F451856

General Info

Members Datasets Scaffolds Average Seq Length
478 229 956 243

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100210471|Ga0068860_1002104711
Length 272
Sequence VLLQEFIAEAEAASTVEDGAEVLVDSGRAMNLEKQLEDFVAQLRRAAGDNLESVLLYGSAASGKFHPQLSNINLLCILRQTSFVALSALAPAIKSWFDEKHPPPMLLTREELRRAVDVFAIEFLDIKEHHQVLFGSSLPDLEIPMDRHRAQVEYELREKLVLLRQRLLLALNDDNRLWTLIMQSLPAFTTLFRHALIALGDAPPKTKAETLRDMAKRFPFDSTTFTQLLDLREHPENRKALDVKDLMARYLETIQQVTAAVDKILTDPRRAS

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.11
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 11.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100210471 3300005843 Bacteria 1886
2 Ga0065712_10123247 3300005290 Bacteria 1619
3 Ga0070676_10340159 3300005328 Unclassified 1029
4 Ga0070683_100035316 3300005329 Bacteria 4570
5 Ga0070683_100100426 3300005329 Bacteria 2724
6 Ga0070690_100152489 3300005330 Bacteria 1578
7 Ga0068869_100066992 3300005334 Unclassified 2647
8 Ga0070666_10068013 3300005335 Bacteria 2419
9 Ga0070666_10177063 3300005335 Bacteria 1495
10 Ga0070682_100264369 3300005337 Bacteria 1247
11 Ga0068868_100029656 3300005338 Bacteria 4191
12 Ga0068868_100235579 3300005338 Bacteria 1537
13 Ga0070689_100406617 3300005340 Bacteria 1152
14 Ga0070661_100106116 3300005344 Bacteria 2094
15 Ga0070668_100026372 3300005347 Bacteria 4409
16 Ga0070669_100159457 3300005353 Bacteria 1752
17 Ga0070671_100162686 3300005355 Bacteria 1886
18 Ga0070673_100228645 3300005364 Bacteria 1613
19 Ga0070659_100075659 3300005366 Bacteria 2684
20 Ga0070659_100101711 3300005366 Bacteria 2313
21 Ga0070667_100089963 3300005367 Bacteria 2637
22 Ga0070709_10000612 3300005434 Bacteria 20626
23 Ga0070709_10032042 3300005434 Bacteria 3167
24 Ga0070709_10032362 3300005434 Bacteria 3152
25 Ga0070709_10217174 3300005434 Unclassified 1362
26 Ga0070709_10298174 3300005434 Bacteria 1176
27 Ga0070714_100000307 3300005435 Bacteria 37308
28 Ga0070714_100197448 3300005435 Unclassified 1839
29 Ga0070713_100000116 3300005436 Bacteria 52486
30 Ga0070713_100000136 3300005436 Bacteria 48253
31 Ga0070713_100018263 3300005436 Bacteria 5330
32 Ga0070713_100080468 3300005436 Bacteria 2778
33 Ga0070713_100125505 3300005436 Bacteria 2257
34 Ga0070713_100295067 3300005436 Bacteria 1491
35 Ga0070713_100485147 3300005436 Bacteria 1164
36 Ga0070710_10008593 3300005437 Bacteria 4973
37 Ga0070710_10034553 3300005437 Bacteria 2751
38 Ga0070710_10055859 3300005437 Unclassified 2233
39 Ga0070710_10087835 3300005437 Bacteria 1828
40 Ga0070711_100004826 3300005439 Bacteria 7996
41 Ga0070711_100008884 3300005439 Bacteria 6165
42 Ga0070711_100093067 3300005439 Unclassified 2176
43 Ga0070711_100106897 3300005439 Bacteria 2047
44 Ga0070711_100169363 3300005439 Bacteria 1663
45 Ga0070711_100178081 3300005439 Bacteria 1626
46 Ga0070711_100178212 3300005439 Bacteria 1625
47 Ga0070711_100507099 3300005439 Bacteria 995
48 Ga0070694_100402553 3300005444 Unclassified 1072
49 Ga0070708_100026183 3300005445 Bacteria 4990
50 Ga0070663_100053821 3300005455 Bacteria 2874
51 Ga0070678_100113554 3300005456 Bacteria 2124
52 Ga0070662_100376553 3300005457 Bacteria 1168
53 Ga0070681_10291020 3300005458 Unclassified 1543
54 Ga0070681_10365278 3300005458 Bacteria 1354
55 Ga0068867_100061149 3300005459 Bacteria 2796
56 Ga0070685_10033350 3300005466 Bacteria 2892
57 Ga0070706_100021507 3300005467 Bacteria 5939
58 Ga0070707_100013473 3300005468 Bacteria 7648
59 Ga0070699_100007967 3300005518 Bacteria 9198
60 Ga0070679_100032009 3300005530 Bacteria 5201
61 Ga0070679_100063421 3300005530 Bacteria 3683
62 Ga0070679_100100614 3300005530 Bacteria 2876
63 Ga0070684_100047620 3300005535 Bacteria 3715
64 Ga0070684_100064284 3300005535 Bacteria 3218
65 Ga0070684_100184230 3300005535 Bacteria 1899
66 Ga0070697_100000099 3300005536 Bacteria 71389
67 Ga0070697_100002841 3300005536 Bacteria 13321
68 Ga0070697_100336293 3300005536 Bacteria 1302
69 Ga0068853_100197951 3300005539 Bacteria 1828
70 Ga0068853_100209458 3300005539 Bacteria 1776
71 Ga0070672_100480245 3300005543 Bacteria 1073
72 Ga0070686_100140087 3300005544 Bacteria 1683
73 Ga0070693_100035385 3300005547 Bacteria 2769
74 Ga0070693_100046445 3300005547 Bacteria 2466
75 Ga0070665_100332475 3300005548 Bacteria 1524
76 Ga0068855_100153083 3300005563 Bacteria 2621
77 Ga0068855_100274461 3300005563 Unclassified 1874
78 Ga0068855_100407523 3300005563 Bacteria 1489
79 Ga0070664_100050215 3300005564 Bacteria 3529
80 Ga0070664_100340378 3300005564 Bacteria 1362
81 Ga0068857_100325723 3300005577 Bacteria 1419
