F451815

General Info

Members Datasets Scaffolds Average Seq Length
477 246 448 210

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2902682994|2902686761
Length 209
Sequence QIPALFVAEAPGLDFLNSVATPVDEQIDWIVDGAGLQDWLQQAGMVSAEALAEMRGRFASAEFDAVAGEARELREWFRRFVTARKGRPLTAADLRELEPLNRLLERDERYGAVVPGAESAFEFRELRRWKSPESLLMPIAEALARLVCDEDFTQVKACEGPRCTLLFADHTRGHARRWCSMAVCGNRAKVAAHRKRRKDQEGAGSQLPD

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
5 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
8 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
9 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
10 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
11 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
12 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
13 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
14 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
15 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
16 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
17 2884411467 Dyella sp. AD56 Isolate Rhizosphere
18 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
19 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
20 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
21 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
22 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
239 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
240 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
241 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
242 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
243 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
244 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
245 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
246 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 0
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 2.73
Rhizoplane 7.97
Rhizosphere 73.38
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000114 3300001915 Bacteria 21871
2 JGI24740J21852_10009799 3300001979 Bacteria 3729
3 JGI25156J39149_1000172 3300002705 Bacteria 47326
4 rootH1_10205646 3300003323 Bacteria 2942
5 JGI25160J50197_1000037 3300003354 Bacteria 162757
6 Ga0055535_1001097 3300003761 Bacteria 16502
7 Ga0055542_1000318 3300003762 Bacteria 51721
8 Ga0065165_1002556 3300005262 Bacteria 15066
9 Ga0070658_10000399 3300005327 Bacteria 37847
10 Ga0070658_10302583 3300005327 Bacteria 1364
11 Ga0070683_100195955 3300005329 Bacteria 1918
12 Ga0070666_10046890 3300005335 Bacteria 2900
13 Ga0070680_100000183 3300005336 Bacteria 40502
14 Ga0070680_100030363 3300005336 Bacteria 4341
15 Ga0070682_100009285 3300005337 Bacteria 5566
16 Ga0070689_100001027 3300005340 Bacteria 17530
17 Ga0070661_100098986 3300005344 Bacteria 2166
18 Ga0070688_100163393 3300005365 Bacteria 1531
19 Ga0070667_100000136 3300005367 Bacteria 93545
20 Ga0070667_100020512 3300005367 Bacteria 5487
21 Ga0070667_100368228 3300005367 Bacteria 1303
22 Ga0070663_100000565 3300005455 Bacteria 19747
23 Ga0070663_100013381 3300005455 Bacteria 5230
24 Ga0070663_100062975 3300005455 Bacteria 2676
25 Ga0070663_100241328 3300005455 Bacteria 1426
26 Ga0070663_100559008 3300005455 Bacteria 957
27 Ga0070663_101000417 3300005455 Bacteria 727
28 Ga0070681_10002026 3300005458 Bacteria 18338
