F451862

General Info

Members Datasets Scaffolds Average Seq Length
478 186 956 349

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100036227|Ga0075428_1000362274
Length 376
Sequence MTGGGAVAAWLGRLRPRIGLAAAWARQIGDAGAGAYTAVMRPAPSAVVVVGTVLLASIASAHHSFAPHFDSSRPANISGTITKFEAQNPHSYVHITAVDESGRTREYVCESHGVTQLARNGITPQLLKAGTKVRVTGSMSRHSAYMCFFDTIEFADGRKMSVNGPTGSARPPAPTLPVRVDIFGTWLLAPIANRSTSGPQPMTQYLTPAGEKAVAAYDPFKDDPTFRCDPVAIRRVWAAPGTPLEIVRQGNDVVLHHEWMDVRRVVHMNMKDHPKNGWDGDTLVIETANYSAGVLSQYVEQPGQPTRGLLHSAALTSVERLHLDAARQRLVVEIDLADPDFFTQAFPRSTTEYAPSALKIEPFNCSREGVTGTIRK

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 1.05
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 16.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100036227 3300006844 Bacteria 5435
2 JGI25406J46586_10004008 3300003203 Bacteria 6889
3 JGI25406J46586_10005597 3300003203 Bacteria 5819
4 Ga0065712_10000563 3300005290 Bacteria 16585
5 Ga0065712_10008128 3300005290 Bacteria 2301
6 Ga0065712_10102351 3300005290 Bacteria 2011
7 Ga0065715_10129262 3300005293 Bacteria 2046
8 Ga0065715_10195078 3300005293 Bacteria 1392
9 Ga0070676_10057529 3300005328 Bacteria 2301
10 Ga0070690_100001605 3300005330 Bacteria 11867
11 Ga0070690_100015001 3300005330 Bacteria 4610
12 Ga0070690_100097907 3300005330 Bacteria 1941
13 Ga0070690_100120131 3300005330 Bacteria 1763
14 Ga0070690_100148582 3300005330 Archaea 1597
15 Ga0070670_100001066 3300005331 Bacteria 21769
16 Ga0070670_100007118 3300005331 Bacteria 9472
17 Ga0070670_100021432 3300005331 Bacteria 5559
18 Ga0070670_100039099 3300005331 Unclassified 4079
19 Ga0070670_100082589 3300005331 Unclassified 2761
20 Ga0070677_10031556 3300005333 Bacteria 2025
21 Ga0070666_10043636 3300005335 Bacteria 3003
22 Ga0070666_10102414 3300005335 Bacteria 1974
23 Ga0070666_10159545 3300005335 Bacteria 1576
24 Ga0070682_100194346 3300005337 Unclassified 1427
25 Ga0068868_100014542 3300005338 Bacteria 5803
26 Ga0068868_100262257 3300005338 Unclassified 1457
27 Ga0068868_100399798 3300005338 Bacteria 1185
28 Ga0070689_100019467 3300005340 Bacteria 5020
29 Ga0070689_100024907 3300005340 Bacteria 4491
30 Ga0070689_100038344 3300005340 Unclassified 3666
31 Ga0070689_100086448 3300005340 Bacteria 2466
32 Ga0070689_100100737 3300005340 Bacteria 2286
33 Ga0070689_100281865 3300005340 Bacteria 1379
34 Ga0070687_100076774 3300005343 Bacteria 1810
35 Ga0070687_100199662 3300005343 Bacteria 1211
36 Ga0070661_100013108 3300005344 Bacteria 5816
37 Ga0070661_100016758 3300005344 Bacteria 5187
38 Ga0070661_100045591 3300005344 Unclassified 3205
39 Ga0070661_100295691 3300005344 Bacteria 1259
40 Ga0070668_100409003 3300005347 Unclassified 1160
41 Ga0070669_100018707 3300005353 Unclassified 4951
42 Ga0070669_100025963 3300005353 Unclassified 4213
43 Ga0070669_100046891 3300005353 Bacteria 3151
44 Ga0070669_100224118 3300005353 Bacteria 1487
45 Ga0070675_100000385 3300005354 Bacteria 29879
46 Ga0070675_100000754 3300005354 Bacteria 22571
47 Ga0070675_100001280 3300005354 Bacteria 18369
48 Ga0070675_100003020 3300005354 Bacteria 12700
49 Ga0070675_100003407 3300005354 Bacteria 12041
50 Ga0070675_100068489 3300005354 Bacteria 2939
51 Ga0070675_100082854 3300005354 Bacteria 2676
52 Ga0070675_100087469 3300005354 Bacteria 2606
53 Ga0070675_100089608 3300005354 Bacteria 2576
54 Ga0070675_100118407 3300005354 Bacteria 2249
55 Ga0070671_100002255 3300005355 Bacteria 14888
56 Ga0070671_100019640 3300005355 Bacteria 5502
57 Ga0070671_100019793 3300005355 Bacteria 5483
58 Ga0070674_100000428 3300005356 Bacteria 21246
59 Ga0070674_100168601 3300005356 Bacteria 1667
60 Ga0070674_100247326 3300005356 Bacteria 1399
61 Ga0070673_100063490 3300005364 Bacteria 2939
62 Ga0070673_100154222 3300005364 Bacteria 1948
63 Ga0070673_100171363 3300005364 Unclassified 1853
64 Ga0070673_100192913 3300005364 Bacteria 1751
65 Ga0070688_100061383 3300005365 Bacteria 2376
66 Ga0070688_100077015 3300005365 Unclassified 2148
67 Ga0070688_100084208 3300005365 Bacteria 2065
68 Ga0070688_100088599 3300005365 Bacteria 2018
69 Ga0070688_100199148 3300005365 Bacteria 1400
70 Ga0070659_100019352 3300005366 Bacteria 5158
71 Ga0070667_100080060 3300005367 Bacteria 2793
72 Ga0070667_100164822 3300005367 Bacteria 1954
73 Ga0070667_100237807 3300005367 Unclassified 1625
74 Ga0070713_100010988 3300005436 Bacteria 6568
75 Ga0070701_10078495 3300005438 Bacteria 1781
76 Ga0070700_100019607 3300005441 Bacteria 3906
77 Ga0070663_100045671 3300005455 Bacteria 3096
78 Ga0070678_100039027 3300005456 Bacteria 3347
79 Ga0070678_100121799 3300005456 Bacteria 2058
80 Ga0070662_100256740 3300005457 Unclassified 1407