82 Ga0068857_100437286 3300005577 Bacteria 1222
83 Ga0068854_100017079 3300005578 Bacteria 4852
84 Ga0068854_100021749 3300005578 Bacteria 4357
85 Ga0068856_100016804 3300005614 Bacteria 7090
86 Ga0068856_100170958 3300005614 Bacteria 2185
87 Ga0068856_100207522 3300005614 Bacteria 1974
88 Ga0068856_100221682 3300005614 Bacteria 1906
89 Ga0068856_100332605 3300005614 Bacteria 1537
90 Ga0068852_100072359 3300005616 Bacteria 3030
91 Ga0068852_100268783 3300005616 Bacteria 1640
92 Ga0068859_100024793 3300005617 Bacteria 6019
93 Ga0068859_100133698 3300005617 Bacteria 2552
94 Ga0068864_100155253 3300005618 Bacteria 2077
95 Ga0068866_10047437 3300005718 Bacteria 2166
96 Ga0068866_10073266 3300005718 Bacteria 1817
97 Ga0068866_10291791 3300005718 Unclassified 1015
98 Ga0068861_100057786 3300005719 Bacteria 2964
99 Ga0068851_10009544 3300005834 Bacteria 4516
100 Ga0068851_10015832 3300005834 Bacteria 3599
101 Ga0068863_100077007 3300005841 Bacteria 3156
102 Ga0068863_100161535 3300005841 Unclassified 2147
103 Ga0068863_100222537 3300005841 Unclassified 1819
104 Ga0068863_100284913 3300005841 Bacteria 1601
105 Ga0068863_101035243 3300005841 Unclassified 824
106 Ga0068858_100052814 3300005842 Unclassified 3760
107 Ga0068858_100188162 3300005842 Bacteria 1950
108 Ga0068858_100703527 3300005842 Unclassified 983
109 Ga0068860_100042194 3300005843 Unclassified 4358
110 Ga0068860_100103338 3300005843 Bacteria 2719
111 Ga0068862_100050524 3300005844 Unclassified 3554
112 Ga0081540_1073478 3300005983 Unclassified 1571
113 Ga0070717_10000529 3300006028 Bacteria 24184
114 Ga0070717_10001368 3300006028 Bacteria 16806
115 Ga0070717_10014592 3300006028 Bacteria 6049
116 Ga0070717_10446024 3300006028 Bacteria 1166
117 Ga0070715_10012603 3300006163 Bacteria 3083
118 Ga0070715_10065231 3300006163 Bacteria 1611
119 Ga0070716_100000936 3300006173 Bacteria 12675
120 Ga0070716_100005175 3300006173 Bacteria 6304
121 Ga0070712_100000298 3300006175 Bacteria 27949
122 Ga0070712_100000651 3300006175 Bacteria 20428
123 Ga0070712_100010791 3300006175 Bacteria 5775
124 Ga0070712_100042192 3300006175 Bacteria 3136
125 Ga0070712_100067368 3300006175 Bacteria 2547
126 Ga0070712_100130363 3300006175 Bacteria 1905
127 Ga0070712_100170321 3300006175 Bacteria 1689
128 Ga0070712_100368679 3300006175 Unclassified 1179
129 Ga0070712_100462397 3300006175 Bacteria 1058
130 Ga0097621_100023565 3300006237 Bacteria 4794
131 Ga0097621_100390230 3300006237 Bacteria 1245
132 Ga0068871_100044989 3300006358 Bacteria 3551
133 Ga0068871_100142026 3300006358 Bacteria 2042
134 Ga0068871_100161171 3300006358 Bacteria 1919
135 Ga0068871_100234307 3300006358 Bacteria 1594
136 Ga0075433_10012025 3300006852 Bacteria 6981
137 Ga0075434_100188075 3300006871 Bacteria 2085
138 Ga0075434_101192729 3300006871 Unclassified 773
139 Ga0068865_100073562 3300006881 Bacteria 2430
140 Ga0075436_100003008 3300006914 Bacteria 11547
141 Ga0097620_100024793 3300006931 Bacteria 6019
142 Ga0097620_100133692 3300006931 Bacteria 2552
143 Ga0075435_100189183 3300007076 Bacteria 1742
144 Ga0099794_10092244 3300007265 Bacteria 1504
145 Ga0099795_10067127 3300007788 Unclassified 1345
146 Ga0099795_10136420 3300007788 Unclassified 994
147 Ga0105240_10043804 3300009093 Bacteria 5691
148 Ga0105240_10147897 3300009093 Bacteria 2801
149 Ga0105240_10149715 3300009093 Bacteria 2781
150 Ga0105240_10228747 3300009093 Bacteria 2162
151 Ga0105245_10034074 3300009098 Bacteria 4514
152 Ga0105245_10077142 3300009098 Bacteria 3037
153 Ga0105245_10276809 3300009098 Bacteria 1639
154 Ga0105247_10031978 3300009101 Bacteria 3195
155 Ga0105243_10041015 3300009148 Bacteria 3619
156 Ga0105241_10042618 3300009174 Bacteria 3435
157 Ga0105241_10051615 3300009174 Bacteria 3137
158 Ga0105241_10222648 3300009174 Unclassified 1587
159 Ga0105241_10549973 3300009174 Unclassified 1036
160 Ga0105242_10102464 3300009176 Bacteria 2427
161 Ga0105242_10120187 3300009176 Bacteria 2253
162 Ga0105242_10221853 3300009176 Bacteria 1690
163 Ga0105248_10067537 3300009177 Unclassified 4014
164 Ga0105248_10186047 3300009177 Bacteria 2340
165 Ga0105237_10052222 3300009545 Bacteria 4104
166 Ga0105237_10086624 3300009545 Bacteria 3122
167 Ga0105237_10125864 3300009545 Bacteria 2557
168 Ga0105237_10180701 3300009545 Bacteria 2110
169 Ga0105237_10597096 3300009545 Bacteria 1111
170 Ga0105237_10964695 3300009545 Unclassified 859
171 Ga0105238_10022012 3300009551 Bacteria 6496
172 Ga0105238_10044234 3300009551 Bacteria 4503
173 Ga0105238_10076570 3300009551 Bacteria 3336
174 Ga0105238_10415638 3300009551 Unclassified 1339