29 Ga0070681_10115466 3300005458 Bacteria 2622
30 Ga0070681_10440161 3300005458 Bacteria 1215
31 Ga0070685_10005257 3300005466 Bacteria 6566
32 Ga0070679_100000957 3300005530 Bacteria 25127
33 Ga0070679_100115505 3300005530 Bacteria 2669
34 Ga0070684_100096390 3300005535 Bacteria 2637
35 Ga0068853_100010235 3300005539 Bacteria 7584
36 Ga0068853_100034167 3300005539 Bacteria 4315
37 Ga0070696_100077471 3300005546 Bacteria 2349
38 Ga0068855_100004498 3300005563 Bacteria 17033
39 Ga0068855_100158385 3300005563 Bacteria 2571
40 Ga0070664_100551205 3300005564 Bacteria 1066
41 Ga0068857_100141472 3300005577 Bacteria 2175
42 Ga0068856_100087296 3300005614 Bacteria 3101
43 Ga0068858_101208536 3300005842 Bacteria 743
44 Ga0068860_100371641 3300005843 Bacteria 1410
45 Ga0070712_100011357 3300006175 Bacteria 5644
46 Ga0075433_10215915 3300006852 Bacteria 1704
47 Ga0075434_101124208 3300006871 Bacteria 799
48 Ga0075435_100096523 3300007076 Bacteria 2445
49 Ga0075435_100334167 3300007076 Bacteria 1298
50 Ga0105240_10002193 3300009093 Bacteria 31894
51 Ga0105240_10011016 3300009093 Bacteria 12656
52 Ga0105240_10090113 3300009093 Bacteria 3749
53 Ga0105240_10181352 3300009093 Bacteria 2484
54 Ga0105240_10942621 3300009093 Bacteria 926
55 Ga0105247_10117039 3300009101 Bacteria 1722
56 Ga0105241_10006522 3300009174 Bacteria 8601
57 Ga0105241_10299166 3300009174 Bacteria 1380
58 Ga0105248_10000896 3300009177 Bacteria 33323
59 Ga0105248_10001703 3300009177 Bacteria 24461
60 Ga0105248_10017622 3300009177 Bacteria 7878
61 Ga0105237_10001196 3300009545 Bacteria 34722
62 Ga0105237_10060121 3300009545 Bacteria 3802
63 Ga0105237_10850821 3300009545 Bacteria 919
64 Ga0105238_10000967 3300009551 Bacteria 29421
65 Ga0105238_10025570 3300009551 Bacteria 6019
66 Ga0105249_10000512 3300009553 Bacteria 35808
67 Ga0105239_10032168 3300010375 Bacteria 5765
68 Ga0105239_11667682 3300010375 Bacteria 738
69 Ga0157371_10000043 3300013102 Bacteria 197887
70 Ga0157371_10182013 3300013102 Bacteria 1503
71 Ga0157370_10001552 3300013104 Bacteria 28454
72 Ga0157370_10088530 3300013104 Bacteria 2908
73 Ga0157370_10205024 3300013104 Bacteria 1828
74 Ga0157369_10001911 3300013105 Bacteria 25132
75 Ga0157369_10051414 3300013105 Bacteria 4459
76 Ga0163162_10001682 3300013306 Bacteria 20745
77 Ga0163162_10332829 3300013306 Bacteria 1651
78 Ga0157372_10090252 3300013307 Bacteria 3483
79 Ga0157372_11684704 3300013307 Unclassified 730
80 Ga0157375_10823070 3300013308 Bacteria 1076
81 Ga0157376_10527262 3300014969 Bacteria 1165
82 Ga0183361_10020 3300016635 Bacteria 128627
83 Ga0209672_100441 3300025228 Bacteria 23665
84 Ga0209672_100974 3300025228 Bacteria 12684
85 Ga0209258_100412 3300025242 Bacteria 51830
86 Ga0209148_1000390 3300025254 Bacteria 51830
87 Ga0209759_1000044 3300025256 Bacteria 241431
88 Ga0209233_1012635 3300025261 Bacteria 2441
89 Ga0209233_1018605 3300025261 Bacteria 1865
90 Ga0209455_1004999 3300025272 Bacteria 4200
91 Ga0209564_1003924 3300025295 Bacteria 9509
92 Ga0207426_1000004 3300025302 Bacteria 1047900
93 Ga0207680_10595780 3300025903 Bacteria 790
94 Ga0207647_10046310 3300025904 Bacteria 2711
95 Ga0207699_10361611 3300025906 Bacteria 1026
96 Ga0207705_10000308 3300025909 Bacteria 45168
97 Ga0207654_10001108 3300025911 Bacteria 14556
98 Ga0207707_10000437 3300025912 Bacteria 43369
