009148 Bacteria 1058
177 Ga0105243_10716569 3300009148 Bacteria 977
178 Ga0105241_10081808 3300009174 Bacteria 2530
179 Ga0105241_10154563 3300009174 Unclassified 1880
180 Ga0105241_10245614 3300009174 Unclassified 1515
181 Ga0105242_10092745 3300009176 Bacteria 2545
182 Ga0105242_10120475 3300009176 Bacteria 2251
183 Ga0105242_10215631 3300009176 Bacteria 1713
184 Ga0105242_10349644 3300009176 Unclassified 1365
185 Ga0105248_10004879 3300009177 Bacteria 14830
186 Ga0105248_10006056 3300009177 Bacteria 13274
187 Ga0105248_10019195 3300009177 Bacteria 7563
188 Ga0105248_10144407 3300009177 Bacteria 2685
189 Ga0105248_10334188 3300009177 Unclassified 1706
190 Ga0105248_10359887 3300009177 Bacteria 1638
191 Ga0105248_10507943 3300009177 Unclassified 1359
192 Ga0105237_10008903 3300009545 Bacteria 10815
193 Ga0105237_10015838 3300009545 Bacteria 7842
194 Ga0105238_10013915 3300009551 Bacteria 8138
195 Ga0105238_10027606 3300009551 Bacteria 5785
196 Ga0105249_10007021 3300009553 Bacteria 9829
197 Ga0105249_10009528 3300009553 Bacteria 8509
198 Ga0105249_10022284 3300009553 Bacteria 5674
199 Ga0105249_10023478 3300009553 Bacteria 5535
200 Ga0105249_10055573 3300009553 Bacteria 3622
201 Ga0105249_10332916 3300009553 Bacteria 1533
202 Ga0105249_10549881 3300009553 Unclassified 1205
203 Ga0105239_10172767 3300010375 Bacteria 2417
204 Ga0105246_10046767 3300011119 Unclassified 2953
205 Ga0105246_10064504 3300011119 Bacteria 2559
206 Ga0157373_10002883 3300013100 Bacteria 13006
207 Ga0157373_10008292 3300013100 Bacteria 7720
208 Ga0157370_10188195 3300013104 Bacteria 1916
209 Ga0157378_10213030 3300013297 Unclassified 1833
210 Ga0157378_10254614 3300013297 Bacteria 1682
211 Ga0163162_10002437 3300013306 Bacteria 17536
212 Ga0163162_10012021 3300013306 Bacteria 8441
213 Ga0163162_10123411 3300013306 Bacteria 2695
214 Ga0163162_10160062 3300013306 Bacteria 2373
215 Ga0163162_10226680 3300013306 Bacteria 1998
216 Ga0163162_10342717 3300013306 Unclassified 1627
217 Ga0163162_10692225 3300013306 Bacteria 1141
218 Ga0157372_10001564 3300013307 Bacteria 24928
219 Ga0157372_10037335 3300013307 Bacteria 5358
220 Ga0157372_10097521 3300013307 Bacteria 3353
221 Ga0157372_10577649 3300013307 Unclassified 1310
222 Ga0157375_10024705 3300013308 Bacteria 5567
223 Ga0157375_10066490 3300013308 Bacteria 3599
224 Ga0157375_10163772 3300013308 Unclassified 2368
225 Ga0157375_10757507 3300013308 Bacteria 1122
226 Ga0157375_10901390 3300013308 Unclassified 1028
227 Ga0163163_10000862 3300014325 Bacteria 25852
228 Ga0163163_10029821 3300014325 Bacteria 5249
229 Ga0163163_10176680 3300014325 Bacteria 2182
230 Ga0163163_10285910 3300014325 Bacteria 1701
231 Ga0163163_10650171 3300014325 Unclassified 1118
232 Ga0163163_10829744 3300014325 Bacteria 988
233 Ga0157380_10004388 3300014326 Bacteria 9778
234 Ga0157380_10255811 3300014326 Bacteria 1588
235 Ga0157377_10222413 3300014745 Bacteria 1209
236 Ga0157379_10153894 3300014968 Bacteria 2074
237 Ga0157379_10167591 3300014968 Bacteria 1983
238 Ga0182007_10069023 3300015262 Unclassified 1158
239 Ga0213876_10000102 3300021384 Bacteria 94958
240 Ga0213876_10000277 3300021384 Bacteria 47161
241 Ga0207656_10020864 3300025321 Bacteria 2609
242 Ga0207653_10003394 3300025885 Bacteria 5028
243 Ga0207710_10001166 3300025900 Bacteria 13372
244 Ga0207710_10003077 3300025900 Bacteria 7493
245 Ga0207647_10000385 3300025904 Bacteria 35983
246 Ga0207647_10037013 3300025904 Unclassified 3097
