F451920

General Info

Members Datasets Scaffolds Average Seq Length
478 228 956 104

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_1500389|Ga0451791_1500389_13_363
Length 116
Sequence VQARRAGGTLVAVKELLDDIDRWRLAGRRVALARVVDTDGSGPRLPGAAMAVNDQGQVVGSVTGGCVEGAVVVEAQDVLATGRPRLVRFGYSDADAFAVGLTCGGTVHLFIEPLDW

Samples

Sample ID Description Type Environment
1 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
104 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
105 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
106 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
116 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
123 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.57
Nodule 0
Rhizoplane 6.69
Rhizosphere 72.38
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451791_1500389 3300041451 Bacteria 634
2 Ga0070670_101641159 3300005331 Bacteria 591
3 Ga0068869_101477637 3300005334 Bacteria 603
4 Ga0070682_101078898 3300005337 Bacteria 671
5 Ga0068868_100657610 3300005338 Bacteria 934
6 Ga0070669_100348993 3300005353 Bacteria 1201
7 Ga0070671_100003857 3300005355 Bacteria 11786
8 Ga0070673_101234145 3300005364 Bacteria 701
9 Ga0070667_100135970 3300005367 Bacteria 2149
10 Ga0070708_100150015 3300005445 Bacteria 2168
11 Ga0070708_100197351 3300005445 Bacteria 1883
12 Ga0070708_100401478 3300005445 Bacteria 1292
13 Ga0070663_100777830 3300005455 Bacteria 819
14 Ga0070663_101774999 3300005455 Bacteria 553
15 Ga0070678_101707111 3300005456 Bacteria 593
16 Ga0070681_11551797 3300005458 Bacteria 587
17 Ga0068867_100423127 3300005459 Bacteria 1129
18 Ga0070685_10673482 3300005466 Bacteria 752
19 Ga0070685_11426981 3300005466 Bacteria 532
20 Ga0070706_100034309 3300005467 Bacteria 4686
21 Ga0070706_100367262 3300005467 Bacteria 1341
22 Ga0070706_100403307 3300005467 Bacteria 1273
23 Ga0070706_100824197 3300005467 Bacteria 858
24 Ga0070707_100439697 3300005468 Bacteria 1265
25 Ga0070707_101566983 3300005468 Bacteria 626
26 Ga0070697_100058305 3300005536 Bacteria 3142
27 Ga0070696_101776758 3300005546 Bacteria 532
28 Ga0070665_101693019 3300005548 Bacteria 640
29 Ga0068856_100846149 3300005614 Bacteria 934
30 Ga0070702_101039240 3300005615 Bacteria 651
31 Ga0068866_10917567 3300005718 Bacteria 617
32 Ga0068861_101718132 3300005719 Bacteria 621
33 Ga0068870_11135288 3300005840 Bacteria 563
34 Ga0068863_100095406 3300005841 Bacteria 2823
35 Ga0068858_101045198 3300005842 Bacteria 801
36 Ga0068858_102425313 3300005842 Bacteria 518
37 Ga0068860_100959524 3300005843 Bacteria 872
38 Ga0068862_102208514 3300005844 Bacteria 562
39 Ga0081455_10023380 3300005937 Bacteria 5752
40 Ga0081455_10076633 3300005937 Bacteria 2754
41 Ga0081455_10465996 3300005937 Bacteria 859
42 Ga0081538_10000385 3300005981 Bacteria 50162
43 Ga0075365_10003285 3300006038 Bacteria 8295
44 Ga0075365_10010802 3300006038 Bacteria 5338
45 Ga0075365_10017758 3300006038 Bacteria 4361
46 Ga0075365_10035889 3300006038 Bacteria 3210
47 Ga0075365_10113710 3300006038 Bacteria 1862
48 Ga0075365_10183410 3300006038 Bacteria 1464
49 Ga0075365_10727823 3300006038 Bacteria 701
50 Ga0075365_10735531 3300006038 Bacteria 697
51 Ga0075365_10780516 3300006038 Bacteria 674
52 Ga0075365_10887869 3300006038 Bacteria 628
53 Ga0075368_10031636 3300006042 Bacteria 2053
54 Ga0075368_10131175 3300006042 Unclassified 1042
55 Ga0075368_10179126 3300006042 Bacteria 893
56 Ga0075363_100038639 3300006048 Bacteria 2510
57 Ga0075363_100099590 3300006048 Bacteria 1607
58 Ga0075363_100108966 3300006048 Bacteria 1538
59 Ga0075363_100113164 3300006048 Bacteria 1510
60 Ga0075363_100118018 3300006048 Bacteria 1479
61 Ga0075363_100130467 3300006048 Bacteria 1409
62 Ga0075363_100180808 3300006048 Bacteria 1200
63 Ga0075363_100280148 3300006048 Bacteria 964
64 Ga0075363_100492245 3300006048 Bacteria 727
65 Ga0075364_10000967 3300006051 Bacteria 15151
66 Ga0075364_10003844 3300006051 Bacteria 8605
67 Ga0075364_10089572 3300006051 Bacteria 2040
68 Ga0075364_10104184 3300006051 Bacteria 1890
69 Ga0075364_10163178 3300006051 Bacteria 1504
70 Ga0075362_10009977 3300006177 Bacteria 3692
71 Ga0075362_10048569 3300006177 Bacteria 1894
72 Ga0075362_10266023 3300006177 Bacteria 846
73 Ga0075367_10036408 3300006178 Bacteria 2853
74 Ga0075367_10053574 3300006178 Bacteria 2391
75 Ga0075367_10297921 3300006178 Bacteria 1015
76 Ga0075367_10552557 3300006178 Bacteria 731
77 Ga0075369_10016694 3300006186 Bacteria 2966
78 Ga0075427_10048783 3300006194 Bacteria 726
79 Ga0075370_10058483 3300006353 Bacteria 2193