99 Ga0207707_10024534 3300025912 Bacteria 5277
100 Ga0207707_10195960 3300025912 Bacteria 1762
101 Ga0207695_10003440 3300025913 Bacteria 22325
102 Ga0207695_10012057 3300025913 Bacteria 10393
103 Ga0207695_10325223 3300025913 Bacteria 1427
104 Ga0207695_10646713 3300025913 Bacteria 938
105 Ga0207671_10007784 3300025914 Bacteria 9226
106 Ga0207671_10098055 3300025914 Bacteria 2217
107 Ga0207671_10237202 3300025914 Bacteria 1432
108 Ga0207693_10028279 3300025915 Bacteria 4430
109 Ga0207663_10428404 3300025916 Bacteria 1017
110 Ga0207660_10004892 3300025917 Bacteria 8725
111 Ga0207657_10003038 3300025919 Bacteria 17970
112 Ga0207649_10000572 3300025920 Bacteria 25183
113 Ga0207652_10001266 3300025921 Bacteria 22511
114 Ga0207694_10046599 3300025924 Bacteria 3351
115 Ga0207694_10082626 3300025924 Bacteria 2525
116 Ga0207694_10098585 3300025924 Bacteria 2314
117 Ga0207694_10466632 3300025924 Bacteria 1055
118 Ga0207664_10636567 3300025929 Bacteria 958
119 Ga0207690_10000827 3300025932 Bacteria 19835
120 Ga0207670_10010677 3300025936 Bacteria 5299
121 Ga0207665_10296693 3300025939 Bacteria 1207
122 Ga0207711_10000283 3300025941 Bacteria 54527
123 Ga0207711_10029320 3300025941 Bacteria 4641
124 Ga0207711_10073428 3300025941 Bacteria 2973
125 Ga0207667_10000069 3300025949 Bacteria 180683
126 Ga0207667_10014541 3300025949 Bacteria 8967
127 Ga0207667_10082047 3300025949 Bacteria 3340
128 Ga0207712_10006154 3300025961 Bacteria 7566
129 Ga0207640_10000465 3300025981 Bacteria 24766
130 Ga0207658_10000547 3300025986 Bacteria 34061
131 Ga0207658_10030799 3300025986 Bacteria 3803
132 Ga0207639_10000527 3300026041 Bacteria 26396
133 Ga0207639_10022669 3300026041 Bacteria 4525
134 Ga0207639_10024463 3300026041 Bacteria 4371
135 Ga0207639_10117751 3300026041 Bacteria 2177
136 Ga0207678_10000304 3300026067 Bacteria 44143
137 Ga0207678_10002800 3300026067 Bacteria 15828
138 Ga0207678_10024156 3300026067 Bacteria 5311
139 Ga0207678_10355393 3300026067 Bacteria 1264
140 Ga0207678_10435355 3300026067 Bacteria 1138
141 Ga0207678_10799635 3300026067 Bacteria 832
142 Ga0207702_10027677 3300026078 Bacteria 4708
143 Ga0207641_10161483 3300026088 Bacteria 2038
144 Ga0207674_10002536 3300026116 Bacteria 23004
145 Ga0207683_10159957 3300026121 Bacteria 2035
146 Ga0207698_10017707 3300026142 Bacteria 4842
147 Ga0307513_10021646 3300031456 Bacteria 7584
148 Ga0307513_10040756 3300031456 Bacteria 5132
149 Ga0307513_10350152 3300031456 Unclassified 1225
150 Ga0307509_10033311 3300031507 Bacteria 5672
151 Ga0307408_100196775 3300031548 Bacteria 1628
152 Ga0307405_10312835 3300031731 Bacteria 1196
153 Ga0373936_0008628 3300035113 Bacteria 3839
154 Ga0373943_0387138 3300035170 Bacteria 806
155 Ga0373935_0276895 3300035692 Bacteria 1180
156 Ga0373927_0129239 3300035695 Bacteria 1650
157 Ga0373927_0530128 3300035695 Bacteria 778
158 Ga0373925_0813468 3300037068 Bacteria 770
159 Ga0395905_0000082 3300037471 Bacteria 158963
160 Ga0395905_0225558 3300037471 Bacteria 1753
161 Ga0466969_0014801 3300044656 Bacteria 4097
162 Ga0466966_0112821 3300044684 Bacteria 1674
163 Ga0466970_0084618 3300044765 Bacteria 1717
164 Ga0466959_0057639 3300045049 Bacteria 2831
165 Ga0466967_0137824 3300045976 Bacteria 2270
166 Ga0495592_0021515 3300046454 Bacteria 4906
167 Ga0495603_0000929 3300046455 Bacteria 16822