175 Ga0105238_10444297 3300009551 Bacteria 1293
176 Ga0105249_10057065 3300009553 Bacteria 3576
177 Ga0105239_10012169 3300010375 Bacteria 9593
178 Ga0105239_10080860 3300010375 Bacteria 3575
179 Ga0105239_10123435 3300010375 Bacteria 2877
180 Ga0105239_10260751 3300010375 Bacteria 1948
181 Ga0105239_10310046 3300010375 Bacteria 1778
182 Ga0105239_10661287 3300010375 Unclassified 1193
183 Ga0157373_10184849 3300013100 Bacteria 1468
184 Ga0157373_10225724 3300013100 Bacteria 1322
185 Ga0157371_10012111 3300013102 Bacteria 6608
186 Ga0157371_10364819 3300013102 Bacteria 1053
187 Ga0157369_10000770 3300013105 Bacteria 41464
188 Ga0157369_10028348 3300013105 Bacteria 6198
189 Ga0157369_10037111 3300013105 Bacteria 5337
190 Ga0157369_10679763 3300013105 Bacteria 1061
191 Ga0157374_10000480 3300013296 Bacteria 36285
192 Ga0157374_10019953 3300013296 Bacteria 5942
193 Ga0157374_10092121 3300013296 Bacteria 2891
194 Ga0157374_10221222 3300013296 Bacteria 1858
195 Ga0157374_10236079 3300013296 Bacteria 1797
196 Ga0157374_10245246 3300013296 Bacteria 1762
197 Ga0157374_10395863 3300013296 Bacteria 1377
198 Ga0157378_10026548 3300013297 Bacteria 5105
199 Ga0157378_10047025 3300013297 Bacteria 3836
200 Ga0157378_10106132 3300013297 Bacteria 2569
201 Ga0157378_10124435 3300013297 Unclassified 2381
202 Ga0157378_10449720 3300013297 Bacteria 1278
203 Ga0163162_10022773 3300013306 Bacteria 6175
204 Ga0163162_10024397 3300013306 Bacteria 5969
205 Ga0157372_10610431 3300013307 Bacteria 1271
206 Ga0157372_10815248 3300013307 Bacteria 1084
207 Ga0157375_10208946 3300013308 Bacteria 2109
208 Ga0163163_10001469 3300014325 Bacteria 19935
209 Ga0163163_10054870 3300014325 Bacteria 3938
210 Ga0163163_10187102 3300014325 Bacteria 2118
211 Ga0163163_10240814 3300014325 Bacteria 1859
212 Ga0157379_10077165 3300014968 Bacteria 2983
213 Ga0157379_10115566 3300014968 Bacteria 2412
214 Ga0157379_10123460 3300014968 Bacteria 2330
215 Ga0157379_10134831 3300014968 Bacteria 2224
216 Ga0157376_10606585 3300014969 Bacteria 1090
217 Ga0157376_10608394 3300014969 Bacteria 1088
218 Ga0157376_10982145 3300014969 Bacteria 866
219 Ga0182006_1058150 3300015261 Bacteria 1467
220 Ga0224572_1000228 3300024225 Bacteria 5557
221 Ga0228598_1000011 3300024227 Bacteria 26445
222 Ga0228598_1000145 3300024227 Bacteria 12199
223 Ga0228598_1003318 3300024227 Bacteria 3470
224 Ga0207692_10017547 3300025898 Bacteria 3195
225 Ga0207692_10026054 3300025898 Bacteria 2740
226 Ga0207692_10039158 3300025898 Bacteria 2330
227 Ga0207692_10172431 3300025898 Bacteria 1254
228 Ga0207642_10021882 3300025899 Bacteria 2525
229 Ga0207642_10170888 3300025899 Bacteria 1176
230 Ga0207710_10037835 3300025900 Bacteria 2132
231 Ga0207647_10008045 3300025904 Bacteria 7582
232 Ga0207647_10121516 3300025904 Bacteria 1540
233 Ga0207699_10001567 3300025906 Bacteria 10853
234 Ga0207699_10002474 3300025906 Bacteria 8714
235 Ga0207699_10120683 3300025906 Bacteria 1695
236 Ga0207699_10194813 3300025906 Bacteria 1370
237 Ga0207699_10299366 3300025906 Unclassified 1123
238 Ga0207645_10274382 3300025907 Bacteria 1119
239 Ga0207643_10392947 3300025908 Unclassified 876
240 Ga0207705_10391900 3300025909 Bacteria 1074
241 Ga0207684_10019812 3300025910 Bacteria 5754
242 Ga0207684_10272189 3300025910 Bacteria 1461
243 Ga0207654_10012196 3300025911 Bacteria 4401
244 Ga0207654_10034724 3300025911 Bacteria 2804
245 Ga0207707_10008653 3300025912 Bacteria 8829
246 Ga0207707_10133501 3300025912 Bacteria 2171
247 Ga0207707_10147608 3300025912 Bacteria 2056
248 Ga0207707_10585954 3300025912 Bacteria 945
249 Ga0207695_10045589 3300025913 Bacteria 4653
250 Ga0207695_10245158 3300025913 Bacteria 1692
251 Ga0207671_10090957 3300025914 Bacteria 2299
252 Ga0207671_10256005 3300025914 Bacteria 1377
253 Ga0207671_10442644 3300025914 Bacteria 1035
254 Ga0207693_10000289 3300025915 Bacteria 46604
255 Ga0207693_10000779 3300025915 Bacteria 28532
256 Ga0207693_10004114 3300025915 Bacteria 12353
257 Ga0207693_10042537 3300025915 Bacteria 3576
258 Ga0207693_10088906 3300025915 Bacteria 2421
259 Ga0207693_10172768 3300025915 Bacteria 1701
260 Ga0207663_10000883 3300025916 Bacteria 13642
261 Ga0207663_10063390 3300025916 Bacteria 2354
262 Ga0207663_10114163 3300025916 Bacteria 1838
263 Ga0207663_10205127 3300025916 Bacteria 1425
264 Ga0207663_10337974 3300025916 Bacteria 1136
265 Ga0207663_10647896 3300025916 Unclassified 833
266 Ga0207660_10096209 3300025917 Bacteria 2204
267 Ga0207657_10029847 3300025919 Bacteria 4957
268 Ga0207657_10037084 3300025919 Bacteria 4359