80 Ga0075370_10203274 3300006353 Bacteria 1169
81 Ga0075370_10753507 3300006353 Bacteria 593
82 Ga0075428_100000250 3300006844 Bacteria 52704
83 Ga0075428_100080278 3300006844 Bacteria 3560
84 Ga0075428_100159526 3300006844 Bacteria 2448
85 Ga0075428_100166748 3300006844 Bacteria 2389
86 Ga0075428_100739790 3300006844 Bacteria 1047
87 Ga0075430_100007194 3300006846 Bacteria 9388
88 Ga0075430_100012608 3300006846 Bacteria 7197
89 Ga0075430_100949010 3300006846 Bacteria 709
90 Ga0075431_100001023 3300006847 Bacteria 24930
91 Ga0075431_100002952 3300006847 Bacteria 16466
92 Ga0075431_100203946 3300006847 Bacteria 2022
93 Ga0075431_100303544 3300006847 Bacteria 1612
94 Ga0075431_101398701 3300006847 Bacteria 659
95 Ga0075429_100000110 3300006880 Bacteria 46855
96 Ga0075429_100007681 3300006880 Bacteria 9363
97 Ga0075429_100010872 3300006880 Bacteria 7872
98 Ga0075429_100145234 3300006880 Bacteria 2077
99 Ga0075429_100540052 3300006880 Bacteria 1022
100 Ga0075429_100892672 3300006880 Bacteria 778
101 Ga0075435_100423090 3300007076 Unclassified 1147
102 Ga0111539_10033710 3300009094 Bacteria 6215
103 Ga0111539_10037355 3300009094 Bacteria 5865
104 Ga0111539_10289505 3300009094 Bacteria 1906
105 Ga0111539_11035006 3300009094 Bacteria 954
106 Ga0105245_10026115 3300009098 Bacteria 5139
107 Ga0105245_10335153 3300009098 Bacteria 1494
108 Ga0105245_11840897 3300009098 Bacteria 658
109 Ga0114129_10000293 3300009147 Bacteria 57817
110 Ga0114129_10081793 3300009147 Bacteria 4489
111 Ga0114129_10380970 3300009147 Bacteria 1863
112 Ga0114129_10471671 3300009147 Bacteria 1643
113 Ga0114129_10852921 3300009147 Bacteria 1158
114 Ga0114129_11339848 3300009147 Bacteria 885
115 Ga0114129_11469644 3300009147 Bacteria 838
116 Ga0114129_12523407 3300009147 Bacteria 614
117 Ga0105243_11607645 3300009148 Bacteria 677
118 Ga0105242_10340485 3300009176 Bacteria 1382
119 Ga0105248_10454167 3300009177 Bacteria 1444
120 Ga0105248_10730641 3300009177 Bacteria 1117
121 Ga0105237_11355378 3300009545 Bacteria 718
122 Ga0105238_11989419 3300009551 Bacteria 615
123 Ga0105249_12546634 3300009553 Bacteria 584
124 Ga0105239_12512776 3300010375 Bacteria 600
125 Ga0105239_13083182 3300010375 Bacteria 543
126 Ga0105246_12072315 3300011119 Bacteria 551
127 Ga0157374_11716116 3300013296 Bacteria 653
128 Ga0157378_10104396 3300013297 Bacteria 2590
129 Ga0157378_10164600 3300013297 Bacteria 2077
130 Ga0157378_12812982 3300013297 Bacteria 539
131 Ga0163162_11383829 3300013306 Bacteria 800
132 Ga0157375_10701656 3300013308 Bacteria 1165
133 Ga0157375_11428643 3300013308 Bacteria 815
134 Ga0163163_11480838 3300014325 Bacteria 740
135 Ga0163163_11548848 3300014325 Bacteria 724
136 Ga0157380_10438174 3300014326 Bacteria 1251
137 Ga0157380_10577302 3300014326 Bacteria 1108
138 Ga0157379_11370124 3300014968 Bacteria 685
139 Ga0157376_11034479 3300014969 Bacteria 845
140 Ga0163161_11695526 3300017792 Bacteria 560
141 Ga0197907_10403055 3300020069 Bacteria 529
142 Ga0213871_10168935 3300021441 Bacteria 672
143 Ga0224712_10306402 3300022467 Bacteria 744
144 Ga0224712_10469906 3300022467 Bacteria 605
145 Ga0224712_10623754 3300022467 Bacteria 527
146 Ga0207688_10686564 3300025901 Bacteria 647
147 Ga0207684_10194052 3300025910 Bacteria 1751
148 Ga0207684_10207646 3300025910 Bacteria 1689
149 Ga0207684_10401516 3300025910 Bacteria 1178
150 Ga0207684_10653682 3300025910 Bacteria 896
151 Ga0207646_10420319 3300025922 Bacteria 1207
152 Ga0207646_10466687 3300025922 Bacteria 1138
153 Ga0207681_10332058 3300025923 Bacteria 1212
154 Ga0207681_10773688 3300025923 Bacteria 801
155 Ga0207650_10242183 3300025925 Bacteria 1458
156 Ga0207650_10835924 3300025925 Bacteria 781
157 Ga0207650_11321452 3300025925 Bacteria 614
158 Ga0207687_10002682 3300025927 Bacteria 12043
159 Ga0207644_10006487 3300025931 Bacteria 7626
160 Ga0207686_11380641 3300025934 Bacteria 579
161 Ga0207686_11554004 3300025934 Bacteria 546
162 Ga0207686_11791046 3300025934 Bacteria 508
163 Ga0207670_10251452 3300025936 Bacteria 1366
164 Ga0207669_11553055 3300025937 Bacteria 565
165 Ga0207689_10214539 3300025942 Bacteria 1590
166 Ga0207661_12126775 3300025944 Bacteria 507
167 Ga0207651_11012554 3300025960 Bacteria 743
168 Ga0207668_10549024 3300025972 Bacteria 1001
169 Ga0207658_10237063 3300025986 Bacteria 1543
170 Ga0207677_10226821 3300026023 Bacteria 1502
171 Ga0207677_11035999 3300026023 Bacteria 745
172 Ga0207703_10052681 3300026035 Bacteria 3305
173 Ga0207702_12153588 3300026078 Bacteria 547
174 Ga0207641_10376616 3300026088 Bacteria 1358
175 Ga0207676_12095438 3300026095 Bacteria 564