81 Ga0070662_100303638 3300005457 Bacteria 1297
82 Ga0068867_100011381 3300005459 Bacteria 6278
83 Ga0070685_10010438 3300005466 Bacteria 4826
84 Ga0070685_10023175 3300005466 Unclassified 3397
85 Ga0070685_10101883 3300005466 Unclassified 1755
86 Ga0070672_100016304 3300005543 Bacteria 5318
87 Ga0070672_100035696 3300005543 Bacteria 3780
88 Ga0070672_100064869 3300005543 Bacteria 2887
89 Ga0070686_100068448 3300005544 Unclassified 2315
90 Ga0070686_100147742 3300005544 Bacteria 1643
91 Ga0070686_100314699 3300005544 Bacteria 1165
92 Ga0070665_100040483 3300005548 Bacteria 4684
93 Ga0070665_100086196 3300005548 Bacteria 3146
94 Ga0070664_100000389 3300005564 Bacteria 32754
95 Ga0070664_100008448 3300005564 Bacteria 8329
96 Ga0070664_100017279 3300005564 Bacteria 5924
97 Ga0070664_100036522 3300005564 Unclassified 4128
98 Ga0070664_100144928 3300005564 Bacteria 2094
99 Ga0068854_100042268 3300005578 Bacteria 3225
100 Ga0070702_100019123 3300005615 Unclassified 3565
101 Ga0068859_100000498 3300005617 Bacteria 38756
102 Ga0068859_100017826 3300005617 Bacteria 7137
103 Ga0068859_100022940 3300005617 Bacteria 6259
104 Ga0068859_100044560 3300005617 Bacteria 4457
105 Ga0068859_100064601 3300005617 Bacteria 3692
106 Ga0068859_100162217 3300005617 Unclassified 2314
107 Ga0068864_100001026 3300005618 Bacteria 23370
108 Ga0068864_100003714 3300005618 Bacteria 12600
109 Ga0068864_100081333 3300005618 Bacteria 2840
110 Ga0068864_100252443 3300005618 Bacteria 1638
111 Ga0068861_100010844 3300005719 Bacteria 6334
112 Ga0068861_100047167 3300005719 Unclassified 3251
113 Ga0068861_100209874 3300005719 Bacteria 1640
114 Ga0068851_10182181 3300005834 Bacteria 1164
115 Ga0068870_10010112 3300005840 Bacteria 4318
116 Ga0068870_10064437 3300005840 Bacteria 1979
117 Ga0068863_100001165 3300005841 Bacteria 26255
118 Ga0068863_100015746 3300005841 Bacteria 7261
119 Ga0068863_100019812 3300005841 Bacteria 6434
120 Ga0068863_100189468 3300005841 Unclassified 1976
121 Ga0068863_100228571 3300005841 Bacteria 1794
122 Ga0068863_100287358 3300005841 Bacteria 1594
123 Ga0068858_100054894 3300005842 Bacteria 3684
124 Ga0068858_100084589 3300005842 Bacteria 2950
125 Ga0068858_100178467 3300005842 Bacteria 2005
126 Ga0068860_100032724 3300005843 Bacteria 4995
127 Ga0068860_100044890 3300005843 Bacteria 4212
128 Ga0068860_100251341 3300005843 Bacteria 1722
129 Ga0068860_100298909 3300005843 Bacteria 1577
130 Ga0068860_100299578 3300005843 Bacteria 1575
131 Ga0068860_100369822 3300005843 Bacteria 1414
132 Ga0068862_100003127 3300005844 Bacteria 14405
133 Ga0068862_100089298 3300005844 Bacteria 2682
134 Ga0068862_100143061 3300005844 Unclassified 2124
135 Ga0081455_10304775 3300005937 Bacteria 1141
136 Ga0081539_10000071 3300005985 Bacteria 233094
137 Ga0081539_10000960 3300005985 Bacteria 54037
138 Ga0081539_10006520 3300005985 Bacteria 11148
139 Ga0097621_100001992 3300006237 Bacteria 13928
140 Ga0097621_100016897 3300006237 Bacteria 5530
141 Ga0097621_100158435 3300006237 Unclassified 1945
142 Ga0097621_100353565 3300006237 Bacteria 1307
143 Ga0068871_100003123 3300006358 Bacteria 11370
144 Ga0068871_100008591 3300006358 Bacteria 7343
145 Ga0068871_100017283 3300006358 Bacteria 5455
146 Ga0068871_100140659 3300006358 Bacteria 2052
147 Ga0075428_100011073 3300006844 Bacteria 10033
148 Ga0075428_100036246 3300006844 Bacteria 5434
149 Ga0075428_100055177 3300006844 Bacteria 4353
150 Ga0075430_100006930 3300006846 Bacteria 9552
151 Ga0075430_100017932 3300006846 Bacteria 6024
152 Ga0075430_100055086 3300006846 Bacteria 3345
153 Ga0075430_100151709 3300006846 Unclassified 1930
154 Ga0075431_100000430 3300006847 Bacteria 34249
155 Ga0075431_100012119 3300006847 Bacteria 8698
156 Ga0075431_100032074 3300006847 Bacteria 5414
157 Ga0075431_100052025 3300006847 Bacteria 4223
158 Ga0075433_10100757 3300006852 Bacteria 2558
159 Ga0075433_10139009 3300006852 Bacteria 2159
160 Ga0075434_100008589 3300006871 Bacteria 9506
161 Ga0075434_100012945 3300006871 Bacteria 7923
162 Ga0075434_100036413 3300006871 Bacteria 4867
163 Ga0075434_100094797 3300006871 Bacteria 2990
164 Ga0075429_100003709 3300006880 Bacteria 13019
165 Ga0075429_100154578 3300006880 Bacteria 2009
166 Ga0075429_100182588 3300006880 Bacteria 1838
167 Ga0075429_100275041 3300006880 Bacteria 1475
168 Ga0068865_100171135 3300006881 Bacteria 1665
169 Ga0068865_100255889 3300006881 Bacteria 1384
170 Ga0097620_100000498 3300006931 Bacteria 38756
171 Ga0097620_100017826 3300006931 Bacteria 7137
172 Ga0097620_100022939 3300006931 Bacteria 6259
173 Ga0097620_100044561 3300006931 Bacteria 4457