168 Ga0495603_0016507 3300046455 Bacteria 4467
169 Ga0495603_0055396 3300046455 Bacteria 2350
170 Ga0495603_0350325 3300046455 Bacteria 847
171 Ga0495591_002408 3300046458 Bacteria 10443
172 Ga0495629_0000143 3300046459 Bacteria 63075
173 Ga0495629_0008830 3300046459 Bacteria 7412
174 Ga0495629_0013120 3300046459 Bacteria 5984
175 Ga0495629_0142398 3300046459 Bacteria 1668
176 Ga0495638_0000111 3300046460 Bacteria 130877
177 Ga0495638_0016629 3300046460 Bacteria 4922
178 Ga0495641_0009380 3300046461 Bacteria 5818
179 Ga0495641_0061181 3300046461 Bacteria 1700
180 Ga0495651_0007548 3300046462 Bacteria 8319
181 Ga0495651_0057173 3300046462 Bacteria 2995
182 Ga0495651_0064271 3300046462 Bacteria 2805
183 Ga0495651_0179739 3300046462 Bacteria 1498
184 Ga0495653_0000737 3300046463 Bacteria 24985
185 Ga0495653_0019368 3300046463 Bacteria 5519
186 Ga0495650_0001898 3300046471 Bacteria 18542
187 Ga0495650_0006581 3300046471 Bacteria 7221
188 Ga0495650_0017015 3300046471 Bacteria 3657
189 Ga0495650_0160494 3300046471 Bacteria 802
190 Ga0495580_0000009 3300046472 Bacteria 101827
191 Ga0495580_0001158 3300046472 Bacteria 23176
192 Ga0495580_0004987 3300046472 Bacteria 11082
193 Ga0495580_0007285 3300046472 Bacteria 8895
194 Ga0495580_0014393 3300046472 Bacteria 5999
195 Ga0495580_0028017 3300046472 Bacteria 4096
196 Ga0495580_0249810 3300046472 Bacteria 1214
197 Ga0495582_0009904 3300046473 Bacteria 5244
198 Ga0495582_0014553 3300046473 Bacteria 4322
199 Ga0495605_0003628 3300046474 Bacteria 9159
200 Ga0495639_0030013 3300046475 Bacteria 2415
201 Ga0495662_0006159 3300046476 Bacteria 5997
202 Ga0495662_0026940 3300046476 Bacteria 2776
203 Ga0495664_0005113 3300046477 Bacteria 7193
204 Ga0495664_0006308 3300046477 Bacteria 6548
205 Ga0495664_0450480 3300046477 Bacteria 771
206 Ga0495585_0083268 3300046492 Bacteria 1731
207 Ga0495594_0145935 3300046499 Bacteria 1342
208 Ga0495583_0005202 3300046506 Bacteria 8943
209 Ga0495583_0017922 3300046506 Bacteria 3743
210 Ga0495606_0055818 3300046507 Bacteria 2552
211 Ga0495606_0095892 3300046507 Bacteria 1815
212 Ga0495608_0001297 3300046511 Bacteria 17779
213 Ga0495616_0095289 3300046513 Bacteria 1403
214 Ga0495618_0001439 3300046514 Bacteria 15961
215 Ga0495618_0011071 3300046514 Bacteria 5467
216 Ga0495620_0023213 3300046515 Bacteria 2971
217 Ga0495628_0006405 3300046516 Bacteria 10282
218 Ga0495628_0012972 3300046516 Bacteria 7018
219 Ga0495628_0024596 3300046516 Bacteria 4927
220 Ga0495628_0340849 3300046516 Bacteria 1103
221 Ga0495628_0635627 3300046516 Bacteria 759
222 Ga0495630_0009569 3300046517 Bacteria 6968
223 Ga0495630_0016134 3300046517 Bacteria 5458
224 Ga0495630_0024698 3300046517 Bacteria 4441
225 Ga0495631_0076659 3300046518 Bacteria 1443
226 Ga0495644_0019982 3300046523 Bacteria 2556
227 Ga0495644_0058371 3300046523 Bacteria 1451
228 Ga0495648_0002735 3300046524 Bacteria 15929
229 Ga0495648_0020269 3300046524 Bacteria 4642
230 Ga0495648_0051925 3300046524 Bacteria 2494
231 Ga0495648_0068239 3300046524 Bacteria 2075
232 Ga0495648_0165056 3300046524 Unclassified 1141
233 Ga0495648_0192046 3300046524 Bacteria 1029
234 Ga0495666_0000120 3300046526 Bacteria 32561
235 Ga0495666_0001152 3300046526 Bacteria 12678
236 Ga0495642_0000612 3300046528 Bacteria 17990
237 Ga0495642_0100549 3300046528 Bacteria 1230