176 Ga0207675_101410914 3300026118 Bacteria 717
177 Ga0209813_10117647 3300027866 Bacteria 922
178 Ga0209813_10159444 3300027866 Bacteria 813
179 Ga0207428_10184530 3300027907 Bacteria 1575
180 Ga0268266_11450049 3300028379 Bacteria 662
181 Ga0265338_10179739 3300028800 Bacteria 1614
182 Ga0265338_10497596 3300028800 Bacteria 858
183 Ga0265328_10192613 3300031239 Bacteria 773
184 Ga0265327_10010205 3300031251 Bacteria 6634
185 Ga0265327_10019898 3300031251 Bacteria 4110
186 Ga0265327_10025369 3300031251 Bacteria 3458
187 Ga0265327_10216645 3300031251 Bacteria 862
188 Ga0265316_11203673 3300031344 Bacteria 524
189 Ga0316579_10300903 3300031691 Bacteria 775
190 Ga0316576_10065693 3300031727 Bacteria 2666
191 Ga0316576_10872637 3300031727 Bacteria 645
192 Ga0316578_10098857 3300031728 Bacteria 1748
193 Ga0316577_10047150 3300031733 Bacteria 2406
194 Ga0307409_100790361 3300031995 Bacteria 956
195 Ga0307409_101816732 3300031995 Bacteria 639
196 Ga0307415_101137259 3300032126 Bacteria 733
197 Ga0307415_101400575 3300032126 Bacteria 666
198 Ga0316585_10108098 3300032137 Bacteria 914
199 Ga0373930_0001024 3300034816 Bacteria 4024
200 Ga0373928_0000370 3300035084 Bacteria 8989
201 Ga0373928_0071152 3300035084 Bacteria 860
202 Ga0373928_0278238 3300035084 Bacteria 506
203 Ga0373929_0028035 3300035085 Bacteria 1187
204 Ga0373929_0037369 3300035085 Bacteria 1064
205 Ga0373932_0044622 3300035112 Bacteria 1293
206 Ga0373932_0188170 3300035112 Bacteria 728
207 Ga0316574_0089404 3300035398 Bacteria 1962
208 Ga0316574_0161584 3300035398 Bacteria 1442
209 Ga0316574_0257284 3300035398 Bacteria 1115
210 Ga0373931_0000032 3300035691 Bacteria 96498
211 Ga0373931_0000146 3300035691 Bacteria 30952
212 Ga0373947_0477537 3300035725 Bacteria 846
213 Ga0373937_1420690 3300036401 Bacteria 642
214 Ga0316582_0171072 3300036647 Bacteria 1475
215 Ga0316584_0008524 3300036712 Bacteria 7064
216 Ga0316584_0068540 3300036712 Bacteria 2659
217 Ga0316584_0980587 3300036712 Bacteria 565
218 Ga0436364_0651656 3300037853 Bacteria 713
219 Ga0400485_13045 3300038735 Bacteria 20812
220 Ga0400483_048441 3300039062 Bacteria 3961
221 Ga0400483_050686 3300039062 Bacteria 1609
222 Ga0400483_095400 3300039062 Bacteria 1589
223 Ga0400483_098082 3300039062 Bacteria 12363
224 Ga0400483_132392 3300039062 Bacteria 4111
225 Ga0400483_166649 3300039062 Bacteria 3492
226 Ga0400483_195830 3300039062 Bacteria 1028
227 Ga0400483_234306 3300039062 Bacteria 2922
228 Ga0400483_267148 3300039062 Bacteria 38824
229 Ga0400483_291742 3300039062 Bacteria 11410
230 Ga0436365_0602433 3300039437 Bacteria 1120
231 Ga0436360_0006345 3300039438 Bacteria 667
232 Ga0436363_0666382 3300039450 Bacteria 961
233 Ga0436363_0938563 3300039450 Bacteria 806
234 Ga0451789_0291600 3300041443 Bacteria 569
235 Ga0451791_1635519 3300041451 Bacteria 681
236 Ga0451802_1989186 3300041460 Bacteria 506
237 Ga0451849_0014478 3300041505 Bacteria 696
238 Ga0439454_113349 3300042011 Bacteria 519
239 Ga0451577_0012738 3300042876 Bacteria 7889
240 Ga0439440_0056047 3300042993 Bacteria 996
241 Ga0466969_0460252 3300044656 Unclassified 579
242 Ga0466966_0894956 3300044684 Unclassified 535
243 Ga0453684_0002246 3300044712 Bacteria 47929
244 Ga0466968_0309804 3300044735 Bacteria 761
245 Ga0466959_0308128 3300045049 Bacteria 1084
246 Ga0495592_0380267 3300046454 Bacteria 898
247 Ga0495629_0054279 3300046459 Bacteria 2803
248 Ga0495629_0599055 3300046459 Bacteria 737
249 Ga0495629_0957442 3300046459 Bacteria 559
250 Ga0495641_0078189 3300046461 Bacteria 1483
251 Ga0495653_0130839 3300046463 Bacteria 1777
252 Ga0495653_0336519 3300046463 Bacteria 974
253 Ga0495653_0426342 3300046463 Bacteria 838
254 Ga0495582_0032809 3300046473 Bacteria 2854
255 Ga0495639_0021402 3300046475 Bacteria 2831
256 Ga0495639_0569436 3300046475 Bacteria 581
257 Ga0495664_0047211 3300046477 Bacteria 2555
258 Ga0495594_0831054 3300046499 Bacteria 520
259 Ga0495608_0052271 3300046511 Bacteria 2705
260 Ga0495618_0333025 3300046514 Bacteria 938
261 Ga0495628_0012034 3300046516 Bacteria 7297
262 Ga0495628_0239789 3300046516 Bacteria 1356
263 Ga0495628_0574877 3300046516 Bacteria 807
264 Ga0495630_0108932 3300046517 Bacteria 2098
265 Ga0495630_0173574 3300046517 Bacteria 1643
266 Ga0495630_0718170 3300046517 Bacteria 764
267 Ga0495630_0912215 3300046517 Bacteria 669
268 Ga0495666_0579659 3300046526 Bacteria 500
269 Ga0495640_0061835 3300046533 Bacteria 2542
270 Ga0495586_0123779 3300046535 Bacteria 1445
271 Ga0495587_0836332 3300046536 Bacteria 502