174 Ga0097620_100064598 3300006931 Bacteria 3692
175 Ga0097620_100162204 3300006931 Unclassified 2314
176 Ga0075435_100018779 3300007076 Bacteria 5267
177 Ga0075435_100186296 3300007076 Bacteria 1755
178 Ga0111539_10001480 3300009094 Bacteria 31387
179 Ga0111539_10001637 3300009094 Bacteria 29911
180 Ga0111539_10012653 3300009094 Bacteria 10571
181 Ga0111539_10018641 3300009094 Bacteria 8595
182 Ga0111539_10030503 3300009094 Bacteria 6553
183 Ga0111539_10056936 3300009094 Bacteria 4644
184 Ga0111539_10063192 3300009094 Bacteria 4381
185 Ga0111539_10088646 3300009094 Bacteria 3635
186 Ga0111539_10138327 3300009094 Bacteria 2852
187 Ga0111539_10239385 3300009094 Bacteria 2112
188 Ga0111539_10465944 3300009094 Bacteria 1471
189 Ga0105245_10092874 3300009098 Unclassified 2780
190 Ga0105247_10015888 3300009101 Bacteria 4508
191 Ga0114129_10028799 3300009147 Bacteria 7870
192 Ga0114129_10054554 3300009147 Bacteria 5603
193 Ga0114129_10056613 3300009147 Bacteria 5491
194 Ga0114129_10094012 3300009147 Unclassified 4152
195 Ga0114129_10119227 3300009147 Bacteria 3634
196 Ga0105248_10000903 3300009177 Bacteria 33203
197 Ga0105248_10002872 3300009177 Bacteria 19120
198 Ga0105248_10045678 3300009177 Bacteria 4911
199 Ga0105248_10217243 3300009177 Bacteria 2153
200 Ga0105248_10257355 3300009177 Unclassified 1965
201 Ga0105248_10421524 3300009177 Bacteria 1503
202 Ga0105238_10012956 3300009551 Bacteria 8417
203 Ga0105249_10002910 3300009553 Bacteria 14770
204 Ga0105239_10277722 3300010375 Unclassified 1885
205 Ga0105246_10014088 3300011119 Bacteria 5024
206 Ga0105246_10127375 3300011119 Bacteria 1896
207 Ga0105246_10199176 3300011119 Bacteria 1556
208 Ga0157374_10003306 3300013296 Bacteria 13543
209 Ga0157378_10035880 3300013297 Bacteria 4388
210 Ga0157378_10142211 3300013297 Bacteria 2229
211 Ga0163162_10013814 3300013306 Bacteria 7889
212 Ga0163162_10067221 3300013306 Bacteria 3634
213 Ga0163162_10088654 3300013306 Unclassified 3173
214 Ga0157375_10009195 3300013308 Bacteria 8663
215 Ga0157375_10075028 3300013308 Bacteria 3405
216 Ga0163163_10001890 3300014325 Bacteria 17718
217 Ga0163163_10007713 3300014325 Bacteria 9508
218 Ga0163163_10013274 3300014325 Bacteria 7536
219 Ga0163163_10063519 3300014325 Unclassified 3661
220 Ga0163163_10141199 3300014325 Bacteria 2451
221 Ga0163163_10144726 3300014325 Bacteria 2420
222 Ga0163163_10206616 3300014325 Bacteria 2012
223 Ga0163163_10215971 3300014325 Bacteria 1966
224 Ga0163163_10339924 3300014325 Bacteria 1556
225 Ga0157380_10007243 3300014326 Bacteria 7867
226 Ga0157380_10012628 3300014326 Bacteria 6129
227 Ga0157380_10030325 3300014326 Bacteria 4141
228 Ga0157380_10032941 3300014326 Bacteria 3988
229 Ga0157380_10116793 3300014326 Bacteria 2253
230 Ga0157380_10157299 3300014326 Bacteria 1971
231 Ga0157380_10269745 3300014326 Unclassified 1551
232 Ga0157377_10078279 3300014745 Bacteria 1927
233 Ga0157379_10000121 3300014968 Bacteria 54416
234 Ga0157379_10157609 3300014968 Unclassified 2048
235 Ga0157379_10221684 3300014968 Bacteria 1713
236 Ga0157376_10006221 3300014969 Bacteria 8414
237 Ga0157376_10027501 3300014969 Bacteria 4509
238 Ga0157376_10036864 3300014969 Bacteria 3964
239 Ga0157376_10133113 3300014969 Bacteria 2221
240 Ga0163161_10064485 3300017792 Unclassified 2672
241 Ga0163161_10064926 3300017792 Bacteria 2664
242 Ga0163161_10108226 3300017792 Unclassified 2075
243 Ga0213876_10076159 3300021384 Bacteria 1772
244 Ga0207697_10024472 3300025315 Bacteria 2471
245 Ga0207682_10002934 3300025893 Bacteria 7513
246 Ga0207682_10061796 3300025893 Unclassified 1569
247 Ga0207682_10076145 3300025893 Bacteria 1430
248 Ga0207642_10025806 3300025899 Bacteria 2383
249 Ga0207642_10057602 3300025899 Bacteria 1788
250 Ga0207688_10211871 3300025901 Bacteria 1164
251 Ga0207645_10055290 3300025907 Bacteria 2534
252 Ga0207643_10001612 3300025908 Bacteria 12731
253 Ga0207643_10006198 3300025908 Bacteria 6400
254 Ga0207643_10031231 3300025908 Bacteria 2968
255 Ga0207643_10033706 3300025908 Bacteria 2866
256 Ga0207662_10257551 3300025918 Unclassified 1147
257 Ga0207681_10005707 3300025923 Bacteria 7639
258 Ga0207681_10122029 3300025923 Bacteria 1912
259 Ga0207650_10036330 3300025925 Bacteria 3584
260 Ga0207650_10085062 3300025925 Bacteria 2405
261 Ga0207659_10000616 3300025926 Bacteria 21223
262 Ga0207659_10000768 3300025926 Bacteria 19072
263 Ga0207659_10002399 3300025926 Bacteria 11146
264 Ga0207659_10003009 3300025926 Bacteria 10048
265 Ga0207659_10005079 3300025926 Bacteria 7980
266 Ga0207659_10008013 3300025926 Bacteria 6535
267 Ga0207659_10009932 3300025926 Bacteria 5957