269 Ga0207649_10028402 3300025920 Bacteria 3293
270 Ga0207652_10059720 3300025921 Bacteria 3287
271 Ga0207652_10110445 3300025921 Bacteria 2438
272 Ga0207652_10277390 3300025921 Bacteria 1512
273 Ga0207646_10006067 3300025922 Bacteria 12585
274 Ga0207646_10075018 3300025922 Bacteria 3021
275 Ga0207646_10450807 3300025922 Bacteria 1161
276 Ga0207694_10191233 3300025924 Bacteria 1663
277 Ga0207694_10337871 3300025924 Bacteria 1245
278 Ga0207687_10084381 3300025927 Unclassified 2302
279 Ga0207687_10106828 3300025927 Bacteria 2070
280 Ga0207700_10000372 3300025928 Bacteria 26220
281 Ga0207700_10298205 3300025928 Bacteria 1391
282 Ga0207664_10000409 3300025929 Bacteria 30767
283 Ga0207664_10035549 3300025929 Bacteria 3845
284 Ga0207706_10000722 3300025933 Bacteria 34504
285 Ga0207686_10265684 3300025934 Bacteria 1260
286 Ga0207686_10326706 3300025934 Bacteria 1148
287 Ga0207670_10154784 3300025936 Bacteria 1705
288 Ga0207704_10434925 3300025938 Bacteria 1043
289 Ga0207665_10001070 3300025939 Bacteria 18405
290 Ga0207665_10001695 3300025939 Bacteria 14818
291 Ga0207665_10071217 3300025939 Bacteria 2373
292 Ga0207665_10221973 3300025939 Bacteria 1385
293 Ga0207665_10444493 3300025939 Bacteria 994
294 Ga0207691_10254845 3300025940 Bacteria 1514
295 Ga0207711_10338049 3300025941 Bacteria 1393
296 Ga0207689_10000728 3300025942 Bacteria 31608
297 Ga0207689_10059060 3300025942 Bacteria 3155
298 Ga0207661_10348449 3300025944 Bacteria 1336
299 Ga0207679_10221423 3300025945 Bacteria 1592
300 Ga0207667_10131076 3300025949 Bacteria 2582
301 Ga0207667_10786125 3300025949 Unclassified 949
302 Ga0207651_10329006 3300025960 Bacteria 1280
303 Ga0207712_10117484 3300025961 Bacteria 2006
304 Ga0207668_10012863 3300025972 Bacteria 5136
305 Ga0207640_10108761 3300025981 Bacteria 1960
306 Ga0207640_10154224 3300025981 Unclassified 1691
307 Ga0207677_10001955 3300026023 Bacteria 10905
308 Ga0207677_10174016 3300026023 Bacteria 1687
309 Ga0207677_10735956 3300026023 Bacteria 878
310 Ga0207703_10023668 3300026035 Bacteria 4830
311 Ga0207639_10014763 3300026041 Bacteria 5502
312 Ga0207639_10123391 3300026041 Bacteria 2132
313 Ga0207678_10000405 3300026067 Bacteria 39009
314 Ga0207702_10173055 3300026078 Bacteria 1982
315 Ga0207702_10346835 3300026078 Bacteria 1420
316 Ga0207641_10047692 3300026088 Bacteria 3613
317 Ga0207641_10051365 3300026088 Bacteria 3491
318 Ga0207641_10201131 3300026088 Unclassified 1837
319 Ga0207641_10249422 3300026088 Bacteria 1657
320 Ga0207641_10493703 3300026088 Unclassified 1188
321 Ga0207641_10954043 3300026088 Unclassified 853
322 Ga0207648_10014256 3300026089 Bacteria 7349
323 Ga0207648_10142627 3300026089 Bacteria 2112
324 Ga0207676_10559920 3300026095 Bacteria 1093
325 Ga0207674_10038730 3300026116 Bacteria 4944
326 Ga0207674_10057373 3300026116 Bacteria 3947
327 Ga0207674_10223181 3300026116 Bacteria 1833
328 Ga0207675_100013550 3300026118 Bacteria 7609
329 Ga0207675_100095021 3300026118 Bacteria 2804
330 Ga0207683_10155037 3300026121 Bacteria 2068
331 Ga0207698_10195252 3300026142 Bacteria 1807
332 Ga0207698_10485041 3300026142 Unclassified 1200
333 Ga0265356_1003976 3300028017 Bacteria 1828
334 Ga0268264_10179483 3300028381 Bacteria 1921
335 Ga0265338_10025347 3300028800 Bacteria 6022
336 Ga0265338_10381993 3300028800 Unclassified 1007
337 Ga0265762_1048021 3300030760 Unclassified 850
338 Ga0265770_1005136 3300030878 Bacteria 1797
339 Ga0265760_10004514 3300031090 Bacteria 3994
340 Ga0265760_10005073 3300031090 Bacteria 3768
341 Ga0265760_10006838 3300031090 Bacteria 3268
342 Ga0265325_10069544 3300031241 Bacteria 1770
343 Ga0265339_10035743 3300031249 Bacteria 2785
344 Ga0265316_10015080 3300031344 Bacteria 6773
345 Ga0265316_10023001 3300031344 Bacteria 5243
346 Ga0265314_10001739 3300031711 Bacteria 23572
347 Ga0265342_10018646 3300031712 Bacteria 4487
348 Ga0373929_0023732 3300035085 Bacteria 1262
349 Ga0373934_0008394 3300035086 Bacteria 3849
350 Ga0373944_0046011 3300035089 Bacteria 1363
351 Ga0373949_0089064 3300035090 Unclassified 832
352 Ga0373923_0002712 3300035111 Bacteria 5518
353 Ga0373936_0011178 3300035113 Bacteria 3392
354 Ga0373936_0033823 3300035113 Bacteria 2028
355 Ga0373941_0015514 3300035115 Bacteria 2057
356 Ga0373945_0000160 3300035116 Bacteria 17398
357 Ga0373953_0013100 3300035117 Bacteria 2953
358 Ga0373954_0017041 3300035118 Bacteria 3258
359 Ga0373954_0254936 3300035118 Bacteria 864
360 Ga0373954_0480427 3300035118 Unclassified 615
361 Ga0373956_0027477 3300035119 Bacteria 2470
362 Ga0373943_0000030 3300035170 Bacteria 47703