247 Ga0207643_10198389 3300025908 Unclassified 1221
248 Ga0207684_10000131 3300025910 Bacteria 137508
249 Ga0207654_10080054 3300025911 Bacteria 1964
250 Ga0207654_10095706 3300025911 Bacteria 1819
251 Ga0207654_10220267 3300025911 Unclassified 1258
252 Ga0207707_10004243 3300025912 Bacteria 12691
253 Ga0207707_10071747 3300025912 Bacteria 3018
254 Ga0207671_10018785 3300025914 Bacteria 5297
255 Ga0207660_10186717 3300025917 Bacteria 1612
256 Ga0207662_10041903 3300025918 Unclassified 2697
257 Ga0207657_10072188 3300025919 Bacteria 2921
258 Ga0207652_10074357 3300025921 Bacteria 2959
259 Ga0207652_10212329 3300025921 Bacteria 1743
260 Ga0207646_10114880 3300025922 Bacteria 2417
261 Ga0207681_10000710 3300025923 Bacteria 21886
262 Ga0207681_10011902 3300025923 Bacteria 5356
263 Ga0207681_10035068 3300025923 Bacteria 3305
264 Ga0207681_10284530 3300025923 Bacteria 1303
265 Ga0207694_10007934 3300025924 Bacteria 8032
266 Ga0207694_10117357 3300025924 Bacteria 2122
267 Ga0207650_10000005 3300025925 Bacteria 663190
268 Ga0207650_10004505 3300025925 Bacteria 9530
269 Ga0207650_10038364 3300025925 Bacteria 3498
270 Ga0207650_10100360 3300025925 Bacteria 2227
271 Ga0207650_10155763 3300025925 Bacteria 1806
272 Ga0207650_10188170 3300025925 Bacteria 1648
273 Ga0207650_10364609 3300025925 Bacteria 1191
274 Ga0207650_10618101 3300025925 Unclassified 912
275 Ga0207644_10005236 3300025931 Bacteria 8467
276 Ga0207706_10078555 3300025933 Bacteria 2902
277 Ga0207706_10096216 3300025933 Bacteria 2604
278 Ga0207706_10196360 3300025933 Bacteria 1770
279 Ga0207686_10159056 3300025934 Bacteria 1581
280 Ga0207686_10431383 3300025934 Unclassified 1010
281 Ga0207709_10014077 3300025935 Bacteria 4416
282 Ga0207670_10003824 3300025936 Bacteria 8011
283 Ga0207670_10016323 3300025936 Unclassified 4460
284 Ga0207691_10043208 3300025940 Bacteria 4154
285 Ga0207691_10081333 3300025940 Bacteria 2912
286 Ga0207711_10003667 3300025941 Bacteria 13273
287 Ga0207711_10003858 3300025941 Bacteria 12904
288 Ga0207711_10045781 3300025941 Unclassified 3739
289 Ga0207711_10053439 3300025941 Unclassified 3464
290 Ga0207711_10060152 3300025941 Bacteria 3273
291 Ga0207711_10299163 3300025941 Unclassified 1484
292 Ga0207689_10006380 3300025942 Bacteria 10441
293 Ga0207689_10043920 3300025942 Bacteria 3695
294 Ga0207689_10056365 3300025942 Bacteria 3234
295 Ga0207689_10064860 3300025942 Unclassified 3004
296 Ga0207679_10098745 3300025945 Bacteria 2278
297 Ga0207679_10133942 3300025945 Unclassified 1992
298 Ga0207679_10169807 3300025945 Bacteria 1794
299 Ga0207667_10147647 3300025949 Unclassified 2420
300 Ga0207651_10031252 3300025960 Bacteria 3401
301 Ga0207651_10148747 3300025960 Unclassified 1820
302 Ga0207712_10003603 3300025961 Bacteria 9769
303 Ga0207712_10007987 3300025961 Bacteria 6690
304 Ga0207712_10016622 3300025961 Unclassified 4770
305 Ga0207712_10210330 3300025961 Bacteria 1548
306 Ga0207640_10107395 3300025981 Bacteria 1971
307 Ga0207677_10012907 3300026023 Bacteria 4824
308 Ga0207703_10048098 3300026035 Bacteria 3440
309 Ga0207703_10198251 3300026035 Unclassified 1782
310 Ga0207703_10245176 3300026035 Unclassified 1612
311 Ga0207703_10386309 3300026035 Unclassified 1296
312 Ga0207703_10403304 3300026035 Unclassified 1269
313 Ga0207639_10001238 3300026041 Bacteria 17290
314 Ga0207639_10119535 3300026041 Bacteria 2162
315 Ga0207678_10026981 3300026067 Bacteria 5009
316 Ga0207708_10000043 3300026075 Bacteria 121725