268 Ga0207659_10012955 3300025926 Bacteria 5326
269 Ga0207659_10015978 3300025926 Unclassified 4876
270 Ga0207659_10016856 3300025926 Bacteria 4763
271 Ga0207659_10043560 3300025926 Bacteria 3152
272 Ga0207659_10205277 3300025926 Bacteria 1576
273 Ga0207659_10277052 3300025926 Bacteria 1370
274 Ga0207687_10082522 3300025927 Unclassified 2326
275 Ga0207644_10008709 3300025931 Bacteria 6642
276 Ga0207644_10013291 3300025931 Bacteria 5484
277 Ga0207644_10034472 3300025931 Bacteria 3542
278 Ga0207690_10020394 3300025932 Unclassified 4096
279 Ga0207706_10038714 3300025933 Unclassified 4230
280 Ga0207706_10079553 3300025933 Bacteria 2882
281 Ga0207686_10025368 3300025934 Bacteria 3447
282 Ga0207686_10026459 3300025934 Unclassified 3384
283 Ga0207686_10292537 3300025934 Unclassified 1207
284 Ga0207709_10019664 3300025935 Bacteria 3801
285 Ga0207670_10007138 3300025936 Bacteria 6225
286 Ga0207670_10010095 3300025936 Bacteria 5422
287 Ga0207670_10033387 3300025936 Bacteria 3316
288 Ga0207670_10045155 3300025936 Bacteria 2919
289 Ga0207670_10145382 3300025936 Bacteria 1753
290 Ga0207670_10169602 3300025936 Bacteria 1635
291 Ga0207669_10002614 3300025937 Bacteria 7702
292 Ga0207669_10047575 3300025937 Bacteria 2542
293 Ga0207669_10048159 3300025937 Bacteria 2530
294 Ga0207704_10034815 3300025938 Bacteria 2878
295 Ga0207691_10014783 3300025940 Bacteria 7439
296 Ga0207691_10030816 3300025940 Bacteria 5010
297 Ga0207691_10050836 3300025940 Bacteria 3793
298 Ga0207691_10052724 3300025940 Bacteria 3715
299 Ga0207691_10170853 3300025940 Unclassified 1904
300 Ga0207711_10000188 3300025941 Bacteria 65983
301 Ga0207711_10002288 3300025941 Bacteria 17182
302 Ga0207711_10094722 3300025941 Unclassified 2632
303 Ga0207711_10157198 3300025941 Unclassified 2055
304 Ga0207689_10011387 3300025942 Bacteria 7622
305 Ga0207689_10015763 3300025942 Bacteria 6399
306 Ga0207689_10294913 3300025942 Unclassified 1344
307 Ga0207679_10024592 3300025945 Bacteria 4131
308 Ga0207679_10037932 3300025945 Bacteria 3430
309 Ga0207679_10100994 3300025945 Unclassified 2256
310 Ga0207679_10112116 3300025945 Unclassified 2155
311 Ga0207679_10183007 3300025945 Bacteria 1735
312 Ga0207651_10001187 3300025960 Bacteria 11684
313 Ga0207651_10015510 3300025960 Bacteria 4430
314 Ga0207651_10027070 3300025960 Bacteria 3595
315 Ga0207651_10032838 3300025960 Unclassified 3339
316 Ga0207651_10063207 3300025960 Unclassified 2584
317 Ga0207651_10163988 3300025960 Bacteria 1745
318 Ga0207712_10038284 3300025961 Bacteria 3278
319 Ga0207658_10085222 3300025986 Bacteria 2433
320 Ga0207658_10129027 3300025986 Bacteria 2029
321 Ga0207677_10027676 3300026023 Bacteria 3575
322 Ga0207677_10163683 3300026023 Unclassified 1731
323 Ga0207677_10331429 3300026023 Bacteria 1268
324 Ga0207703_10040772 3300026035 Unclassified 3717
325 Ga0207703_10041303 3300026035 Bacteria 3694
326 Ga0207703_10042204 3300026035 Bacteria 3658
327 Ga0207703_10139350 3300026035 Bacteria 2104
328 Ga0207703_10246941 3300026035 Bacteria 1607
329 Ga0207708_10028265 3300026075 Bacteria 4247
330 Ga0207641_10004632 3300026088 Bacteria 11878
331 Ga0207641_10005721 3300026088 Bacteria 10560
332 Ga0207641_10006113 3300026088 Bacteria 10190
333 Ga0207641_10046334 3300026088 Bacteria 3664
334 Ga0207648_10000163 3300026089 Bacteria 68352
335 Ga0207648_10009311 3300026089 Bacteria 9414
336 Ga0207648_10066438 3300026089 Bacteria 3145
337 Ga0207648_10134898 3300026089 Bacteria 2174
338 Ga0207676_10002565 3300026095 Bacteria 12967
339 Ga0207676_10032705 3300026095 Bacteria 3922
340 Ga0207676_10070794 3300026095 Unclassified 2798
341 Ga0207676_10075069 3300026095 Bacteria 2726
342 Ga0207676_10319983 3300026095 Bacteria 1424
343 Ga0207676_10392661 3300026095 Bacteria 1294
344 Ga0207674_10064686 3300026116 Bacteria 3689
345 Ga0207675_100050709 3300026118 Bacteria 3873
346 Ga0207683_10006784 3300026121 Bacteria 9803
347 Ga0207683_10285006 3300026121 Bacteria 1510
348 Ga0207683_10300858 3300026121 Bacteria 1468
349 Ga0207683_10383431 3300026121 Unclassified 1292
350 Ga0207428_10002007 3300027907 Bacteria 20601
351 Ga0207428_10002438 3300027907 Bacteria 18586
352 Ga0207428_10010805 3300027907 Bacteria 8138
353 Ga0207428_10024275 3300027907 Bacteria 5093
354 Ga0207428_10060186 3300027907 Bacteria 3009
355 Ga0207428_10091056 3300027907 Bacteria 2368
356 Ga0268266_10029032 3300028379 Bacteria 4701
357 Ga0268266_10396369 3300028379 Unclassified 1304
358 Ga0268265_10009792 3300028380 Bacteria 6470
359 Ga0268265_10070535 3300028380 Bacteria 2718
360 Ga0268265_10207455 3300028380 Viruses 1705
361 Ga0268264_10017869 3300028381 Bacteria 5804