363 Ga0373943_0009396 3300035170 Bacteria 4382
364 Ga0373946_0012917 3300035171 Bacteria 3132
365 Ga0373946_0076085 3300035171 Bacteria 1460
366 Ga0373955_0016719 3300035172 Bacteria 3615
367 Ga0373955_0071011 3300035172 Bacteria 1947
368 Ga0373955_0292303 3300035172 Bacteria 982
369 Ga0373961_0082454 3300035241 Unclassified 1014
370 Ga0373924_0020381 3300035410 Bacteria 2577
371 Ga0373931_0019686 3300035691 Bacteria 3371
372 Ga0373935_0006239 3300035692 Bacteria 7095
373 Ga0373935_0371923 3300035692 Bacteria 1022
374 Ga0373927_0014111 3300035695 Bacteria 5297
375 Ga0373927_0021003 3300035695 Bacteria 4280
376 Ga0373927_0369813 3300035695 Bacteria 945
377 Ga0373927_0467830 3300035695 Unclassified 833
378 Ga0373933_0019596 3300035724 Bacteria 3823
379 Ga0373933_0027185 3300035724 Bacteria 3292
380 Ga0373947_0000319 3300035725 Bacteria 27240
381 Ga0373947_0005313 3300035725 Bacteria 7531
382 Ga0373937_0111307 3300036401 Bacteria 2547
383 Ga0373937_0639835 3300036401 Bacteria 1009
384 Ga0373925_0001348 3300037068 Bacteria 21410
385 Ga0373925_0017259 3300037068 Bacteria 5228
386 Ga0373925_0028348 3300037068 Bacteria 4102
387 Ga0373925_0032924 3300037068 Bacteria 3818
388 Ga0373925_0653456 3300037068 Unclassified 866
389 Ga0439448_0011161 3300042005 Bacteria 2674
390 Ga0451577_0493553 3300042876 Bacteria 1112
391 Ga0453684_0544782 3300044712 Bacteria 1279
392 Ga0451576_0129724 3300045051 Unclassified 2628
393 Ga0451576_0161209 3300045051 Bacteria 2341
394 Ga0495629_0221053 3300046459 Bacteria 1306
395 Ga0495651_0331020 3300046462 Unclassified 1012
396 Ga0495653_0346564 3300046463 Unclassified 956
397 Ga0495580_0001015 3300046472 Bacteria 24655
398 Ga0495580_0002932 3300046472 Bacteria 14649
399 Ga0495580_0004648 3300046472 Bacteria 11521
400 Ga0495580_0013871 3300046472 Bacteria 6136
401 Ga0495580_0021962 3300046472 Bacteria 4704
402 Ga0495580_0033872 3300046472 Bacteria 3678
403 Ga0495580_0193789 3300046472 Bacteria 1401
404 Ga0495580_0238898 3300046472 Bacteria 1246
405 Ga0495582_0000143 3300046473 Bacteria 38449
406 Ga0495582_0009560 3300046473 Bacteria 5339
407 Ga0495664_0136278 3300046477 Bacteria 1487
408 Ga0495594_0116165 3300046499 Bacteria 1511
409 Ga0495594_0164589 3300046499 Bacteria 1261
410 Ga0495630_0043116 3300046517 Bacteria 3370
411 Ga0495630_0320575 3300046517 Bacteria 1185
412 Ga0495665_0004649 3300046531 Bacteria 7408
413 Ga0495665_0145935 3300046531 Bacteria 1236
414 Ga0495586_0126472 3300046535 Bacteria 1430
415 Ga0495587_0297632 3300046536 Unclassified 903
416 Ga0495667_0181911 3300046559 Unclassified 1349
417 Ga0495634_0248717 3300046642 Bacteria 1088
418 Ga0495635_0133574 3300046663 Bacteria 1692
419 Ga0495588_0121357 3300046674 Bacteria 1378
420 Ga0495657_0146432 3300046675 Unclassified 1469
421 Ga0495599_0075544 3300046678 Bacteria 2104
422 Ga0495599_0318898 3300046678 Unclassified 936
423 Ga0495623_0092535 3300046679 Bacteria 1853
424 Ga0495623_0095778 3300046679 Bacteria 1814
425 Ga0495669_0005144 3300046684 Bacteria 5440
426 Ga0495669_0208887 3300046684 Bacteria 934
427 Ga0495624_0057373 3300046690 Bacteria 2448
428 Ga0495581_0025011 3300047315 Bacteria 3460
429 Ga0495674_0018865 3300047319 Bacteria 6416
430 Ga0495674_0037711 3300047319 Bacteria 4342
431 Ga0495674_0186647 3300047319 Bacteria 1725
432 Ga0495674_0189158 3300047319 Bacteria 1712
433 Ga0495676_0241336 3300047321 Bacteria 1237
434 Ga0495675_0154914 3300047444 Unclassified 1414
435 Ga0495684_0187064 3300047471 Bacteria 1533
436 Ga0496100_0263715 3300048903 Bacteria 1278
437 Ga0496100_0323855 3300048903 Bacteria 1158
438 Ga0496100_0632240 3300048903 Unclassified 833
439 Ga0496101_0027489 3300048904 Bacteria 3964
440 Ga0496101_0108541 3300048904 Bacteria 2087
441 Ga0496102_0003287 3300048905 Bacteria 13705
442 Ga0496102_0149945 3300048905 Bacteria 2190
443 Ga0496102_0513543 3300048905 Bacteria 1121
444 Ga0496103_0015469 3300048906 Bacteria 4541
445 Ga0496103_0165672 3300048906 Bacteria 1418
446 Ga0496104_0040312 3300048907 Bacteria 4377
447 Ga0496104_0610583 3300048907 Bacteria 1001
448 Ga0496105_0074833 3300048908 Bacteria 2798
449 Ga0496105_0394035 3300048908 Bacteria 1100
450 Ga0496106_0021601 3300048909 Bacteria 4779
451 Ga0496106_0105487 3300048909 Bacteria 2190
452 Ga0496106_0122099 3300048909 Bacteria 2037
453 Ga0496107_0042538 3300048910 Bacteria 3263
454 Ga0496107_0146192 3300048910 Bacteria 1748
455 Ga0496108_0160724 3300048911 Bacteria 1941
456 Ga0496108_0543916 3300048911 Bacteria 1013
457 Ga0496109_0077131 3300048912 Bacteria 3066
458 Ga0496109_0386954 3300048912 Bacteria 1321