272 Ga0495621_0007471 3300046539 Bacteria 3238
273 Ga0495634_0003110 3300046642 Bacteria 13492
274 Ga0495634_0708778 3300046642 Bacteria 578
275 Ga0495635_0628166 3300046663 Bacteria 700
276 Ga0495635_0630960 3300046663 Bacteria 698
277 Ga0495588_0080703 3300046674 Bacteria 1698
278 Ga0495657_0303863 3300046675 Bacteria 951
279 Ga0495657_0437863 3300046675 Bacteria 766
280 Ga0495623_0336796 3300046679 Bacteria 825
281 Ga0495646_0095119 3300046680 Bacteria 1715
282 Ga0495646_0282217 3300046680 Bacteria 882
283 Ga0495647_0021146 3300046681 Bacteria 2341
284 Ga0495658_0023296 3300046683 Bacteria 3286
285 Ga0495658_0258368 3300046683 Bacteria 1096
286 Ga0495613_0000418 3300046689 Bacteria 36443
287 Ga0495613_0604158 3300046689 Bacteria 730
288 Ga0495613_1008999 3300046689 Bacteria 534
289 Ga0495670_0245713 3300046691 Bacteria 953
290 Ga0495649_0685386 3300046694 Bacteria 503
291 Ga0495589_0518978 3300046794 Bacteria 544
292 Ga0495604_0284474 3300047317 Bacteria 1116
293 Ga0495604_0285891 3300047317 Bacteria 1112
294 Ga0495674_0049848 3300047319 Bacteria 3697
295 Ga0495674_0103767 3300047319 Bacteria 2417
296 Ga0495674_1043599 3300047319 Bacteria 625
297 Ga0495674_1360281 3300047319 Bacteria 531
298 Ga0495674_1423566 3300047319 Bacteria 516
299 Ga0495676_0213412 3300047321 Bacteria 1334
300 Ga0495676_0454086 3300047321 Bacteria 845
301 Ga0495676_0496077 3300047321 Bacteria 802
302 Ga0495683_0434789 3300047323 Bacteria 541
303 Ga0495684_0704232 3300047471 Bacteria 669
304 Ga0495684_1003690 3300047471 Bacteria 530
305 Ga0495614_0014956 3300048089 Bacteria 3390
306 Ga0496102_0264680 3300048905 Bacteria 1621
307 Ga0496104_0135362 3300048907 Bacteria 2367
308 Ga0496104_0235430 3300048907 Bacteria 1743
309 Ga0496104_0514393 3300048907 Bacteria 1108
310 Ga0496104_0672576 3300048907 Bacteria 944
311 Ga0496104_0876137 3300048907 Bacteria 803
312 Ga0496105_0607915 3300048908 Bacteria 848
313 Ga0496106_0212951 3300048909 Bacteria 1540
314 Ga0496106_1351903 3300048909 Bacteria 552
315 Ga0496107_0277865 3300048910 Bacteria 1247
316 Ga0496108_0066218 3300048911 Bacteria 3046
317 Ga0496108_0146688 3300048911 Bacteria 2035
318 Ga0496109_0136195 3300048912 Bacteria 2295
319 Ga0496109_0167209 3300048912 Bacteria 2062
320 Ga0496109_0318755 3300048912 Bacteria 1467
321 Ga0496109_2054843 3300048912 Bacteria 503
322 Ga0496110_0076774 3300048913 Bacteria 2971
323 Ga0496110_0310516 3300048913 Bacteria 1436
324 Ga0496110_0475967 3300048913 Bacteria 1138
325 Ga0496110_1005707 3300048913 Bacteria 741
326 Ga0496111_0080942 3300048914 Bacteria 2370
327 Ga0496111_0807944 3300048914 Bacteria 678
328 Ga0496112_0018873 3300048915 Bacteria 6497
329 Ga0496112_0852275 3300048915 Bacteria 835
330 Ga0496113_0112257 3300048916 Bacteria 2123
331 Ga0496113_0266875 3300048916 Bacteria 1368
332 Ga0496114_0348799 3300048917 Bacteria 1309
333 Ga0496115_0598723 3300048918 Bacteria 877
334 Ga0501031_0460231 3300049568 Bacteria 822
335 Ga0501032_0002410 3300049569 Bacteria 14586
336 Ga0501033_0014023 3300049570 Bacteria 6097
337 Ga0501034_0008101 3300049571 Bacteria 11146
338 Ga0501034_0027379 3300049571 Bacteria 5797
339 Ga0501034_0066097 3300049571 Bacteria 3629
340 Ga0501034_0162973 3300049571 Bacteria 2200
341 Ga0501034_0643266 3300049571 Bacteria 963
342 Ga0501034_1064173 3300049571 Bacteria 691
343 Ga0501034_1168030 3300049571 Bacteria 649
344 Ga0501036_0440519 3300049572 Bacteria 1086
345 Ga0501036_0673319 3300049572 Bacteria 856
346 Ga0501037_0000990 3300049573 Bacteria 21062
347 Ga0501038_0103696 3300049574 Bacteria 2365
348 Ga0501039_0404641 3300049575 Bacteria 1072
349 Ga0501040_1065397 3300049576 Bacteria 586
350 Ga0501041_0021488 3300049577 Bacteria 3866
351 Ga0501042_0084542 3300049578 Bacteria 2275
352 Ga0501043_0032484 3300049579 Bacteria 4104
353 Ga0501043_0232310 3300049579 Bacteria 1424
354 Ga0501043_0333928 3300049579 Bacteria 1154
355 Ga0501046_0021215 3300049580 Bacteria 5363
356 Ga0501046_0242805 3300049580 Bacteria 1328
357 Ga0501047_0045492 3300049581 Bacteria 4244
358 Ga0501047_0137715 3300049581 Bacteria 2321
359 Ga0501047_0161023 3300049581 Bacteria 2116
360 Ga0501047_0858870 3300049581 Bacteria 721
361 Ga0501048_0092090 3300049582 Bacteria 2138
362 Ga0501048_0308701 3300049582 Bacteria 1126
363 Ga0501068_0040196 3300049584 Bacteria 2807
364 Ga0501068_0047757 3300049584 Bacteria 2583
365 Ga0501068_0435026 3300049584 Bacteria 848
366 Ga0501068_0449386 3300049584 Bacteria 834
367 Ga0501068_0467607 3300049584 Bacteria 817
368 Ga0501068_0472205 3300049584 Bacteria 812
369 Ga0501070_0025818 3300049586 Bacteria 4928