238 Ga0495642_0126984 3300046528 Bacteria 1096
239 Ga0495642_0142104 3300046528 Bacteria 1036
240 Ga0495652_0036294 3300046529 Bacteria 4287
241 Ga0495652_0039967 3300046529 Bacteria 4054
242 Ga0495652_0228095 3300046529 Bacteria 1395
243 Ga0495654_0115975 3300046530 Bacteria 1217
244 Ga0495665_0005605 3300046531 Bacteria 6765
245 Ga0495665_0018655 3300046531 Bacteria 3725
246 Ga0495665_0066174 3300046531 Bacteria 1907
247 Ga0495665_0365039 3300046531 Bacteria 734
248 Ga0495640_0004132 3300046533 Bacteria 11616
249 Ga0495640_0017927 3300046533 Bacteria 5263
250 Ga0495586_0009056 3300046535 Bacteria 5293
251 Ga0495586_0032462 3300046535 Bacteria 2799
252 Ga0495587_0006325 3300046536 Bacteria 7726
253 Ga0495587_0016108 3300046536 Bacteria 4654
254 Ga0495645_0000185 3300046543 Bacteria 44326
255 Ga0495645_0012507 3300046543 Bacteria 5981
256 Ga0495645_0035527 3300046543 Bacteria 3633
257 Ga0495622_0000115 3300046557 Bacteria 69111
258 Ga0495622_0004862 3300046557 Bacteria 6222
259 Ga0495622_0125231 3300046557 Bacteria 1172
260 Ga0495667_0232867 3300046559 Bacteria 1174
261 Ga0495634_0010866 3300046642 Bacteria 6651
262 Ga0495634_0013209 3300046642 Bacteria 5969
263 Ga0495611_0030765 3300046648 Bacteria 2361
264 Ga0495625_0003803 3300046660 Bacteria 14613
265 Ga0495625_0139973 3300046660 Bacteria 1633
266 Ga0495635_0007446 3300046663 Bacteria 7640
267 Ga0495635_0009724 3300046663 Bacteria 6722
268 Ga0495661_0002143 3300046665 Bacteria 15471
269 Ga0495661_0011745 3300046665 Bacteria 5933
270 Ga0495661_0123035 3300046665 Bacteria 1430
271 Ga0495588_0061778 3300046674 Bacteria 1941
272 Ga0495588_0077478 3300046674 Bacteria 1734
273 Ga0495657_0436849 3300046675 Bacteria 767
274 Ga0495599_0006460 3300046678 Bacteria 7071
275 Ga0495599_0009180 3300046678 Bacteria 6035
276 Ga0495599_0010321 3300046678 Bacteria 5713
277 Ga0495623_0001156 3300046679 Bacteria 17864
278 Ga0495623_0016674 3300046679 Bacteria 4745
279 Ga0495623_0021498 3300046679 Bacteria 4165
280 Ga0495646_0003033 3300046680 Bacteria 10400
281 Ga0495646_0003614 3300046680 Bacteria 9646
282 Ga0495646_0012954 3300046680 Bacteria 5302
283 Ga0495646_0022234 3300046680 Bacteria 4000
284 Ga0495669_0047484 3300046684 Bacteria 1918
285 Ga0495669_0242164 3300046684 Bacteria 866
286 Ga0495669_0275252 3300046684 Unclassified 809
287 Ga0495613_0009998 3300046689 Bacteria 7048
288 Ga0495613_0026844 3300046689 Bacteria 4287
289 Ga0495613_0031318 3300046689 Bacteria 3950
290 Ga0495624_0006337 3300046690 Bacteria 8408
291 Ga0495624_0015397 3300046690 Bacteria 5164
292 Ga0495624_0055155 3300046690 Bacteria 2504
293 Ga0495624_0059734 3300046690 Bacteria 2391
294 Ga0495670_0004048 3300046691 Bacteria 7185
295 Ga0495671_0009124 3300046692 Bacteria 5554
296 Ga0495671_0065520 3300046692 Bacteria 1788
297 Ga0495671_0205134 3300046692 Bacteria 956
298 Ga0495589_0001700 3300046794 Bacteria 12563
299 Ga0495589_0004999 3300046794 Bacteria 7022
300 Ga0495589_0015709 3300046794 Bacteria 3892
301 Ga0495589_0043676 3300046794 Bacteria 2230
302 Ga0495589_0058608 3300046794 Bacteria 1893
303 Ga0495600_0001350 3300046809 Bacteria 13532
304 Ga0495600_0114148 3300046809 Bacteria 1759
305 Ga0495600_0131611 3300046809 Bacteria 1626
306 Ga0495581_0001554 3300047315 Bacteria 12820
307 Ga0495581_0018191 3300047315 Bacteria 4082