459 Ga0496111_0026719 3300048914 Unclassified 4077
460 Ga0496112_0007066 3300048915 Bacteria 9919
461 Ga0496112_0021011 3300048915 Bacteria 6200
462 Ga0496112_0142645 3300048915 Bacteria 2364
463 Ga0496112_0176124 3300048915 Bacteria 2104
464 Ga0496112_0437778 3300048915 Bacteria 1245
465 Ga0496114_0077293 3300048917 Bacteria 2806
466 Ga0496115_0009266 3300048918 Bacteria 7315
467 Ga0496115_0106805 3300048918 Bacteria 2298
468 Ga0496115_0190939 3300048918 Unclassified 1692
469 Ga0496115_0303968 3300048918 Bacteria 1307
470 Ga0501067_0148336 3300049583 Bacteria 1307
471 nmdc:mga0n895_257707_c1 3300050512 Bacteria 1770
472 nmdc:mga0rr50_193747_c1 3300050513 Bacteria 1667
473 nmdc:mga0rr50_769236_c1 3300050513 Bacteria 822
474 nmdc:mga0rr50_77337_c1 3300050513 Bacteria 2557
475 nmdc:mga08x19_390010_c1 3300050514 Bacteria 976
476 nmdc:mga08x19_781_c1 3300050514 Bacteria 20275
477 nmdc:mga0a205_2823_c2 3300050515 Bacteria 11199
478 Ga0495619_0070283 3300053085 Bacteria 2341
479 Ga0068860_100210471
480 Ga0065712_10123247
481 Ga0070676_10340159
482 Ga0070683_100035316
483 Ga0070683_100100426
484 Ga0070690_100152489
485 Ga0068869_100066992
486 Ga0070666_10068013
487 Ga0070666_10177063
488 Ga0070682_100264369
489 Ga0068868_100029656
490 Ga0068868_100235579
491 Ga0070689_100406617
492 Ga0070661_100106116
493 Ga0070668_100026372
494 Ga0070669_100159457
495 Ga0070671_100162686
496 Ga0070673_100228645
497 Ga0070659_100075659
498 Ga0070659_100101711
499 Ga0070667_100089963
500 Ga0070709_10000612
501 Ga0070709_10032042
502 Ga0070709_10032362
503 Ga0070709_10217174
504 Ga0070709_10298174
505 Ga0070714_100000307
506 Ga0070714_100197448
507 Ga0070713_100000116
508 Ga0070713_100000136
509 Ga0070713_100018263
510 Ga0070713_100080468
511 Ga0070713_100125505
512 Ga0070713_100295067
513 Ga0070713_100485147
514 Ga0070710_10008593
515 Ga0070710_10034553
516 Ga0070710_10055859
517 Ga0070710_10087835
518 Ga0070711_100004826
519 Ga0070711_100008884
520 Ga0070711_100093067
521 Ga0070711_100106897
522 Ga0070711_100169363
523 Ga0070711_100178081
524 Ga0070711_100178212
525 Ga0070711_100507099
526 Ga0070694_100402553
527 Ga0070708_100026183
528 Ga0070663_100053821
529 Ga0070678_100113554
530 Ga0070662_100376553
531 Ga0070681_10291020
532 Ga0070681_10365278
533 Ga0068867_100061149
534 Ga0070685_10033350
535 Ga0070706_100021507
536 Ga0070707_100013473
537 Ga0070699_100007967
538 Ga0070679_100032009
539 Ga0070679_100063421
540 Ga0070679_100100614
541 Ga0070684_100047620
542 Ga0070684_100064284
543 Ga0070684_100184230
544 Ga0070697_100000099
545 Ga0070697_100002841
546 Ga0070697_100336293
547 Ga0068853_100197951
548 Ga0068853_100209458
549 Ga0070672_100480245
550 Ga0070686_100140087
551 Ga0070693_100035385
552 Ga0070693_100046445
553 Ga0070665_100332475
554 Ga0068855_100153083
555 Ga0068855_100274461
556 Ga0068855_100407523
557 Ga0070664_100050215
558 Ga0070664_100340378
559 Ga0068857_100325723
560 Ga0068857_100437286
561 Ga0068854_100017079
562 Ga0068854_100021749
563 Ga0068856_100016804
564 Ga0068856_100170958
565 Ga0068856_100207522
566 Ga0068856_100221682
567 Ga0068856_100332605
568 Ga0068852_100072359
569 Ga0068852_100268783
570 Ga0068859_100024793
571 Ga0068859_100133698
572 Ga0068864_100155253
573 Ga0068866_10047437
574 Ga0068866_10073266
575 Ga0068866_10291791
576 Ga0068861_100057786
577 Ga0068851_10009544
578 Ga0068851_10015832
579 Ga0068863_100077007
580 Ga0068863_100161535
581 Ga0068863_100222537
582 Ga0068863_100284913
583 Ga0068863_101035243
584 Ga0068858_100052814
585 Ga0068858_100188162
586 Ga0068858_100703527
587 Ga0068860_100042194
588 Ga0068860_100103338
589 Ga0068862_100050524
590 Ga0081540_1073478
591 Ga0070717_10000529
592 Ga0070717_10001368
593 Ga0070717_10014592
594 Ga0070717_10446024
595 Ga0070715_10012603
596 Ga0070715_10065231
597 Ga0070716_100000936
598 Ga0070716_100005175
599 Ga0070712_100000298
600 Ga0070712_100000651
601 Ga0070712_100010791
602 Ga0070712_100042192
603 Ga0070712_100067368
604 Ga0070712_100130363
605 Ga0070712_100170321
606 Ga0070712_100368679
607 Ga0070712_100462397
608 Ga0097621_100023565
609 Ga0097621_100390230
610 Ga0068871_100044989
611 Ga0068871_100142026
612 Ga0068871_100161171
613 Ga0068871_100234307
614 Ga0075433_10012025
615 Ga0075434_100188075
616 Ga0075434_101192729
617 Ga0068865_100073562
618 Ga0075436_100003008
619 Ga0097620_100024793
620 Ga0097620_100133692
621 Ga0075435_100189183
622 Ga0099794_10092244
623 Ga0099795_10067127
624 Ga0099795_10136420
625 Ga0105240_10043804
626 Ga0105240_10147897
627 Ga0105240_10149715
628 Ga0105240_10228747