362 Ga0268264_10140217 3300028381 Bacteria 2155
363 Ga0307515_10060108 3300028794 Bacteria 5431
364 Ga0265314_10021743 3300031711 Bacteria 4925
365 Ga0307413_10005500 3300031824 Bacteria 5662
366 Ga0307410_10004206 3300031852 Bacteria 7396
367 Ga0307406_10038668 3300031901 Unclassified 2955
368 Ga0307407_10004204 3300031903 Bacteria 6074
369 Ga0307409_100003419 3300031995 Bacteria 8626
370 Ga0307409_100004797 3300031995 Bacteria 7670
371 Ga0307409_100316002 3300031995 Unclassified 1460
372 Ga0307409_100571788 3300031995 Bacteria 1113
373 Ga0307416_100031062 3300032002 Unclassified 4016
374 Ga0307414_10117578 3300032004 Bacteria 2037
375 Ga0307411_10298586 3300032005 Unclassified 1291
376 Ga0307415_100033865 3300032126 Bacteria 3319
377 Ga0373952_0028677 3300035092 Bacteria 1222
378 Ga0373936_0031703 3300035113 Unclassified 2088
379 Ga0373953_0079205 3300035117 Bacteria 1364
380 Ga0373955_0021019 3300035172 Unclassified 3288
381 Ga0373924_0004880 3300035410 Bacteria 4712
382 Ga0373935_0108948 3300035692 Unclassified 1836
383 Ga0373937_0027121 3300036401 Bacteria 5178
384 Ga0373937_0150218 3300036401 Unclassified 2182
385 Ga0373937_0203999 3300036401 Bacteria 1859
386 Ga0373937_0425690 3300036401 Bacteria 1260
387 Ga0436365_0526651 3300039437 Bacteria 2550
388 Ga0451837_1782032 3300041494 Unclassified 1627
389 Ga0439460_0035360 3300042461 Bacteria 1445
390 Ga0439440_0028183 3300042993 Bacteria 1310
391 Ga0451576_0088431 3300045051 Bacteria 3222
392 Ga0451576_0120906 3300045051 Bacteria 2726
393 Ga0495592_0033521 3300046454 Unclassified 3873
394 Ga0495629_0065705 3300046459 Bacteria 2532
395 Ga0495580_0029740 3300046472 Bacteria 3963
396 Ga0495639_0056614 3300046475 Bacteria 1790
397 Ga0495608_0008730 3300046511 Bacteria 7091
398 Ga0495618_0066632 3300046514 Unclassified 2289
399 Ga0495643_0008558 3300046522 Bacteria 6462
400 Ga0495587_0023162 3300046536 Bacteria 3818
401 Ga0495621_0016774 3300046539 Bacteria 2357
402 Ga0495667_0007109 3300046559 Bacteria 7592
403 Ga0495634_0059873 3300046642 Unclassified 2535
404 Ga0495657_0008822 3300046675 Bacteria 7677
405 Ga0495657_0120259 3300046675 Bacteria 1655
406 Ga0495647_0000230 3300046681 Bacteria 15233
407 Ga0495647_0033529 3300046681 Bacteria 1919
408 Ga0495669_0001657 3300046684 Bacteria 9142
409 Ga0495669_0021327 3300046684 Bacteria 2811
410 Ga0495669_0096474 3300046684 Bacteria 1370
411 Ga0495613_0000915 3300046689 Bacteria 22630
412 Ga0495613_0015423 3300046689 Bacteria 5682
413 Ga0495613_0139141 3300046689 Unclassified 1735
414 Ga0495604_0023901 3300047317 Bacteria 4878
415 Ga0495636_0035799 3300047318 Bacteria 2045
416 Ga0495674_0045618 3300047319 Bacteria 3892
417 Ga0495675_0098671 3300047444 Bacteria 1830
418 Ga0495684_0000190 3300047471 Bacteria 47246
419 Ga0496109_0066784 3300048912 Unclassified 3294
420 Ga0496109_0406887 3300048912 Bacteria 1285
421 Ga0496113_0111542 3300048916 Bacteria 2130
422 Ga0496113_0261996 3300048916 Bacteria 1381
423 Ga0496114_0000735 3300048917 Bacteria 24425
424 Ga0501298_010924 3300049521 Bacteria 1569
425 Ga0501040_0179154 3300049576 Bacteria 1502
426 Ga0501041_0098307 3300049577 Bacteria 1810
427 Ga0501042_0201848 3300049578 Bacteria 1433
428 Ga0501046_0193324 3300049580 Bacteria 1517
429 Ga0501071_0117460 3300049587 Bacteria 1970
430 Ga0501075_0098911 3300049591 Bacteria 2215
431 Ga0501076_0105350 3300049592 Unclassified 2276
432 Ga0501079_0074899 3300049741 Bacteria 2617
433 Ga0501081_0002838 3300049743 Bacteria 11000
434 Ga0501283_001166 3300049779 Unclassified 3466
435 Ga0501045_0092324 3300049824 Bacteria 2239
436 nmdc:mga05p37_11781_c1 3300050507 Bacteria 10424
437 nmdc:mga05p37_1508_c1 3300050507 Bacteria 27058
438 nmdc:mga05p37_294704_c1 3300050507 Bacteria 1930
439 nmdc:mga05p37_356236_c1 3300050507 Bacteria 1722
440 nmdc:mga05p37_49096_c1 3300050507 Bacteria 5191
441 nmdc:mga05p37_53885_c1 3300050507 Bacteria 4948
442 nmdc:mga05p37_55399_c1 3300050507 Bacteria 4879
443 nmdc:mga05p37_594437_c1 3300050507 Bacteria 1250
444 nmdc:mga09592_107365_c1 3300050508 Bacteria 2394
445 nmdc:mga09592_142608_c1 3300050508 Bacteria 2065
446 nmdc:mga09592_158249_c1 3300050508 Unclassified 1956
447 nmdc:mga09592_19311_c1 3300050508 Bacteria 5596
448 nmdc:mga09592_9716_c1 3300050508 Bacteria 7812
449 nmdc:mga0qj67_15705_c1 3300050509 Bacteria 5735
450 nmdc:mga0qj67_201830_c1 3300050509 Unclassified 1616
451 nmdc:mga0qj67_3696_c1 3300050509 Bacteria 11046
452 nmdc:mga0qj67_49008_c1 3300050509 Unclassified 3338
453 nmdc:mga0qj67_96622_c1 3300050509 Bacteria 2378
454 nmdc:mga06r32_28323_c1 3300050510 Bacteria 5240