317 Ga0207708_10002522 3300026075 Bacteria 13464
318 Ga0207708_10092181 3300026075 Bacteria 2337
319 Ga0207708_10128938 3300026075 Bacteria 1976
320 Ga0207641_10004650 3300026088 Bacteria 11846
321 Ga0207641_10066016 3300026088 Unclassified 3097
322 Ga0207641_10336497 3300026088 Unclassified 1435
323 Ga0207641_10414237 3300026088 Bacteria 1296
324 Ga0207641_10442421 3300026088 Bacteria 1255
325 Ga0207641_10471505 3300026088 Bacteria 1216
326 Ga0207648_10035306 3300026089 Bacteria 4405
327 Ga0207648_10091531 3300026089 Bacteria 2658
328 Ga0207676_10002434 3300026095 Bacteria 13260
329 Ga0207676_10004891 3300026095 Bacteria 9491
330 Ga0207676_10129441 3300026095 Bacteria 2143
331 Ga0207676_10245242 3300026095 Bacteria 1609
332 Ga0207676_10508819 3300026095 Bacteria 1145
333 Ga0207674_10035731 3300026116 Bacteria 5185
334 Ga0207674_10112663 3300026116 Unclassified 2694
335 Ga0207674_10208968 3300026116 Bacteria 1901
336 Ga0207674_10330675 3300026116 Unclassified 1474
337 Ga0207675_100021904 3300026118 Bacteria 5950
338 Ga0207675_100028157 3300026118 Bacteria 5232
339 Ga0207675_100137405 3300026118 Bacteria 2320
340 Ga0207675_100329437 3300026118 Unclassified 1492
341 Ga0207428_10014828 3300027907 Bacteria 6751
342 Ga0207428_10047588 3300027907 Bacteria 3443
343 Ga0268265_10010397 3300028380 Bacteria 6285
344 Ga0268265_10038393 3300028380 Bacteria 3523
345 Ga0268265_10140851 3300028380 Unclassified 2019
346 Ga0268265_10206773 3300028380 Unclassified 1707
347 Ga0268265_10357446 3300028380 Unclassified 1336
348 Ga0268264_10005556 3300028381 Bacteria 10685
349 Ga0268264_10033903 3300028381 Bacteria 4197
350 Ga0268264_10042749 3300028381 Bacteria 3752
351 Ga0268264_10064083 3300028381 Bacteria 3092
352 Ga0268264_10125695 3300028381 Bacteria 2266
353 Ga0268264_10233276 3300028381 Unclassified 1700
354 Ga0268264_10278602 3300028381 Bacteria 1565
355 Ga0307515_10284431 3300028794 Bacteria 1357
356 Ga0307408_100100249 3300031548 Unclassified 2205
357 Ga0307408_100124200 3300031548 Unclassified 2004
358 Ga0307413_10007376 3300031824 Bacteria 5103
359 Ga0307410_10006041 3300031852 Bacteria 6490
360 Ga0307410_10101555 3300031852 Unclassified 2062
361 Ga0307406_10008963 3300031901 Bacteria 5594
362 Ga0307406_10050371 3300031901 Unclassified 2640
363 Ga0307406_10132891 3300031901 Bacteria 1750
364 Ga0307406_10147171 3300031901 Bacteria 1676
365 Ga0307406_10206203 3300031901 Unclassified 1451
366 Ga0307406_10336028 3300031901 Unclassified 1175
367 Ga0307407_10098004 3300031903 Bacteria 1813
368 Ga0307412_10008317 3300031911 Bacteria 5914
369 Ga0307412_10019455 3300031911 Bacteria 4113
370 Ga0307412_10020279 3300031911 Unclassified 4043
371 Ga0307412_10688644 3300031911 Unclassified 876
372 Ga0307409_100017446 3300031995 Bacteria 4786
373 Ga0307409_100029609 3300031995 Unclassified 3921
374 Ga0307409_100285430 3300031995 Bacteria 1528
375 Ga0307409_100578314 3300031995 Unclassified 1107
376 Ga0307409_100603864 3300031995 Unclassified 1085
377 Ga0307416_100002153 3300032002 Bacteria 11158
378 Ga0307416_100096580 3300032002 Unclassified 2556
379 Ga0307416_100202695 3300032002 Bacteria 1884
380 Ga0307416_100338638 3300032002 Bacteria 1516
381 Ga0307414_10001957 3300032004 Bacteria 10653
382 Ga0307411_10009457 3300032005 Bacteria 5126
383 Ga0307415_100017727 3300032126 Bacteria 4276
384 Ga0307415_100067836 3300032126 Unclassified 2494
385 Ga0307415_100139598 3300032126 Bacteria 1849