370 Ga0501070_0055762 3300049586 Bacteria 3275
371 Ga0501070_0136425 3300049586 Bacteria 2026
372 Ga0501071_0403509 3300049587 Bacteria 1044
373 Ga0501071_0772581 3300049587 Bacteria 740
374 Ga0501072_0147307 3300049588 Bacteria 1877
375 Ga0501072_0661170 3300049588 Bacteria 822
376 Ga0501073_0287892 3300049589 Bacteria 1134
377 Ga0501073_0367531 3300049589 Bacteria 994
378 Ga0501073_1183002 3300049589 Bacteria 525
379 Ga0501074_0208229 3300049590 Bacteria 1393
380 Ga0501075_0408074 3300049591 Bacteria 1036
381 Ga0501079_0102222 3300049741 Bacteria 2223
382 Ga0501079_1566520 3300049741 Bacteria 518
383 Ga0501079_1628989 3300049741 Bacteria 508
384 Ga0501080_0051697 3300049742 Bacteria 3824
385 Ga0501080_0250441 3300049742 Bacteria 1615
386 Ga0501083_0490670 3300049744 Bacteria 799
387 Ga0501035_0272858 3300049822 Bacteria 1431
388 Ga0501035_1007578 3300049822 Bacteria 655
389 Ga0501044_0001258 3300049823 Bacteria 29983
390 Ga0501044_0002333 3300049823 Bacteria 21640
391 Ga0501044_0236502 3300049823 Bacteria 1772
392 nmdc:mga03683_27326_c1 3300050489 Bacteria 1598
393 nmdc:mga03n38_167145_c1 3300050490 Bacteria 1118
394 nmdc:mga03n38_26182_c1 3300050490 Bacteria 2406
395 nmdc:mga03n38_64218_c1 3300050490 Bacteria 1680
396 nmdc:mga03n38_676108_c1 3300050490 Bacteria 593
397 nmdc:mga00v17_133860_c1 3300050491 Bacteria 1586
398 nmdc:mga00v17_134934_c1 3300050491 Bacteria 1579
399 nmdc:mga00v17_13795_c1 3300050491 Bacteria 4493
400 nmdc:mga00v17_150567_c1 3300050491 Bacteria 1495
401 nmdc:mga00v17_51684_c1 3300050491 Bacteria 2499
402 nmdc:mga00v17_56612_c1 3300050491 Bacteria 1949
403 nmdc:mga00v17_577877_c1 3300050491 Bacteria 725
404 nmdc:mga00v17_7957_c1 3300050491 Bacteria 5683
405 nmdc:mga00v17_810325_c1 3300050491 Bacteria 596
406 nmdc:mga00v17_845542_c1 3300050491 Bacteria 581
407 nmdc:mga0yw44_112450_c1 3300050492 Bacteria 1746
408 nmdc:mga0yw44_13574_c1 3300050492 Bacteria 4294
409 nmdc:mga0yw44_255013_c1 3300050492 Bacteria 1168
410 nmdc:mga0yw44_27435_c1 3300050492 Bacteria 3261
411 nmdc:mga0yw44_280503_c1 3300050492 Bacteria 1113
412 nmdc:mga0yw44_309201_c1 3300050492 Unclassified 1060
413 nmdc:mga0yw44_360007_c1 3300050492 Bacteria 980
414 nmdc:mga0yw44_54925_c1 3300050492 Bacteria 2422
415 nmdc:mga0yw44_6816_c1 3300050492 Bacteria 5554
416 nmdc:mga0yw44_759580_c1 3300050492 Bacteria 658
417 nmdc:mga0yw44_7742_c1 3300050492 Bacteria 5306
418 nmdc:mga06z11_144671_c1 3300050494 Bacteria 1346
419 nmdc:mga06z11_326595_c1 3300050494 Unclassified 916
420 nmdc:mga06z11_353481_c1 3300050494 Unclassified 880
421 nmdc:mga06z11_565283_c1 3300050494 Bacteria 691
422 nmdc:mga06z11_93757_c1 3300050494 Bacteria 1069
423 nmdc:mga04h51_184489_c1 3300050495 Bacteria 813
424 nmdc:mga07m45_557833_c1 3300050496 Bacteria 662
425 nmdc:mga07m45_698781_c1 3300050496 Bacteria 583
426 nmdc:mga05p37_1131902_c1 3300050507 Bacteria 816
427 nmdc:mga05p37_1162250_c1 3300050507 Bacteria 802
428 nmdc:mga05p37_142271_c1 3300050507 Bacteria 2938
429 nmdc:mga05p37_227_c1 3300050507 Bacteria 57142
430 nmdc:mga05p37_60938_c1 3300050507 Bacteria 4646
431 nmdc:mga05p37_819614_c1 3300050507 Bacteria 1015
432 nmdc:mga09592_1140863_c1 3300050508 Bacteria 646
433 nmdc:mga09592_1385013_c1 3300050508 Bacteria 576
434 nmdc:mga09592_218068_c1 3300050508 Bacteria 1653
435 nmdc:mga09592_323_c1 3300050508 Bacteria 34887
436 nmdc:mga09592_402742_c1 3300050508 Bacteria 1183
437 nmdc:mga09592_428_c1 3300050508 Bacteria 30978
438 nmdc:mga09592_558512_c1 3300050508 Bacteria 983
439 nmdc:mga09592_900820_c1 3300050508 Bacteria 744
440 nmdc:mga0qj67_13640_c1 3300050509 Bacteria 6131
441 nmdc:mga0qj67_1542010_c1 3300050509 Bacteria 510
442 nmdc:mga0qj67_204373_c1 3300050509 Bacteria 1604
443 nmdc:mga0qj67_223706_c1 3300050509 Bacteria 1528
444 nmdc:mga0qj67_548641_c1 3300050509 Bacteria 927
445 nmdc:mga0qj67_849934_c1 3300050509 Bacteria 721
446 nmdc:mga0qj67_9570_c1 3300050509 Bacteria 7222
447 nmdc:mga06r32_171481_c1 3300050510 Bacteria 2154
448 nmdc:mga06r32_2794_c1 3300050510 Bacteria 15630
449 nmdc:mga06r32_309400_c1 3300050510 Bacteria 1566
450 nmdc:mga06r32_3967_c1 3300050510 Bacteria 13267
451 nmdc:mga06r32_718696_c1 3300050510 Bacteria 964
452 nmdc:mga06r32_922566_c1 3300050510 Bacteria 829
453 nmdc:mga08y16_1167061_c1 3300050511 Bacteria 742
454 nmdc:mga08y16_335850_c1 3300050511 Bacteria 1554
455 nmdc:mga08y16_515987_c1 3300050511 Bacteria 1213
456 nmdc:mga0sz30_140704_c1 3300050516 Bacteria 1065
457 nmdc:mga0sz30_47150_c1 3300050516 Bacteria 1820
458 Ga0495601_0029598 3300053077 Bacteria 3398