455 nmdc:mga06r32_48123_c1 3300050510 Bacteria 4075
456 nmdc:mga08y16_106948_c1 3300050511 Unclassified 2912
457 nmdc:mga08y16_1838_c2 3300050511 Bacteria 18505
458 nmdc:mga08y16_280620_c1 3300050511 Bacteria 1718
459 nmdc:mga08y16_37447_c1 3300050511 Bacteria 5094
460 nmdc:mga08y16_376286_c1 3300050511 Bacteria 1456
461 nmdc:mga08y16_44475_c1 3300050511 Bacteria 4652
462 nmdc:mga08y16_64128_c1 3300050511 Unclassified 3837
463 nmdc:mga08y16_66499_c1 3300050511 Bacteria 3762
464 nmdc:mga0n895_18251_c1 3300050512 Bacteria 6487
465 nmdc:mga0n895_2990_c1 3300050512 Bacteria 11306
466 nmdc:mga0n895_36131_c1 3300050512 Bacteria 4770
467 nmdc:mga0n895_4895_c1 3300050512 Bacteria 11096
468 nmdc:mga0rr50_32174_c1 3300050513 Bacteria 3734
469 nmdc:mga0a205_2533_c1 3300050515 Bacteria 16098
470 nmdc:mga0a205_4054_c1 3300050515 Bacteria 13094
471 nmdc:mga0a205_50282_c1 3300050515 Bacteria 4024
472 nmdc:mga0a205_508990_c1 3300050515 Bacteria 1061
473 nmdc:mga0a205_9105_c1 3300050515 Bacteria 9060
474 Ga0495619_0003571 3300053085 Bacteria 10028
475 Ga0495619_0047768 3300053085 Unclassified 2820
476 Ga0500616_0000032 3300053153 Bacteria 403673
477 Ga0500616_0069851 3300053153 Bacteria 1794
478 Ga0501084_0009779 3300054114 Bacteria 7928
479 Ga0075428_100036227
480 JGI25406J46586_10004008
481 JGI25406J46586_10005597
482 Ga0065712_10000563
483 Ga0065712_10008128
484 Ga0065712_10102351
485 Ga0065715_10129262
486 Ga0065715_10195078
487 Ga0070676_10057529
488 Ga0070690_100001605
489 Ga0070690_100015001
490 Ga0070690_100097907
491 Ga0070690_100120131
492 Ga0070690_100148582
493 Ga0070670_100001066
494 Ga0070670_100007118
495 Ga0070670_100021432
496 Ga0070670_100039099
497 Ga0070670_100082589
498 Ga0070677_10031556
499 Ga0070666_10043636
500 Ga0070666_10102414
501 Ga0070666_10159545
502 Ga0070682_100194346
503 Ga0068868_100014542
504 Ga0068868_100262257
505 Ga0068868_100399798
506 Ga0070689_100019467
507 Ga0070689_100024907
508 Ga0070689_100038344
509 Ga0070689_100086448
510 Ga0070689_100100737
511 Ga0070689_100281865
512 Ga0070687_100076774
513 Ga0070687_100199662
514 Ga0070661_100013108
515 Ga0070661_100016758
516 Ga0070661_100045591
517 Ga0070661_100295691
518 Ga0070668_100409003
519 Ga0070669_100018707
520 Ga0070669_100025963
521 Ga0070669_100046891
522 Ga0070669_100224118
523 Ga0070675_100000385
524 Ga0070675_100000754
525 Ga0070675_100001280
526 Ga0070675_100003020
527 Ga0070675_100003407
528 Ga0070675_100068489
529 Ga0070675_100082854
530 Ga0070675_100087469
531 Ga0070675_100089608
532 Ga0070675_100118407
533 Ga0070671_100002255
534 Ga0070671_100019640
535 Ga0070671_100019793
536 Ga0070674_100000428
537 Ga0070674_100168601
538 Ga0070674_100247326
539 Ga0070673_100063490
540 Ga0070673_100154222
541 Ga0070673_100171363
542 Ga0070673_100192913
543 Ga0070688_100061383
544 Ga0070688_100077015
545 Ga0070688_100084208
546 Ga0070688_100088599
547 Ga0070688_100199148
548 Ga0070659_100019352
549 Ga0070667_100080060
550 Ga0070667_100164822
551 Ga0070667_100237807
552 Ga0070713_100010988
553 Ga0070701_10078495
554 Ga0070700_100019607
555 Ga0070663_100045671
556 Ga0070678_100039027
557 Ga0070678_100121799
558 Ga0070662_100256740
559 Ga0070662_100303638
560 Ga0068867_100011381
561 Ga0070685_10010438
562 Ga0070685_10023175
563 Ga0070685_10101883
564 Ga0070672_100016304
565 Ga0070672_100035696
566 Ga0070672_100064869
567 Ga0070686_100068448
568 Ga0070686_100147742
569 Ga0070686_100314699
570 Ga0070665_100040483
571 Ga0070665_100086196
572 Ga0070664_100000389
573 Ga0070664_100008448
574 Ga0070664_100017279
575 Ga0070664_100036522
576 Ga0070664_100144928
577 Ga0068854_100042268
578 Ga0070702_100019123
579 Ga0068859_100000498
580 Ga0068859_100017826
581 Ga0068859_100022940
582 Ga0068859_100044560
583 Ga0068859_100064601
584 Ga0068859_100162217
585 Ga0068864_100001026
586 Ga0068864_100003714
587 Ga0068864_100081333
588 Ga0068864_100252443
589 Ga0068861_100010844
590 Ga0068861_100047167
591 Ga0068861_100209874
592 Ga0068851_10182181
593 Ga0068870_10010112
594 Ga0068870_10064437
595 Ga0068863_100001165
596 Ga0068863_100015746
597 Ga0068863_100019812
598 Ga0068863_100189468
599 Ga0068863_100228571
600 Ga0068863_100287358
601 Ga0068858_100054894
602 Ga0068858_100084589
603 Ga0068858_100178467
604 Ga0068860_100032724
605 Ga0068860_100044890
606 Ga0068860_100251341
607 Ga0068860_100298909
608 Ga0068860_100299578
609 Ga0068860_100369822
610 Ga0068862_100003127
611 Ga0068862_100089298
612 Ga0068862_100143061
613 Ga0081455_10304775
614 Ga0081539_10000071
615 Ga0081539_10000960
616 Ga0081539_10006520
617 Ga0097621_100001992
618 Ga0097621_100016897
619 Ga0097621_100158435