629 Ga0105245_10034074
630 Ga0105245_10077142
631 Ga0105245_10276809
632 Ga0105247_10031978
633 Ga0105243_10041015
634 Ga0105241_10042618
635 Ga0105241_10051615
636 Ga0105241_10222648
637 Ga0105241_10549973
638 Ga0105242_10102464
639 Ga0105242_10120187
640 Ga0105242_10221853
641 Ga0105248_10067537
642 Ga0105248_10186047
643 Ga0105237_10052222
644 Ga0105237_10086624
645 Ga0105237_10125864
646 Ga0105237_10180701
647 Ga0105237_10597096
648 Ga0105237_10964695
649 Ga0105238_10022012
650 Ga0105238_10044234
651 Ga0105238_10076570
652 Ga0105238_10415638
653 Ga0105238_10444297
654 Ga0105249_10057065
655 Ga0105239_10012169
656 Ga0105239_10080860
657 Ga0105239_10123435
658 Ga0105239_10260751
659 Ga0105239_10310046
660 Ga0105239_10661287
661 Ga0157373_10184849
662 Ga0157373_10225724
663 Ga0157371_10012111
664 Ga0157371_10364819
665 Ga0157369_10000770
666 Ga0157369_10028348
667 Ga0157369_10037111
668 Ga0157369_10679763
669 Ga0157374_10000480
670 Ga0157374_10019953
671 Ga0157374_10092121
672 Ga0157374_10221222
673 Ga0157374_10236079
674 Ga0157374_10245246
675 Ga0157374_10395863
676 Ga0157378_10026548
677 Ga0157378_10047025
678 Ga0157378_10106132
679 Ga0157378_10124435
680 Ga0157378_10449720
681 Ga0163162_10022773
682 Ga0163162_10024397
683 Ga0157372_10610431
684 Ga0157372_10815248
685 Ga0157375_10208946
686 Ga0163163_10001469
687 Ga0163163_10054870
688 Ga0163163_10187102
689 Ga0163163_10240814
690 Ga0157379_10077165
691 Ga0157379_10115566
692 Ga0157379_10123460
693 Ga0157379_10134831
694 Ga0157376_10606585
695 Ga0157376_10608394
696 Ga0157376_10982145
697 Ga0182006_1058150
698 Ga0224572_1000228
699 Ga0228598_1000011
700 Ga0228598_1000145
701 Ga0228598_1003318
702 Ga0207692_10017547
703 Ga0207692_10026054
704 Ga0207692_10039158
705 Ga0207692_10172431
706 Ga0207642_10021882
707 Ga0207642_10170888
708 Ga0207710_10037835
709 Ga0207647_10008045
710 Ga0207647_10121516
711 Ga0207699_10001567
712 Ga0207699_10002474
713 Ga0207699_10120683
714 Ga0207699_10194813
715 Ga0207699_10299366
716 Ga0207645_10274382
717 Ga0207643_10392947
718 Ga0207705_10391900
719 Ga0207684_10019812
720 Ga0207684_10272189
721 Ga0207654_10012196
722 Ga0207654_10034724
723 Ga0207707_10008653
724 Ga0207707_10133501
725 Ga0207707_10147608
726 Ga0207707_10585954
727 Ga0207695_10045589
728 Ga0207695_10245158
729 Ga0207671_10090957
730 Ga0207671_10256005
731 Ga0207671_10442644
732 Ga0207693_10000289
733 Ga0207693_10000779
734 Ga0207693_10004114
735 Ga0207693_10042537
736 Ga0207693_10088906
737 Ga0207693_10172768
738 Ga0207663_10000883
739 Ga0207663_10063390
740 Ga0207663_10114163
741 Ga0207663_10205127
742 Ga0207663_10337974
743 Ga0207663_10647896
744 Ga0207660_10096209
745 Ga0207657_10029847
746 Ga0207657_10037084
747 Ga0207649_10028402
748 Ga0207652_10059720
749 Ga0207652_10110445
750 Ga0207652_10277390
751 Ga0207646_10006067
752 Ga0207646_10075018
753 Ga0207646_10450807
754 Ga0207694_10191233
755 Ga0207694_10337871
756 Ga0207687_10084381
757 Ga0207687_10106828
758 Ga0207700_10000372
759 Ga0207700_10298205
760 Ga0207664_10000409
761 Ga0207664_10035549
762 Ga0207706_10000722
763 Ga0207686_10265684
764 Ga0207686_10326706
765 Ga0207670_10154784
766 Ga0207704_10434925
767 Ga0207665_10001070
768 Ga0207665_10001695
769 Ga0207665_10071217
770 Ga0207665_10221973
771 Ga0207665_10444493
772 Ga0207691_10254845
773 Ga0207711_10338049
774 Ga0207689_10000728
775 Ga0207689_10059060
776 Ga0207661_10348449
777 Ga0207679_10221423
778 Ga0207667_10131076
779 Ga0207667_10786125
780 Ga0207651_10329006
781 Ga0207712_10117484
782 Ga0207668_10012863
783 Ga0207640_10108761
784 Ga0207640_10154224
785 Ga0207677_10001955
786 Ga0207677_10174016
787 Ga0207677_10735956
788 Ga0207703_10023668
789 Ga0207639_10014763
790 Ga0207639_10123391
791 Ga0207678_10000405
792 Ga0207702_10173055
793 Ga0207702_10346835
794 Ga0207641_10047692
795 Ga0207641_10051365
796 Ga0207641_10201131
797 Ga0207641_10249422
798 Ga0207641_10493703
799 Ga0207641_10954043
800 Ga0207648_10014256
801 Ga0207648_10142627
802 Ga0207676_10559920
803 Ga0207674_10038730
804 Ga0207674_10057373
805 Ga0207674_10223181
806 Ga0207675_100013550
807 Ga0207675_100095021
808 Ga0207683_10155037
809 Ga0207698_10195252
810 Ga0207698_10485041
811 Ga0265356_1003976
812 Ga0268264_10179483
813 Ga0265338_10025347
814 Ga0265338_10381993
815 Ga0265762_1048021
816 Ga0265770_1005136
817 Ga0265760_10004514
818 Ga0265760_10005073
819 Ga0265760_10006838
820 Ga0265325_10069544
821 Ga0265339_10035743
822 Ga0265316_10015080
823 Ga0265316_10023001
824 Ga0265314_10001739
825 Ga0265342_10018646
826 Ga0373929_0023732