386 Ga0395900_0029881 3300037418 Bacteria 5593
387 Ga0395900_0148232 3300037418 Unclassified 2399
388 Ga0395900_0255277 3300037418 Bacteria 1753
389 Ga0395898_0156364 3300037466 Bacteria 2181
390 Ga0395898_0161798 3300037466 Bacteria 2141
391 Ga0395898_0591950 3300037466 Bacteria 1052
392 Ga0395905_0013089 3300037471 Bacteria 7964
393 Ga0395905_0027178 3300037471 Bacteria 5397
394 Ga0395905_0512287 3300037471 Bacteria 1100
395 Ga0436365_0557003 3300039437 Bacteria 48655
396 Ga0439449_0058341 3300042007 Unclassified 1425
397 Ga0451576_0248254 3300045051 Unclassified 1860
398 Ga0451576_0983995 3300045051 Unclassified 884
399 Ga0495663_0000212 3300046525 Bacteria 23260
400 Ga0495621_0000419 3300046539 Bacteria 10471
401 Ga0495636_0015381 3300047318 Bacteria 3050
402 Ga0495672_0069127 3300047320 Unclassified 2006
403 Ga0496104_0273289 3300048907 Unclassified 1603
404 Ga0496106_0172826 3300048909 Bacteria 1713
405 Ga0496108_0140309 3300048911 Bacteria 2082
406 Ga0496108_0196444 3300048911 Bacteria 1750
407 Ga0496109_0249397 3300048912 Unclassified 1672
408 Ga0496110_0203733 3300048913 Unclassified 1798
409 Ga0496112_0274134 3300048915 Bacteria 1635
410 Ga0496112_0343553 3300048915 Bacteria 1436
411 Ga0496114_0502829 3300048917 Unclassified 1072
412 Ga0501290_008269 3300049513 Bacteria 1313
413 Ga0501291_003181 3300049514 Bacteria 2027
414 Ga0501292_001249 3300049515 Bacteria 3115
415 Ga0501296_000428 3300049519 Bacteria 4127
416 Ga0501296_006477 3300049519 Bacteria 1328
417 Ga0501296_011150 3300049519 Bacteria 1073
418 Ga0501298_003470 3300049521 Unclassified 2441
419 Ga0501299_000709 3300049522 Bacteria 4001
420 Ga0501299_002302 3300049522 Unclassified 2637
421 Ga0501040_0174545 3300049576 Bacteria 1523
422 Ga0501075_0491983 3300049591 Unclassified 936
423 Ga0501202_000690 3300049652 Bacteria 5042
424 Ga0501202_026922 3300049652 Bacteria 1179
425 Ga0501202_054240 3300049652 Unclassified 894
426 Ga0501206_003546 3300049653 Unclassified 1985
427 Ga0501206_014461 3300049653 Bacteria 1085
428 Ga0501206_016337 3300049653 Unclassified 1033
429 Ga0501209_010108 3300049656 Bacteria 1929
430 Ga0501216_006493 3300049660 Bacteria 1794
431 Ga0501216_011540 3300049660 Unclassified 1438
432 Ga0501217_020251 3300049661 Bacteria 1560
433 Ga0501227_000106 3300049665 Bacteria 14058
434 Ga0501227_007963 3300049665 Unclassified 2274
435 Ga0501233_001523 3300049668 Unclassified 3957
436 Ga0501233_007411 3300049668 Unclassified 2085
437 Ga0501233_053489 3300049668 Unclassified 984
438 Ga0501235_021159 3300049669 Unclassified 1446
439 Ga0501235_041007 3300049669 Bacteria 1058
440 Ga0501236_005846 3300049670 Unclassified 1497
441 Ga0501239_011697 3300049672 Unclassified 984
442 Ga0501239_012400 3300049672 Unclassified 964
443 Ga0501243_003854 3300049675 Unclassified 2238
444 Ga0501243_005280 3300049675 Bacteria 1942
445 Ga0501253_025969 3300049683 Bacteria 1075
446 Ga0501259_044787 3300049688 Bacteria 881
447 Ga0501260_009204 3300049689 Unclassified 980
448 Ga0501221_048243 3300049704 Unclassified 952
449 Ga0501225_0061649 3300049705 Bacteria 1055
450 Ga0501234_001117 3300049707 Unclassified 4240
451 Ga0501262_013128 3300049759 Unclassified 1066
452 Ga0501268_020469 3300049765 Bacteria 1127
453 Ga0501268_025578 3300049765 Unclassified 1038
454 Ga0501270_019927 3300049767 Bacteria 1010
455 Ga0501272_006502 3300049769 Bacteria 1249
456 Ga0501273_000249 3300049770 Unclassified 4056
457 Ga0501045_0219707 3300049824 Unclassified 1415