308 Ga0495581_0027121 3300047315 Bacteria 3322
309 Ga0495604_0000506 3300047317 Bacteria 34325
310 Ga0495604_0014415 3300047317 Bacteria 6305
311 Ga0495604_0033752 3300047317 Bacteria 4050
312 Ga0495674_0008135 3300047319 Bacteria 10006
313 Ga0495674_0015958 3300047319 Bacteria 7011
314 Ga0495674_0046809 3300047319 Bacteria 3838
315 Ga0495674_0106682 3300047319 Bacteria 2378
316 Ga0495674_0183950 3300047319 Bacteria 1739
317 Ga0495674_0556404 3300047319 Bacteria 912
318 Ga0495672_0066551 3300047320 Bacteria 2055
319 Ga0495672_0067462 3300047320 Bacteria 2037
320 Ga0495672_0258634 3300047320 Bacteria 841
321 Ga0495672_0264085 3300047320 Bacteria 829
322 Ga0495676_0007408 3300047321 Bacteria 10070
323 Ga0495676_0013610 3300047321 Bacteria 7303
324 Ga0495676_0019381 3300047321 Bacteria 5984
325 Ga0495680_0021803 3300047322 Bacteria 5353
326 Ga0495680_0057678 3300047322 Bacteria 3002
327 Ga0495680_0100401 3300047322 Bacteria 2156
328 Ga0495683_0004809 3300047323 Bacteria 7576
329 Ga0495683_0059832 3300047323 Bacteria 1889
330 Ga0495687_050531 3300047443 Bacteria 1771
331 Ga0495675_0006465 3300047444 Bacteria 7172
332 Ga0495675_0037617 3300047444 Bacteria 3082
333 Ga0495675_0137863 3300047444 Bacteria 1513
334 Ga0495679_000012 3300047446 Bacteria 319098
335 Ga0495679_001038 3300047446 Bacteria 16983
336 Ga0495679_002598 3300047446 Bacteria 9074
337 Ga0495673_0051169 3300047469 Bacteria 1810
338 Ga0495673_0060636 3300047469 Bacteria 1622
339 Ga0495681_0039171 3300047470 Bacteria 2317
340 Ga0495686_0000012 3300047472 Bacteria 508428
341 Ga0495686_0106247 3300047472 Bacteria 1688
342 Ga0495593_0001773 3300047673 Bacteria 12782
343 Ga0495593_0005056 3300047673 Bacteria 7797
344 Ga0495593_0008877 3300047673 Bacteria 5832
345 Ga0495593_0024447 3300047673 Bacteria 3348
346 Ga0495593_0195673 3300047673 Bacteria 1016
347 Ga0495602_0028287 3300048088 Bacteria 5367
348 Ga0495602_0032705 3300048088 Bacteria 4893
349 Ga0495602_0134727 3300048088 Bacteria 1964
350 Ga0495614_0004342 3300048089 Bacteria 6391
351 Ga0495614_0009233 3300048089 Bacteria 4367
352 Ga0495614_0011128 3300048089 Bacteria 3959
353 Ga0496100_0000137 3300048903 Bacteria 40757
354 Ga0496100_0171102 3300048903 Bacteria 1564
355 Ga0496101_0000044 3300048904 Bacteria 161295
356 Ga0496101_0288778 3300048904 Bacteria 1283
357 Ga0496101_0372907 3300048904 Bacteria 1122
358 Ga0496102_0000320 3300048905 Bacteria 60114
359 Ga0496102_0000379 3300048905 Bacteria 53037
360 Ga0496102_0010846 3300048905 Bacteria 7845
361 Ga0496102_0023246 3300048905 Bacteria 5502
362 Ga0496102_0415393 3300048905 Bacteria 1264
363 Ga0496103_0000605 3300048906 Bacteria 28172
364 Ga0496103_0000724 3300048906 Bacteria 24379
365 Ga0496103_0004730 3300048906 Bacteria 8236
366 Ga0496104_0027458 3300048907 Bacteria 5267
367 Ga0496104_0039574 3300048907 Bacteria 4414
368 Ga0496104_0152694 3300048907 Bacteria 2216
369 Ga0496104_0253207 3300048907 Bacteria 1674
370 Ga0496105_0004554 3300048908 Bacteria 10438
371 Ga0496105_0026423 3300048908 Bacteria 4734
372 Ga0496105_0161742 3300048908 Bacteria 1838
373 Ga0496106_0000003 3300048909 Bacteria 305293
374 Ga0496106_0054681 3300048909 Bacteria 3016
375 Ga0496106_0567232 3300048909 Bacteria 910
376 Ga0496107_0063657 3300048910 Bacteria 2673
377 Ga0496107_0118066 3300048910 Bacteria 1953