459 Ga0495601_0234536 3300053077 Bacteria 1198
460 Ga0495612_0137414 3300053078 Bacteria 1059
461 Ga0500635_0026235 3300053080 Bacteria 1842
462 Ga0495595_0184123 3300053084 Bacteria 1036
463 Ga0495595_0262431 3300053084 Bacteria 866
464 Ga0495619_0014538 3300053085 Bacteria 4972
465 Ga0495619_0016896 3300053085 Bacteria 4622
466 Ga0495619_0051647 3300053085 Bacteria 2717
467 Ga0495619_0159866 3300053085 Bacteria 1556
468 Ga0495619_0171637 3300053085 Bacteria 1500
469 Ga0495619_0305981 3300053085 Bacteria 1101
470 Ga0500583_0389578 3300053092 Bacteria 670
471 Ga0500566_0000051 3300053094 Bacteria 57633
472 Ga0500566_0365006 3300053094 Unclassified 657
473 Ga0500568_0007165 3300053139 Bacteria 5501
474 Ga0500616_0000146 3300053153 Bacteria 119628
475 Ga0500616_0000149 3300053153 Bacteria 118968
476 Ga0500616_0010576 3300053153 Bacteria 5510
477 Ga0501082_0065485 3300060353 Bacteria 3130
478 Ga0501082_0834872 3300060353 Bacteria 806
479 Ga0451791_1500389
480 Ga0070670_101641159
481 Ga0068869_101477637
482 Ga0070682_101078898
483 Ga0068868_100657610
484 Ga0070669_100348993
485 Ga0070671_100003857
486 Ga0070673_101234145
487 Ga0070667_100135970
488 Ga0070708_100150015
489 Ga0070708_100197351
490 Ga0070708_100401478
491 Ga0070663_100777830
492 Ga0070663_101774999
493 Ga0070678_101707111
494 Ga0070681_11551797
495 Ga0068867_100423127
496 Ga0070685_10673482
497 Ga0070685_11426981
498 Ga0070706_100034309
499 Ga0070706_100367262
500 Ga0070706_100403307
501 Ga0070706_100824197
502 Ga0070707_100439697
503 Ga0070707_101566983
504 Ga0070697_100058305
505 Ga0070696_101776758
506 Ga0070665_101693019
507 Ga0068856_100846149
508 Ga0070702_101039240
509 Ga0068866_10917567
510 Ga0068861_101718132
511 Ga0068870_11135288
512 Ga0068863_100095406
513 Ga0068858_101045198
514 Ga0068858_102425313
515 Ga0068860_100959524
516 Ga0068862_102208514
517 Ga0081455_10023380
518 Ga0081455_10076633
519 Ga0081455_10465996
520 Ga0081538_10000385
521 Ga0075365_10003285
522 Ga0075365_10010802
523 Ga0075365_10017758
524 Ga0075365_10035889
525 Ga0075365_10113710
526 Ga0075365_10183410
527 Ga0075365_10727823
528 Ga0075365_10735531
529 Ga0075365_10780516
530 Ga0075365_10887869
531 Ga0075368_10031636
532 Ga0075368_10131175
533 Ga0075368_10179126
534 Ga0075363_100038639
535 Ga0075363_100099590
536 Ga0075363_100108966
537 Ga0075363_100113164
538 Ga0075363_100118018
539 Ga0075363_100130467
540 Ga0075363_100180808
541 Ga0075363_100280148
542 Ga0075363_100492245
543 Ga0075364_10000967
544 Ga0075364_10003844
545 Ga0075364_10089572
546 Ga0075364_10104184
547 Ga0075364_10163178
548 Ga0075362_10009977
549 Ga0075362_10048569
550 Ga0075362_10266023
551 Ga0075367_10036408
552 Ga0075367_10053574
553 Ga0075367_10297921
554 Ga0075367_10552557
555 Ga0075369_10016694
556 Ga0075427_10048783
557 Ga0075370_10058483
558 Ga0075370_10203274
559 Ga0075370_10753507
560 Ga0075428_100000250
561 Ga0075428_100080278
562 Ga0075428_100159526
563 Ga0075428_100166748
564 Ga0075428_100739790
565 Ga0075430_100007194
566 Ga0075430_100012608
567 Ga0075430_100949010
568 Ga0075431_100001023
569 Ga0075431_100002952
570 Ga0075431_100203946
571 Ga0075431_100303544
572 Ga0075431_101398701
573 Ga0075429_100000110
574 Ga0075429_100007681
575 Ga0075429_100010872
576 Ga0075429_100145234
577 Ga0075429_100540052
578 Ga0075429_100892672
579 Ga0075435_100423090
580 Ga0111539_10033710
581 Ga0111539_10037355
582 Ga0111539_10289505
583 Ga0111539_11035006
584 Ga0105245_10026115
585 Ga0105245_10335153
586 Ga0105245_11840897
587 Ga0114129_10000293
588 Ga0114129_10081793
589 Ga0114129_10380970
590 Ga0114129_10471671
591 Ga0114129_10852921
592 Ga0114129_11339848
593 Ga0114129_11469644
594 Ga0114129_12523407
595 Ga0105243_11607645
596 Ga0105242_10340485
597 Ga0105248_10454167
598 Ga0105248_10730641
599 Ga0105237_11355378
600 Ga0105238_11989419
601 Ga0105249_12546634
602 Ga0105239_12512776
603 Ga0105239_13083182
604 Ga0105246_12072315
605 Ga0157374_11716116
606 Ga0157378_10104396
607 Ga0157378_10164600
608 Ga0157378_12812982
609 Ga0163162_11383829
610 Ga0157375_10701656
611 Ga0157375_11428643
612 Ga0163163_11480838
613 Ga0163163_11548848
614 Ga0157380_10438174
615 Ga0157380_10577302
616 Ga0157379_11370124
617 Ga0157376_11034479
618 Ga0163161_11695526
619 Ga0197907_10403055
620 Ga0213871_10168935
621 Ga0224712_10306402
622 Ga0224712_10469906
623 Ga0224712_10623754
624 Ga0207688_10686564
625 Ga0207684_10194052
626 Ga0207684_10207646
627 Ga0207684_10401516
628 Ga0207684_10653682
629 Ga0207646_10420319
630 Ga0207646_10466687
631 Ga0207681_10332058