620 Ga0097621_100353565
621 Ga0068871_100003123
622 Ga0068871_100008591
623 Ga0068871_100017283
624 Ga0068871_100140659
625 Ga0075428_100011073
626 Ga0075428_100036246
627 Ga0075428_100055177
628 Ga0075430_100006930
629 Ga0075430_100017932
630 Ga0075430_100055086
631 Ga0075430_100151709
632 Ga0075431_100000430
633 Ga0075431_100012119
634 Ga0075431_100032074
635 Ga0075431_100052025
636 Ga0075433_10100757
637 Ga0075433_10139009
638 Ga0075434_100008589
639 Ga0075434_100012945
640 Ga0075434_100036413
641 Ga0075434_100094797
642 Ga0075429_100003709
643 Ga0075429_100154578
644 Ga0075429_100182588
645 Ga0075429_100275041
646 Ga0068865_100171135
647 Ga0068865_100255889
648 Ga0097620_100000498
649 Ga0097620_100017826
650 Ga0097620_100022939
651 Ga0097620_100044561
652 Ga0097620_100064598
653 Ga0097620_100162204
654 Ga0075435_100018779
655 Ga0075435_100186296
656 Ga0111539_10001480
657 Ga0111539_10001637
658 Ga0111539_10012653
659 Ga0111539_10018641
660 Ga0111539_10030503
661 Ga0111539_10056936
662 Ga0111539_10063192
663 Ga0111539_10088646
664 Ga0111539_10138327
665 Ga0111539_10239385
666 Ga0111539_10465944
667 Ga0105245_10092874
668 Ga0105247_10015888
669 Ga0114129_10028799
670 Ga0114129_10054554
671 Ga0114129_10056613
672 Ga0114129_10094012
673 Ga0114129_10119227
674 Ga0105248_10000903
675 Ga0105248_10002872
676 Ga0105248_10045678
677 Ga0105248_10217243
678 Ga0105248_10257355
679 Ga0105248_10421524
680 Ga0105238_10012956
681 Ga0105249_10002910
682 Ga0105239_10277722
683 Ga0105246_10014088
684 Ga0105246_10127375
685 Ga0105246_10199176
686 Ga0157374_10003306
687 Ga0157378_10035880
688 Ga0157378_10142211
689 Ga0163162_10013814
690 Ga0163162_10067221
691 Ga0163162_10088654
692 Ga0157375_10009195
693 Ga0157375_10075028
694 Ga0163163_10001890
695 Ga0163163_10007713
696 Ga0163163_10013274
697 Ga0163163_10063519
698 Ga0163163_10141199
699 Ga0163163_10144726
700 Ga0163163_10206616
701 Ga0163163_10215971
702 Ga0163163_10339924
703 Ga0157380_10007243
704 Ga0157380_10012628
705 Ga0157380_10030325
706 Ga0157380_10032941
707 Ga0157380_10116793
708 Ga0157380_10157299
709 Ga0157380_10269745
710 Ga0157377_10078279
711 Ga0157379_10000121
712 Ga0157379_10157609
713 Ga0157379_10221684
714 Ga0157376_10006221
715 Ga0157376_10027501
716 Ga0157376_10036864
717 Ga0157376_10133113
718 Ga0163161_10064485
719 Ga0163161_10064926
720 Ga0163161_10108226
721 Ga0213876_10076159
722 Ga0207697_10024472
723 Ga0207682_10002934
724 Ga0207682_10061796
725 Ga0207682_10076145
726 Ga0207642_10025806
727 Ga0207642_10057602
728 Ga0207688_10211871
729 Ga0207645_10055290
730 Ga0207643_10001612
731 Ga0207643_10006198
732 Ga0207643_10031231
733 Ga0207643_10033706
734 Ga0207662_10257551
735 Ga0207681_10005707
736 Ga0207681_10122029
737 Ga0207650_10036330
738 Ga0207650_10085062
739 Ga0207659_10000616
740 Ga0207659_10000768
741 Ga0207659_10002399
742 Ga0207659_10003009
743 Ga0207659_10005079
744 Ga0207659_10008013
745 Ga0207659_10009932
746 Ga0207659_10012955
747 Ga0207659_10015978
748 Ga0207659_10016856
749 Ga0207659_10043560
750 Ga0207659_10205277
751 Ga0207659_10277052
752 Ga0207687_10082522
753 Ga0207644_10008709
754 Ga0207644_10013291
755 Ga0207644_10034472
756 Ga0207690_10020394
757 Ga0207706_10038714
758 Ga0207706_10079553
759 Ga0207686_10025368
760 Ga0207686_10026459
761 Ga0207686_10292537
762 Ga0207709_10019664
763 Ga0207670_10007138
764 Ga0207670_10010095
765 Ga0207670_10033387
766 Ga0207670_10045155
767 Ga0207670_10145382
768 Ga0207670_10169602
769 Ga0207669_10002614
770 Ga0207669_10047575
771 Ga0207669_10048159
772 Ga0207704_10034815
773 Ga0207691_10014783
774 Ga0207691_10030816
775 Ga0207691_10050836
776 Ga0207691_10052724
777 Ga0207691_10170853
778 Ga0207711_10000188
779 Ga0207711_10002288
780 Ga0207711_10094722
781 Ga0207711_10157198
782 Ga0207689_10011387
783 Ga0207689_10015763
784 Ga0207689_10294913
785 Ga0207679_10024592
786 Ga0207679_10037932
787 Ga0207679_10100994
788 Ga0207679_10112116
789 Ga0207679_10183007
790 Ga0207651_10001187
791 Ga0207651_10015510
792 Ga0207651_10027070
793 Ga0207651_10032838
794 Ga0207651_10063207
795 Ga0207651_10163988
796 Ga0207712_10038284
797 Ga0207658_10085222
798 Ga0207658_10129027
799 Ga0207677_10027676
800 Ga0207677_10163683
801 Ga0207677_10331429
802 Ga0207703_10040772
803 Ga0207703_10041303
804 Ga0207703_10042204
805 Ga0207703_10139350
806 Ga0207703_10246941
807 Ga0207708_10028265
808 Ga0207641_10004632
809 Ga0207641_10005721
810 Ga0207641_10006113
811 Ga0207641_10046334
812 Ga0207648_10000163
813 Ga0207648_10009311
814 Ga0207648_10066438
815 Ga0207648_10134898
816 Ga0207676_10002565
817 Ga0207676_10032705
818 Ga0207676_10070794