458 Ga0501212_009737 3300049851 Unclassified 1360
459 Ga0501226_002531 3300049853 Bacteria 2223
460 nmdc:mga05p37_24050_c1 3300050507 Bacteria 7399
461 nmdc:mga05p37_642045_c1 3300050507 Bacteria 1190
462 nmdc:mga0qj67_76569_c1 3300050509 Bacteria 2676
463 nmdc:mga06r32_297108_c1 3300050510 Unclassified 1601
464 nmdc:mga06r32_84777_c1 3300050510 Bacteria 3089
465 nmdc:mga08y16_13794_c1 3300050511 Bacteria 8504
466 nmdc:mga08y16_193856_c1 3300050511 Bacteria 2107
467 nmdc:mga08y16_3655_c1 3300050511 Bacteria 15997
468 nmdc:mga08y16_626093_c1 3300050511 Unclassified 1082
469 nmdc:mga0n895_21268_c1 3300050512 Bacteria 6062
470 nmdc:mga0rr50_45291_c1 3300050513 Unclassified 3232
471 nmdc:mga08x19_19505_c1 3300050514 Bacteria 3203
472 nmdc:mga0a205_134431_c1 3300050515 Unclassified 2373
473 nmdc:mga0a205_42670_c1 3300050515 Unclassified 4371
474 nmdc:mga0a205_78183_c1 3300050515 Unclassified 1807
475 nmdc:mga0a205_9994_c1 3300050515 Bacteria 8706
476 Ga0500568_0142855 3300053139 Unclassified 887
477 Ga0501082_0348991 3300060353 Unclassified 1290
478 Ga0501082_0531131 3300060353 Bacteria 1029
479 Ga0501072_0055562
480 CNAas_1000004
481 JGI24751J29686_10000149
482 JGI25406J46586_10006263
483 Ga0065704_10030111
484 Ga0065704_10076278
485 Ga0065704_10088125
486 Ga0065712_10068069
487 Ga0065715_10003931
488 Ga0065715_10117164
489 Ga0065707_10021573
490 Ga0065707_10120340
491 Ga0070683_100528077
492 Ga0070690_100005733
493 Ga0070670_100001746
494 Ga0070670_100043788
495 Ga0070670_100072231
496 Ga0070670_100077570
497 Ga0070670_100148477
498 Ga0070670_100392685
499 Ga0068869_100002890
500 Ga0068869_100029150
501 Ga0068869_100057441
502 Ga0068869_100148876
503 Ga0070666_10051622
504 Ga0070666_10226922
505 Ga0070682_100000059
506 Ga0070682_100012254
507 Ga0068868_100420637
508 Ga0070689_100002993
509 Ga0070689_100005950
510 Ga0070689_100381342
511 Ga0070687_100011185
512 Ga0070692_10010290
513 Ga0070669_100001404
514 Ga0070669_100002230
515 Ga0070669_100010477
516 Ga0070671_100059321
517 Ga0070673_100011870
518 Ga0070673_100012429
519 Ga0070673_100141823
520 Ga0070659_100137027
521 Ga0070667_100015749
522 Ga0070703_10002189
523 Ga0070701_10076159
524 Ga0070705_100004752
525 Ga0070705_100033871
526 Ga0070700_100006690
527 Ga0070700_100063767
528 Ga0070700_100101446
529 Ga0070694_100043726
530 Ga0070694_100145064
531 Ga0070694_100440196
532 Ga0070708_100022495
533 Ga0070708_100285452
534 Ga0070663_100043978
535 Ga0070678_100374819
536 Ga0070662_100104904
537 Ga0070662_100319924
538 Ga0070662_100344650
539 Ga0070681_10044627
540 Ga0070681_10072586
541 Ga0070681_10082510
542 Ga0068867_100283029
543 Ga0070685_10094845
544 Ga0070706_100000088
545 Ga0070706_100007621
546 Ga0070706_100707494
547 Ga0070707_100150924
548 Ga0070698_100001851
549 Ga0070698_100009237
550 Ga0070698_100323483
551 Ga0070699_100017437
552 Ga0070699_100022230
553 Ga0070697_100000018
554 Ga0070697_100146970
555 Ga0070697_100178522
556 Ga0070697_100201927
557 Ga0068853_100002129
558 Ga0070672_100069224
559 Ga0070686_100089706
560 Ga0070695_100020677
561 Ga0070695_100138259
562 Ga0070696_100109787
563 Ga0070696_100122021
564 Ga0070696_100180968
565 Ga0070693_100005407
566 Ga0070693_100111607
567 Ga0070704_100048995
568 Ga0068855_100275197
569 Ga0070664_100073428
570 Ga0070664_100124366
571 Ga0070664_100672297
572 Ga0068857_100026779
573 Ga0068857_100255394
574 Ga0068857_100372139
575 Ga0068854_100115209
576 Ga0068854_100306364