632 Ga0207681_10773688
633 Ga0207650_10242183
634 Ga0207650_10835924
635 Ga0207650_11321452
636 Ga0207687_10002682
637 Ga0207644_10006487
638 Ga0207686_11380641
639 Ga0207686_11554004
640 Ga0207686_11791046
641 Ga0207670_10251452
642 Ga0207669_11553055
643 Ga0207689_10214539
644 Ga0207661_12126775
645 Ga0207651_11012554
646 Ga0207668_10549024
647 Ga0207658_10237063
648 Ga0207677_10226821
649 Ga0207677_11035999
650 Ga0207703_10052681
651 Ga0207702_12153588
652 Ga0207641_10376616
653 Ga0207676_12095438
654 Ga0207675_101410914
655 Ga0209813_10117647
656 Ga0209813_10159444
657 Ga0207428_10184530
658 Ga0268266_11450049
659 Ga0265338_10179739
660 Ga0265338_10497596
661 Ga0265328_10192613
662 Ga0265327_10010205
663 Ga0265327_10019898
664 Ga0265327_10025369
665 Ga0265327_10216645
666 Ga0265316_11203673
667 Ga0316579_10300903
668 Ga0316576_10065693
669 Ga0316576_10872637
670 Ga0316578_10098857
671 Ga0316577_10047150
672 Ga0307409_100790361
673 Ga0307409_101816732
674 Ga0307415_101137259
675 Ga0307415_101400575
676 Ga0316585_10108098
677 Ga0373930_0001024
678 Ga0373928_0000370
679 Ga0373928_0071152
680 Ga0373928_0278238
681 Ga0373929_0028035
682 Ga0373929_0037369
683 Ga0373932_0044622
684 Ga0373932_0188170
685 Ga0316574_0089404
686 Ga0316574_0161584
687 Ga0316574_0257284
688 Ga0373931_0000032
689 Ga0373931_0000146
690 Ga0373947_0477537
691 Ga0373937_1420690
692 Ga0316582_0171072
693 Ga0316584_0008524
694 Ga0316584_0068540
695 Ga0316584_0980587
696 Ga0436364_0651656
697 Ga0400485_13045
698 Ga0400483_048441
699 Ga0400483_050686
700 Ga0400483_095400
701 Ga0400483_098082
702 Ga0400483_132392
703 Ga0400483_166649
704 Ga0400483_195830
705 Ga0400483_234306
706 Ga0400483_267148
707 Ga0400483_291742
708 Ga0436365_0602433
709 Ga0436360_0006345
710 Ga0436363_0666382
711 Ga0436363_0938563
712 Ga0451789_0291600
713 Ga0451791_1635519
714 Ga0451802_1989186
715 Ga0451849_0014478
716 Ga0439454_113349
717 Ga0451577_0012738
718 Ga0439440_0056047
719 Ga0466969_0460252
720 Ga0466966_0894956
721 Ga0453684_0002246
722 Ga0466968_0309804
723 Ga0466959_0308128
724 Ga0495592_0380267
725 Ga0495629_0054279
726 Ga0495629_0599055
727 Ga0495629_0957442
728 Ga0495641_0078189
729 Ga0495653_0130839
730 Ga0495653_0336519
731 Ga0495653_0426342
732 Ga0495582_0032809
733 Ga0495639_0021402
734 Ga0495639_0569436
735 Ga0495664_0047211
736 Ga0495594_0831054
737 Ga0495608_0052271
738 Ga0495618_0333025
739 Ga0495628_0012034
740 Ga0495628_0239789
741 Ga0495628_0574877
742 Ga0495630_0108932
743 Ga0495630_0173574
744 Ga0495630_0718170
745 Ga0495630_0912215
746 Ga0495666_0579659
747 Ga0495640_0061835
748 Ga0495586_0123779
749 Ga0495587_0836332
750 Ga0495621_0007471
751 Ga0495634_0003110
752 Ga0495634_0708778
753 Ga0495635_0628166
754 Ga0495635_0630960
755 Ga0495588_0080703
756 Ga0495657_0303863
757 Ga0495657_0437863
758 Ga0495623_0336796
759 Ga0495646_0095119
760 Ga0495646_0282217
761 Ga0495647_0021146
762 Ga0495658_0023296
763 Ga0495658_0258368
764 Ga0495613_0000418
765 Ga0495613_0604158
766 Ga0495613_1008999
767 Ga0495670_0245713
768 Ga0495649_0685386
769 Ga0495589_0518978
770 Ga0495604_0284474
771 Ga0495604_0285891
772 Ga0495674_0049848
773 Ga0495674_0103767
774 Ga0495674_1043599
775 Ga0495674_1360281
776 Ga0495674_1423566
777 Ga0495676_0213412
778 Ga0495676_0454086
779 Ga0495676_0496077
780 Ga0495683_0434789
781 Ga0495684_0704232
782 Ga0495684_1003690
783 Ga0495614_0014956
784 Ga0496102_0264680
785 Ga0496104_0135362
786 Ga0496104_0235430
787 Ga0496104_0514393
788 Ga0496104_0672576
789 Ga0496104_0876137
790 Ga0496105_0607915
791 Ga0496106_0212951
792 Ga0496106_1351903
793 Ga0496107_0277865
794 Ga0496108_0066218
795 Ga0496108_0146688
796 Ga0496109_0136195
797 Ga0496109_0167209
798 Ga0496109_0318755
799 Ga0496109_2054843
800 Ga0496110_0076774
801 Ga0496110_0310516
802 Ga0496110_0475967
803 Ga0496110_1005707
804 Ga0496111_0080942
805 Ga0496111_0807944
806 Ga0496112_0018873
807 Ga0496112_0852275
808 Ga0496113_0112257
809 Ga0496113_0266875
810 Ga0496114_0348799
811 Ga0496115_0598723
812 Ga0501031_0460231
813 Ga0501032_0002410
814 Ga0501033_0014023
815 Ga0501034_0008101
816 Ga0501034_0027379
817 Ga0501034_0066097
818 Ga0501034_0162973
819 Ga0501034_0643266
820 Ga0501034_1064173
821 Ga0501034_1168030
822 Ga0501036_0440519
823 Ga0501036_0673319
824 Ga0501037_0000990
825 Ga0501038_0103696
826 Ga0501039_0404641
827 Ga0501040_1065397
828 Ga0501041_0021488
829 Ga0501042_0084542
830 Ga0501043_0032484
831 Ga0501043_0232310
832 Ga0501043_0333928
833 Ga0501046_0021215
834 Ga0501046_0242805
835 Ga0501047_0045492