819 Ga0207676_10075069
820 Ga0207676_10319983
821 Ga0207676_10392661
822 Ga0207674_10064686
823 Ga0207675_100050709
824 Ga0207683_10006784
825 Ga0207683_10285006
826 Ga0207683_10300858
827 Ga0207683_10383431
828 Ga0207428_10002007
829 Ga0207428_10002438
830 Ga0207428_10010805
831 Ga0207428_10024275
832 Ga0207428_10060186
833 Ga0207428_10091056
834 Ga0268266_10029032
835 Ga0268266_10396369
836 Ga0268265_10009792
837 Ga0268265_10070535
838 Ga0268265_10207455
839 Ga0268264_10017869
840 Ga0268264_10140217
841 Ga0307515_10060108
842 Ga0265314_10021743
843 Ga0307413_10005500
844 Ga0307410_10004206
845 Ga0307406_10038668
846 Ga0307407_10004204
847 Ga0307409_100003419
848 Ga0307409_100004797
849 Ga0307409_100316002
850 Ga0307409_100571788
851 Ga0307416_100031062
852 Ga0307414_10117578
853 Ga0307411_10298586
854 Ga0307415_100033865
855 Ga0373952_0028677
856 Ga0373936_0031703
857 Ga0373953_0079205
858 Ga0373955_0021019
859 Ga0373924_0004880
860 Ga0373935_0108948
861 Ga0373937_0027121
862 Ga0373937_0150218
863 Ga0373937_0203999
864 Ga0373937_0425690
865 Ga0436365_0526651
866 Ga0451837_1782032
867 Ga0439460_0035360
868 Ga0439440_0028183
869 Ga0451576_0088431
870 Ga0451576_0120906
871 Ga0495592_0033521
872 Ga0495629_0065705
873 Ga0495580_0029740
874 Ga0495639_0056614
875 Ga0495608_0008730
876 Ga0495618_0066632
877 Ga0495643_0008558
878 Ga0495587_0023162
879 Ga0495621_0016774
880 Ga0495667_0007109
881 Ga0495634_0059873
882 Ga0495657_0008822
883 Ga0495657_0120259
884 Ga0495647_0000230
885 Ga0495647_0033529
886 Ga0495669_0001657
887 Ga0495669_0021327
888 Ga0495669_0096474
889 Ga0495613_0000915
890 Ga0495613_0015423
891 Ga0495613_0139141
892 Ga0495604_0023901
893 Ga0495636_0035799
894 Ga0495674_0045618
895 Ga0495675_0098671
896 Ga0495684_0000190
897 Ga0496109_0066784
898 Ga0496109_0406887
899 Ga0496113_0111542
900 Ga0496113_0261996
901 Ga0496114_0000735
902 Ga0501298_010924
903 Ga0501040_0179154
904 Ga0501041_0098307
905 Ga0501042_0201848
906 Ga0501046_0193324
907 Ga0501071_0117460
908 Ga0501075_0098911
909 Ga0501076_0105350
910 Ga0501079_0074899
911 Ga0501081_0002838
912 Ga0501283_001166
913 Ga0501045_0092324
914 nmdc:mga05p37_11781_c1
915 nmdc:mga05p37_1508_c1
916 nmdc:mga05p37_294704_c1
917 nmdc:mga05p37_356236_c1
918 nmdc:mga05p37_49096_c1
919 nmdc:mga05p37_53885_c1
920 nmdc:mga05p37_55399_c1
921 nmdc:mga05p37_594437_c1
922 nmdc:mga09592_107365_c1
923 nmdc:mga09592_142608_c1
924 nmdc:mga09592_158249_c1
925 nmdc:mga09592_19311_c1
926 nmdc:mga09592_9716_c1
927 nmdc:mga0qj67_15705_c1
928 nmdc:mga0qj67_201830_c1
929 nmdc:mga0qj67_3696_c1
930 nmdc:mga0qj67_49008_c1
931 nmdc:mga0qj67_96622_c1
932 nmdc:mga06r32_28323_c1
933 nmdc:mga06r32_48123_c1
934 nmdc:mga08y16_106948_c1
935 nmdc:mga08y16_1838_c2
936 nmdc:mga08y16_280620_c1
937 nmdc:mga08y16_37447_c1
938 nmdc:mga08y16_376286_c1
939 nmdc:mga08y16_44475_c1
940 nmdc:mga08y16_64128_c1
941 nmdc:mga08y16_66499_c1
942 nmdc:mga0n895_18251_c1
943 nmdc:mga0n895_2990_c1
944 nmdc:mga0n895_36131_c1
945 nmdc:mga0n895_4895_c1
946 nmdc:mga0rr50_32174_c1
947 nmdc:mga0a205_2533_c1
948 nmdc:mga0a205_4054_c1
949 nmdc:mga0a205_50282_c1
950 nmdc:mga0a205_508990_c1
951 nmdc:mga0a205_9105_c1
952 Ga0495619_0003571
953 Ga0495619_0047768
954 Ga0500616_0000032
955 Ga0500616_0069851
956 Ga0501084_0009779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

50

147

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sru-assembly1.cif.gz_C crystal structure of full length e. coli ssb protein 0.7569 34 100
1sru-assembly1.cif.gz_B crystal structure of full length e. coli ssb protein 0.74 34 99
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7362 38 75
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7352 38 75
4dka-assembly1.cif.gz_D structure of editosome protein 0.7247 34 98
ID Description Score Start End Superfamily
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8404 36 95 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7741 35 117 2.40.50.140
3kxyA00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7586 279 297 3.30.1460.10
af_A0A1D6IBP5_78_179_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7571 34 99 2.40.50.140
3au7A02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.757 35 115 2.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2V8MW23-F1-model_v4 Uncharacterized protein 0.9454 154 325
AF-A0A2V8MW23-F1-model_v4 Uncharacterized protein 0.9401 154 325
AF-A0A2V8GWG2-F1-model_v4 DUF5666 domain-containing protein 0.9339 34 123
AF-A0A843SIL9-F1-model_v4 Uncharacterized protein 0.9312 36 123
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9235 31 121

Map