577 Ga0070702_100016131
578 Ga0070702_100023312
579 Ga0070702_100054425
580 Ga0070702_100138263
581 Ga0068852_100132570
582 Ga0068859_100002739
583 Ga0068859_100079033
584 Ga0068859_100113258
585 Ga0068859_100288925
586 Ga0068859_100295937
587 Ga0068859_100297388
588 Ga0068859_100361531
589 Ga0068859_100411487
590 Ga0068859_100825918
591 Ga0068864_100009377
592 Ga0068864_100081449
593 Ga0068864_100158598
594 Ga0068864_100247397
595 Ga0068866_10208892
596 Ga0068861_100017567
597 Ga0068861_100091327
598 Ga0068861_100521502
599 Ga0068870_10180853
600 Ga0068870_10198835
601 Ga0068863_100048525
602 Ga0068863_100366412
603 Ga0068858_100140903
604 Ga0068858_100143581
605 Ga0068858_100149577
606 Ga0068858_100173651
607 Ga0068858_100216036
608 Ga0068858_100304109
609 Ga0068860_100030469
610 Ga0068860_100045947
611 Ga0068860_100061516
612 Ga0068860_100111309
613 Ga0068860_100157253
614 Ga0068860_100249471
615 Ga0068862_100078982
616 Ga0068862_100133802
617 Ga0068862_100153541
618 Ga0081539_10000043
619 Ga0081539_10002203
620 Ga0097621_100045854
621 Ga0097621_100077638
622 Ga0097621_100154479
623 Ga0075428_100320679
624 Ga0075430_100037954
625 Ga0075431_100140812
626 Ga0075433_10020255
627 Ga0075433_10022972
628 Ga0075434_100073385
629 Ga0075434_100193993
630 Ga0075429_100053523
631 Ga0075429_100056224
632 Ga0068865_100224160
633 Ga0097620_100002739
634 Ga0097620_100079032
635 Ga0097620_100113240
636 Ga0097620_100288929
637 Ga0097620_100295926
638 Ga0097620_100297388
639 Ga0097620_100361523
640 Ga0097620_100411514
641 Ga0097620_100825928
642 Ga0075435_100010257
643 Ga0105240_10229057
644 Ga0105240_10240142
645 Ga0105240_10339343
646 Ga0111539_10012727
647 Ga0111539_10024482
648 Ga0111539_10237986
649 Ga0105245_10551120
650 Ga0105247_10000592
651 Ga0114129_10055425
652 Ga0114129_10086189
653 Ga0114129_10705332
654 Ga0105243_10602006
655 Ga0105243_10716569
656 Ga0105241_10081808
657 Ga0105241_10154563
658 Ga0105241_10245614
659 Ga0105242_10092745
660 Ga0105242_10120475
661 Ga0105242_10215631
662 Ga0105242_10349644
663 Ga0105248_10004879
664 Ga0105248_10006056
665 Ga0105248_10019195
666 Ga0105248_10144407
667 Ga0105248_10334188
668 Ga0105248_10359887
669 Ga0105248_10507943
670 Ga0105237_10008903
671 Ga0105237_10015838
672 Ga0105238_10013915
673 Ga0105238_10027606
674 Ga0105249_10007021
675 Ga0105249_10009528
676 Ga0105249_10022284
677 Ga0105249_10023478
678 Ga0105249_10055573
679 Ga0105249_10332916
680 Ga0105249_10549881
681 Ga0105239_10172767
682 Ga0105246_10046767
683 Ga0105246_10064504
684 Ga0157373_10002883
685 Ga0157373_10008292
686 Ga0157370_10188195
687 Ga0157378_10213030
688 Ga0157378_10254614
689 Ga0163162_10002437
690 Ga0163162_10012021
691 Ga0163162_10123411
692 Ga0163162_10160062
693 Ga0163162_10226680
694 Ga0163162_10342717
695 Ga0163162_10692225
696 Ga0157372_10001564
697 Ga0157372_10037335
698 Ga0157372_10097521
699 Ga0157372_10577649
700 Ga0157375_10024705
701 Ga0157375_10066490
702 Ga0157375_10163772
703 Ga0157375_10757507
704 Ga0157375_10901390
705 Ga0163163_10000862
706 Ga0163163_10029821
707 Ga0163163_10176680
708 Ga0163163_10285910
709 Ga0163163_10650171
710 Ga0163163_10829744
711 Ga0157380_10004388
712 Ga0157380_10255811
713 Ga0157377_10222413
714 Ga0157379_10153894
715 Ga0157379_10167591
716 Ga0182007_10069023
717 Ga0213876_10000102
718 Ga0213876_10000277
719 Ga0207656_10020864
720 Ga0207653_10003394
721 Ga0207710_10001166
722 Ga0207710_10003077
723 Ga0207647_10000385