836 Ga0501047_0137715
837 Ga0501047_0161023
838 Ga0501047_0858870
839 Ga0501048_0092090
840 Ga0501048_0308701
841 Ga0501068_0040196
842 Ga0501068_0047757
843 Ga0501068_0435026
844 Ga0501068_0449386
845 Ga0501068_0467607
846 Ga0501068_0472205
847 Ga0501070_0025818
848 Ga0501070_0055762
849 Ga0501070_0136425
850 Ga0501071_0403509
851 Ga0501071_0772581
852 Ga0501072_0147307
853 Ga0501072_0661170
854 Ga0501073_0287892
855 Ga0501073_0367531
856 Ga0501073_1183002
857 Ga0501074_0208229
858 Ga0501075_0408074
859 Ga0501079_0102222
860 Ga0501079_1566520
861 Ga0501079_1628989
862 Ga0501080_0051697
863 Ga0501080_0250441
864 Ga0501083_0490670
865 Ga0501035_0272858
866 Ga0501035_1007578
867 Ga0501044_0001258
868 Ga0501044_0002333
869 Ga0501044_0236502
870 nmdc:mga03683_27326_c1
871 nmdc:mga03n38_167145_c1
872 nmdc:mga03n38_26182_c1
873 nmdc:mga03n38_64218_c1
874 nmdc:mga03n38_676108_c1
875 nmdc:mga00v17_133860_c1
876 nmdc:mga00v17_134934_c1
877 nmdc:mga00v17_13795_c1
878 nmdc:mga00v17_150567_c1
879 nmdc:mga00v17_51684_c1
880 nmdc:mga00v17_56612_c1
881 nmdc:mga00v17_577877_c1
882 nmdc:mga00v17_7957_c1
883 nmdc:mga00v17_810325_c1
884 nmdc:mga00v17_845542_c1
885 nmdc:mga0yw44_112450_c1
886 nmdc:mga0yw44_13574_c1
887 nmdc:mga0yw44_255013_c1
888 nmdc:mga0yw44_27435_c1
889 nmdc:mga0yw44_280503_c1
890 nmdc:mga0yw44_309201_c1
891 nmdc:mga0yw44_360007_c1
892 nmdc:mga0yw44_54925_c1
893 nmdc:mga0yw44_6816_c1
894 nmdc:mga0yw44_759580_c1
895 nmdc:mga0yw44_7742_c1
896 nmdc:mga06z11_144671_c1
897 nmdc:mga06z11_326595_c1
898 nmdc:mga06z11_353481_c1
899 nmdc:mga06z11_565283_c1
900 nmdc:mga06z11_93757_c1
901 nmdc:mga04h51_184489_c1
902 nmdc:mga07m45_557833_c1
903 nmdc:mga07m45_698781_c1
904 nmdc:mga05p37_1131902_c1
905 nmdc:mga05p37_1162250_c1
906 nmdc:mga05p37_142271_c1
907 nmdc:mga05p37_227_c1
908 nmdc:mga05p37_60938_c1
909 nmdc:mga05p37_819614_c1
910 nmdc:mga09592_1140863_c1
911 nmdc:mga09592_1385013_c1
912 nmdc:mga09592_218068_c1
913 nmdc:mga09592_323_c1
914 nmdc:mga09592_402742_c1
915 nmdc:mga09592_428_c1
916 nmdc:mga09592_558512_c1
917 nmdc:mga09592_900820_c1
918 nmdc:mga0qj67_13640_c1
919 nmdc:mga0qj67_1542010_c1
920 nmdc:mga0qj67_204373_c1
921 nmdc:mga0qj67_223706_c1
922 nmdc:mga0qj67_548641_c1
923 nmdc:mga0qj67_849934_c1
924 nmdc:mga0qj67_9570_c1
925 nmdc:mga06r32_171481_c1
926 nmdc:mga06r32_2794_c1
927 nmdc:mga06r32_309400_c1
928 nmdc:mga06r32_3967_c1
929 nmdc:mga06r32_718696_c1
930 nmdc:mga06r32_922566_c1
931 nmdc:mga08y16_1167061_c1
932 nmdc:mga08y16_335850_c1
933 nmdc:mga08y16_515987_c1
934 nmdc:mga0sz30_140704_c1
935 nmdc:mga0sz30_47150_c1
936 Ga0495601_0029598
937 Ga0495601_0234536
938 Ga0495612_0137414
939 Ga0500635_0026235
940 Ga0495595_0184123
941 Ga0495595_0262431
942 Ga0495619_0014538
943 Ga0495619_0016896
944 Ga0495619_0051647
945 Ga0495619_0159866
946 Ga0495619_0171637
947 Ga0495619_0305981
948 Ga0500583_0389578
949 Ga0500566_0000051
950 Ga0500566_0365006
951 Ga0500568_0007165
952 Ga0500616_0000146
953 Ga0500616_0000149
954 Ga0500616_0010576
955 Ga0501082_0065485
956 Ga0501082_0834872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02625

XdhC_CoxI

XdhC and CoxI family

23

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2we7-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.8635 2 103
2we8-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.8473 3 103
2we7-assembly2.cif.gz_B-3 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.8132 2 103
3on5-assembly1.cif.gz_A crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution 0.771 5 104
3on5-assembly1.cif.gz_A crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution 0.7326 5 104
ID Description Score Start End Superfamily
af_A0A1D6JF34_14_351_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.7102 3 29 3.30.70.270
1tedB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.5368 52 104 3.40.47.10
af_Q9SGJ0_12_167_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.4667 36 105 2.60.40.150
af_Q94269_374_541_3.40.50.12670 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.46 55 81 3.40.50.12670
af_I1N356_1196_1364_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4327 23 50 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A538HMN7-F1-model_v4 XdhC family protein 0.948 1 105
AF-A0A535EJD9-F1-model_v4 XdhC family protein 0.9198 1 104
AF-A0A1M5QIA4-F1-model_v4 CO or xanthine dehydrogenase, Mo-binding subunit 0.9191 2 104 GO:0016491
AF-A0A6J4MFV2-F1-model_v4 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family 0.9107 2 104
AF-A0A3E0NRG6-F1-model_v4 XdhC family protein 0.91 1 105

Map