827 Ga0373934_0008394
828 Ga0373944_0046011
829 Ga0373949_0089064
830 Ga0373923_0002712
831 Ga0373936_0011178
832 Ga0373936_0033823
833 Ga0373941_0015514
834 Ga0373945_0000160
835 Ga0373953_0013100
836 Ga0373954_0017041
837 Ga0373954_0254936
838 Ga0373954_0480427
839 Ga0373956_0027477
840 Ga0373943_0000030
841 Ga0373943_0009396
842 Ga0373946_0012917
843 Ga0373946_0076085
844 Ga0373955_0016719
845 Ga0373955_0071011
846 Ga0373955_0292303
847 Ga0373961_0082454
848 Ga0373924_0020381
849 Ga0373931_0019686
850 Ga0373935_0006239
851 Ga0373935_0371923
852 Ga0373927_0014111
853 Ga0373927_0021003
854 Ga0373927_0369813
855 Ga0373927_0467830
856 Ga0373933_0019596
857 Ga0373933_0027185
858 Ga0373947_0000319
859 Ga0373947_0005313
860 Ga0373937_0111307
861 Ga0373937_0639835
862 Ga0373925_0001348
863 Ga0373925_0017259
864 Ga0373925_0028348
865 Ga0373925_0032924
866 Ga0373925_0653456
867 Ga0439448_0011161
868 Ga0451577_0493553
869 Ga0453684_0544782
870 Ga0451576_0129724
871 Ga0451576_0161209
872 Ga0495629_0221053
873 Ga0495651_0331020
874 Ga0495653_0346564
875 Ga0495580_0001015
876 Ga0495580_0002932
877 Ga0495580_0004648
878 Ga0495580_0013871
879 Ga0495580_0021962
880 Ga0495580_0033872
881 Ga0495580_0193789
882 Ga0495580_0238898
883 Ga0495582_0000143
884 Ga0495582_0009560
885 Ga0495664_0136278
886 Ga0495594_0116165
887 Ga0495594_0164589
888 Ga0495630_0043116
889 Ga0495630_0320575
890 Ga0495665_0004649
891 Ga0495665_0145935
892 Ga0495586_0126472
893 Ga0495587_0297632
894 Ga0495667_0181911
895 Ga0495634_0248717
896 Ga0495635_0133574
897 Ga0495588_0121357
898 Ga0495657_0146432
899 Ga0495599_0075544
900 Ga0495599_0318898
901 Ga0495623_0092535
902 Ga0495623_0095778
903 Ga0495669_0005144
904 Ga0495669_0208887
905 Ga0495624_0057373
906 Ga0495581_0025011
907 Ga0495674_0018865
908 Ga0495674_0037711
909 Ga0495674_0186647
910 Ga0495674_0189158
911 Ga0495676_0241336
912 Ga0495675_0154914
913 Ga0495684_0187064
914 Ga0496100_0263715
915 Ga0496100_0323855
916 Ga0496100_0632240
917 Ga0496101_0027489
918 Ga0496101_0108541
919 Ga0496102_0003287
920 Ga0496102_0149945
921 Ga0496102_0513543
922 Ga0496103_0015469
923 Ga0496103_0165672
924 Ga0496104_0040312
925 Ga0496104_0610583
926 Ga0496105_0074833
927 Ga0496105_0394035
928 Ga0496106_0021601
929 Ga0496106_0105487
930 Ga0496106_0122099
931 Ga0496107_0042538
932 Ga0496107_0146192
933 Ga0496108_0160724
934 Ga0496108_0543916
935 Ga0496109_0077131
936 Ga0496109_0386954
937 Ga0496111_0026719
938 Ga0496112_0007066
939 Ga0496112_0021011
940 Ga0496112_0142645
941 Ga0496112_0176124
942 Ga0496112_0437778
943 Ga0496114_0077293
944 Ga0496115_0009266
945 Ga0496115_0106805
946 Ga0496115_0190939
947 Ga0496115_0303968
948 Ga0501067_0148336
949 nmdc:mga0n895_257707_c1
950 nmdc:mga0rr50_193747_c1
951 nmdc:mga0rr50_769236_c1
952 nmdc:mga0rr50_77337_c1
953 nmdc:mga08x19_390010_c1
954 nmdc:mga08x19_781_c1
955 nmdc:mga0a205_2823_c2
956 Ga0495619_0070283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uy4-assembly2.cif.gz_B aminoglycoside-modifying enzyme ant-3,9 in complex with spectinomycin and amp-pnp 0.6656 4 235
5lpa-assembly2.cif.gz_B aada e87q in complex with atp, calcium and dihydrostreptomycin 0.658 1 233
6xxq-assembly2.cif.gz_B crystal structure of spectinomycin adenyltransferase aad(9) from enterococcus faecialis with atp and spectinomycin 0.6548 4 234
4m2y-assembly1.cif.gz_A structure of human dna polymerase beta complexed with 8-brg as the template base in a 1-nucleotide gapped dna 0.6484 4 68
5luh-assembly1.cif.gz_A aada e87q in complex with atp, calcium and streptomycin 0.6483 1 231
ID Description Score Start End Superfamily
4ebkB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8084 4 53 3.30.460.10
af_Q57606_1_96_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7783 1 79 3.30.460.10
af_Q54TZ1_588_696_1.10.1410.10 Mainly Alpha;Orthogonal Bundle;Poly(a)-polymerase, middle domain; 0.7743 7 66 1.10.1410.10
af_Q58701_1_124_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7512 5 110 3.30.460.10
af_Q9VC07_41_150_1.10.1410.10 Mainly Alpha;Orthogonal Bundle;Poly(a)-polymerase, middle domain; 0.7318 2 68 1.10.1410.10
ID Description Score Start End GO Terms
AF-A0A2V9ZS08-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9786 2 238
AF-A0A7C5YYN9-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.975 4 237 GO:0016779
AF-A0A2N9LRQ8-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9739 1 239
AF-A0A2V9WG76-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.972 26 241
AF-A0A2N9LRQ8-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9621 1 239

Map