378 Ga0496107_0519110 3300048910 Bacteria 883
379 Ga0496107_0722698 3300048910 Bacteria 732
380 Ga0496109_0059587 3300048912 Bacteria 3488
381 Ga0496110_0043902 3300048913 Bacteria 3903
382 Ga0496110_0364798 3300048913 Bacteria 1316
383 Ga0496111_0012034 3300048914 Bacteria 5848
384 Ga0496113_0055552 3300048916 Bacteria 2968
385 Ga0496113_0326456 3300048916 Bacteria 1230
386 Ga0496114_0002609 3300048917 Bacteria 13763
387 Ga0496115_0000061 3300048918 Bacteria 101438
388 Ga0496115_0023967 3300048918 Bacteria 4739
389 Ga0496115_0044894 3300048918 Bacteria 3526
390 Ga0496115_0535313 3300048918 Bacteria 938
391 Ga0496116_0003377 3300048919 Bacteria 15832
392 Ga0496116_0113009 3300048919 Unclassified 1590
393 Ga0496117_0000098 3300048920 Bacteria 196331
394 Ga0496117_0000281 3300048920 Bacteria 94664
395 Ga0496117_0004004 3300048920 Bacteria 16622
396 Ga0496117_0105324 3300048920 Unclassified 1773
397 Ga0496117_0237668 3300048920 Bacteria 1002
398 Ga0496117_0259826 3300048920 Unclassified 942
399 Ga0496118_0000167 3300048921 Bacteria 119146
400 Ga0496118_0000533 3300048921 Bacteria 62461
401 Ga0496118_0000555 3300048921 Bacteria 61594
402 Ga0496118_0010703 3300048921 Bacteria 9043
403 Ga0496118_0023634 3300048921 Bacteria 5331
404 Ga0496118_0068633 3300048921 Bacteria 2573
405 Ga0496118_0219699 3300048921 Unclassified 1107
406 Ga0496119_0002464 3300048922 Bacteria 20306
407 Ga0496119_0005589 3300048922 Bacteria 11955
408 Ga0496119_0078200 3300048922 Bacteria 1914
409 Ga0496121_0002679 3300048924 Bacteria 26637
410 Ga0496121_0006684 3300048924 Bacteria 14177
411 Ga0496121_0019834 3300048924 Bacteria 6696
412 Ga0496121_0035624 3300048924 Bacteria 4455
413 Ga0496121_0057644 3300048924 Bacteria 3217
414 Ga0496121_0075479 3300048924 Bacteria 2693
415 Ga0496121_0094481 3300048924 Bacteria 2326
416 Ga0496121_0101970 3300048924 Bacteria 2212
417 Ga0496122_0000749 3300048925 Bacteria 63273
418 Ga0496122_0067594 3300048925 Bacteria 2573
419 Ga0496122_0114325 3300048925 Bacteria 1761
420 Ga0496123_0000566 3300048926 Bacteria 63317
421 Ga0496123_0014068 3300048926 Bacteria 6658
422 Ga0496124_0000266 3300048927 Bacteria 101288
423 Ga0496125_0001502 3300048928 Bacteria 33409
424 Ga0496126_0000248 3300048929 Bacteria 116557
425 Ga0496126_0000819 3300048929 Bacteria 55474
426 Ga0496126_0017450 3300048929 Bacteria 7151
427 Ga0496126_0160550 3300048929 Bacteria 1921
428 Ga0496126_0246723 3300048929 Bacteria 1489
429 Ga0496126_0260079 3300048929 Unclassified 1444
430 Ga0495678_036250 3300049459 Bacteria 2014
431 Ga0495682_0006694 3300049460 Bacteria 4651
432 Ga0495682_0043804 3300049460 Bacteria 1638
433 Ga0501034_0777534 3300049571 Bacteria 851
434 Ga0501036_0635132 3300049572 Bacteria 884
435 Ga0501046_0623029 3300049580 Bacteria 764
436 Ga0501047_0043344 3300049581 Bacteria 4346
437 Ga0501070_0751196 3300049586 Bacteria 769
438 Ga0501044_0072505 3300049823 Bacteria 3501
439 nmdc:mga0n895_867459_c1 3300050512 Bacteria 890
440 nmdc:mga0rr50_134038_c1 3300050513 Bacteria 1986
441 nmdc:mga0rr50_501313_c1 3300050513 Bacteria 1032
442 nmdc:mga0a205_240275_c1 3300050515 Bacteria 1692
443 Ga0500647_0164903 3300053091 Bacteria 1026
444 Ga0500566_0000095 3300053094 Bacteria 44474
445 Ga0500650_0159422 3300053098 Bacteria 1041
446 Ga0500556_0000070 3300053104 Bacteria 101159