724 Ga0207647_10037013
725 Ga0207643_10198389
726 Ga0207684_10000131
727 Ga0207654_10080054
728 Ga0207654_10095706
729 Ga0207654_10220267
730 Ga0207707_10004243
731 Ga0207707_10071747
732 Ga0207671_10018785
733 Ga0207660_10186717
734 Ga0207662_10041903
735 Ga0207657_10072188
736 Ga0207652_10074357
737 Ga0207652_10212329
738 Ga0207646_10114880
739 Ga0207681_10000710
740 Ga0207681_10011902
741 Ga0207681_10035068
742 Ga0207681_10284530
743 Ga0207694_10007934
744 Ga0207694_10117357
745 Ga0207650_10000005
746 Ga0207650_10004505
747 Ga0207650_10038364
748 Ga0207650_10100360
749 Ga0207650_10155763
750 Ga0207650_10188170
751 Ga0207650_10364609
752 Ga0207650_10618101
753 Ga0207644_10005236
754 Ga0207706_10078555
755 Ga0207706_10096216
756 Ga0207706_10196360
757 Ga0207686_10159056
758 Ga0207686_10431383
759 Ga0207709_10014077
760 Ga0207670_10003824
761 Ga0207670_10016323
762 Ga0207691_10043208
763 Ga0207691_10081333
764 Ga0207711_10003667
765 Ga0207711_10003858
766 Ga0207711_10045781
767 Ga0207711_10053439
768 Ga0207711_10060152
769 Ga0207711_10299163
770 Ga0207689_10006380
771 Ga0207689_10043920
772 Ga0207689_10056365
773 Ga0207689_10064860
774 Ga0207679_10098745
775 Ga0207679_10133942
776 Ga0207679_10169807
777 Ga0207667_10147647
778 Ga0207651_10031252
779 Ga0207651_10148747
780 Ga0207712_10003603
781 Ga0207712_10007987
782 Ga0207712_10016622
783 Ga0207712_10210330
784 Ga0207640_10107395
785 Ga0207677_10012907
786 Ga0207703_10048098
787 Ga0207703_10198251
788 Ga0207703_10245176
789 Ga0207703_10386309
790 Ga0207703_10403304
791 Ga0207639_10001238
792 Ga0207639_10119535
793 Ga0207678_10026981
794 Ga0207708_10000043
795 Ga0207708_10002522
796 Ga0207708_10092181
797 Ga0207708_10128938
798 Ga0207641_10004650
799 Ga0207641_10066016
800 Ga0207641_10336497
801 Ga0207641_10414237
802 Ga0207641_10442421
803 Ga0207641_10471505
804 Ga0207648_10035306
805 Ga0207648_10091531
806 Ga0207676_10002434
807 Ga0207676_10004891
808 Ga0207676_10129441
809 Ga0207676_10245242
810 Ga0207676_10508819
811 Ga0207674_10035731
812 Ga0207674_10112663
813 Ga0207674_10208968
814 Ga0207674_10330675
815 Ga0207675_100021904
816 Ga0207675_100028157
817 Ga0207675_100137405
818 Ga0207675_100329437
819 Ga0207428_10014828
820 Ga0207428_10047588
821 Ga0268265_10010397
822 Ga0268265_10038393
823 Ga0268265_10140851
824 Ga0268265_10206773
825 Ga0268265_10357446
826 Ga0268264_10005556
827 Ga0268264_10033903
828 Ga0268264_10042749
829 Ga0268264_10064083
830 Ga0268264_10125695
831 Ga0268264_10233276
832 Ga0268264_10278602
833 Ga0307515_10284431
834 Ga0307408_100100249
835 Ga0307408_100124200
836 Ga0307413_10007376
837 Ga0307410_10006041
838 Ga0307410_10101555
839 Ga0307406_10008963
840 Ga0307406_10050371
841 Ga0307406_10132891
842 Ga0307406_10147171
843 Ga0307406_10206203
844 Ga0307406_10336028
845 Ga0307407_10098004
846 Ga0307412_10008317
847 Ga0307412_10019455
848 Ga0307412_10020279
849 Ga0307412_10688644
850 Ga0307409_100017446
851 Ga0307409_100029609
852 Ga0307409_100285430
853 Ga0307409_100578314
854 Ga0307409_100603864
855 Ga0307416_100002153
856 Ga0307416_100096580
857 Ga0307416_100202695
858 Ga0307416_100338638
859 Ga0307414_10001957
860 Ga0307411_10009457
861 Ga0307415_100017727
862 Ga0307415_100067836
863 Ga0307415_100139598
864 Ga0395900_0029881
865 Ga0395900_0148232
866 Ga0395900_0255277
867 Ga0395898_0156364
868 Ga0395898_0161798
869 Ga0395898_0591950
870 Ga0395905_0013089
871 Ga0395905_0027178
872 Ga0395905_0512287
873 Ga0436365_0557003
874 Ga0439449_0058341
875 Ga0451576_0248254
876 Ga0451576_0983995
877 Ga0495663_0000212
878 Ga0495621_0000419
879 Ga0495636_0015381
880 Ga0495672_0069127
881 Ga0496104_0273289
882 Ga0496106_0172826
883 Ga0496108_0140309
884 Ga0496108_0196444
885 Ga0496109_0249397
886 Ga0496110_0203733
887 Ga0496112_0274134
888 Ga0496112_0343553
889 Ga0496114_0502829
890 Ga0501290_008269
891 Ga0501291_003181
892 Ga0501292_001249
893 Ga0501296_000428
894 Ga0501296_006477
895 Ga0501296_011150
896 Ga0501298_003470
897 Ga0501299_000709
898 Ga0501299_002302
899 Ga0501040_0174545
900 Ga0501075_0491983
901 Ga0501202_000690
902 Ga0501202_026922
903 Ga0501202_054240
904 Ga0501206_003546
905 Ga0501206_014461
906 Ga0501206_016337
907 Ga0501209_010108
908 Ga0501216_006493
909 Ga0501216_011540
910 Ga0501217_020251
911 Ga0501227_000106
912 Ga0501227_007963
913 Ga0501233_001523
914 Ga0501233_007411
915 Ga0501233_053489
916 Ga0501235_021159
917 Ga0501235_041007
918 Ga0501236_005846
919 Ga0501239_011697
920 Ga0501239_012400
921 Ga0501243_003854
922 Ga0501243_005280
923 Ga0501253_025969
924 Ga0501259_044787
925 Ga0501260_009204
926 Ga0501221_048243
927 Ga0501225_0061649
928 Ga0501234_001117
929 Ga0501262_013128
930 Ga0501268_020469
931 Ga0501268_025578
932 Ga0501270_019927
933 Ga0501272_006502
934 Ga0501273_000249
935 Ga0501045_0219707
936 Ga0501212_009737
937 Ga0501226_002531
938 nmdc:mga05p37_24050_c1
939 nmdc:mga05p37_642045_c1
940 nmdc:mga0qj67_76569_c1
941 nmdc:mga06r32_297108_c1
942 nmdc:mga06r32_84777_c1
943 nmdc:mga08y16_13794_c1
944 nmdc:mga08y16_193856_c1
945 nmdc:mga08y16_3655_c1
946 nmdc:mga08y16_626093_c1
947 nmdc:mga0n895_21268_c1
948 nmdc:mga0rr50_45291_c1
949 nmdc:mga08x19_19505_c1
950 nmdc:mga0a205_134431_c1
951 nmdc:mga0a205_42670_c1
952 nmdc:mga0a205_78183_c1
953 nmdc:mga0a205_9994_c1
954 Ga0500568_0142855
955 Ga0501082_0348991
956 Ga0501082_0531131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24741

81

291

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bzh-assembly1.cif.gz_A solution structure of a dna binding protein from sulfolobus islandicus 0.8713 208 261
2ia2-assembly1.cif.gz_A the crystal structure of a putative transcriptional regulator rha06195 from rhodococcus sp. rha1 0.8557 221 261
2heo-assembly1.cif.gz_D general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.8477 208 261
1j75-assembly1.cif.gz_A-2 crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna 0.8462 208 261
2heo-assembly1.cif.gz_A general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.8422 208 263
ID Description Score Start End Superfamily
af_B2RYJ1_603_746_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8775 207 261 3.30.230.130
af_Q54S95_10_96_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8675 222 263 1.10.10.10
af_P14081_487_546_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8608 205 260 1.10.10.10
af_P39389_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8586 222 263 1.10.10.10
af_Q19519_316_383_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8572 205 263 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9CKS2-F1-model_v4 Uncharacterized protein 1.004 202 261
AF-A0A7W0GSM1-F1-model_v4 Uncharacterized protein 0.9926 1 206
AF-A0A2V8SUB2-F1-model_v4 Transcriptional regulator 0.9923 1 263
AF-A0A7Y5U5D9-F1-model_v4 Winged helix-turn-helix domain-containing protein 0.9894 1 262
AF-A0A1Q7MSX2-F1-model_v4 Uncharacterized protein 0.9891 1 262

Map