447 Ga0500638_037813 3300053162 Bacteria 2343
448 Ga0500639_139414 3300053163 Bacteria 1136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053104 Ga0500556_0000070 Ga0500556_0000070_44166_44783 200
2 iso_pu_bacteria 2515154122 2515684777 200
3 iso_pu_bacteria 2902682994 2902686761 200
4 3300045976 Ga0466967_0137824 Ga0466967_0137824_111_731 202
5 3300046460 Ga0495638_0000111 Ga0495638_0000111_65631_66251 202
6 3300046557 Ga0495622_0004862 Ga0495622_0004862_2829_3449 202
7 3300046660 Ga0495625_0003803 Ga0495625_0003803_5891_6511 202
8 3300048907 Ga0496104_0027458 Ga0496104_0027458_3335_3955 202
9 3300048918 Ga0496115_0023967 Ga0496115_0023967_2312_2932 202
10 3300048921 Ga0496118_0068633 Ga0496118_0068633_1408_2031 202
11 3300048924 Ga0496121_0075479 Ga0496121_0075479_1017_1640 202
12 3300048929 Ga0496126_0017450 Ga0496126_0017450_966_1586 202
13 3300048929 Ga0496126_0260079 Ga0496126_0260079_507_1130 202
14 iso_pu_bacteria 2884411467 2884411964 202
15 3300005336 Ga0070680_100000183 Ga0070680_10000018318 203
16 3300005337 Ga0070682_100009285 Ga0070682_1000092852 203
17 3300005458 Ga0070681_10002026 Ga0070681_100020262 203
18 3300005458 Ga0070681_10440161 Ga0070681_104401612 203
19 3300005530 Ga0070679_100000957 Ga0070679_10000095712 203
20 3300005563 Ga0068855_100004498 Ga0068855_1000044985 203
21 3300005564 Ga0070664_100551205 Ga0070664_1005512052 203
22 3300007076 Ga0075435_100334167 Ga0075435_1003341671 203
23 3300009093 Ga0105240_10002193 Ga0105240_1000219314 203
24 3300009093 Ga0105240_10011016 Ga0105240_1001101610 203
25 3300009545 Ga0105237_10060121 Ga0105237_100601212 203
26 3300009551 Ga0105238_10000967 Ga0105238_1000096716 203
27 3300013104 Ga0157370_10001552 Ga0157370_1000155218 203
28 3300013105 Ga0157369_10001911 Ga0157369_1000191117 203
29 3300013307 Ga0157372_11684704 Ga0157372_116847041 203
30 3300025912 Ga0207707_10000437 Ga0207707_1000043710 203
31 3300025912 Ga0207707_10024534 Ga0207707_100245345 203
32 3300025913 Ga0207695_10012057 Ga0207695_100120575 203
33 3300025914 Ga0207671_10237202 Ga0207671_102372022 203
34 3300025917 Ga0207660_10004892 Ga0207660_100048928 203
35 3300025921 Ga0207652_10001266 Ga0207652_100012664 203
36 3300025924 Ga0207694_10082626 Ga0207694_100826261 203
37 3300025949 Ga0207667_10014541 Ga0207667_100145412 203
38 3300035113 Ga0373936_0008628 Ga0373936_0008628_1471_2097 203
39 3300050513 nmdc:mga0rr50_501313_c1 nmdc:mga0rr50_501313_c1_270_893 203
40 3300053091 Ga0500647_0164903 Ga0500647_0164903_305_931 203
41 3300053094 Ga0500566_0000095 Ga0500566_0000095_28475_29101 203
42 3300053162 Ga0500638_037813 Ga0500638_037813_1450_2076 203
43 3300053163 Ga0500639_139414 Ga0500639_139414_28_654 203
44 iso_pu_bacteria 2501025501 2501071652 203
45 iso_pu_bacteria 2510917015 2511109238 203
46 iso_pu_bacteria 2513237166 2514047270 203
47 iso_pu_bacteria 2515154189 2516024050 203
48 iso_pu_bacteria 2562617112 2563059703 203
49 iso_pu_bacteria 2711768613 2713480589 203
50 iso_pu_bacteria 2721755763 2723876117 203
51 iso_pu_bacteria 2744054900 2746089119 203
52 iso_pu_bacteria 2744054901 2746097251 203
53 iso_pu_bacteria 2791355137 2792835416 203
54 iso_pu_bacteria 2818991472 2819747115 203
55 iso_pu_bacteria 2842324504 2842327283 203
56 iso_pu_bacteria 2842348783 2842352110 203
57 iso_pu_bacteria 2842454564 2842458353 203
58 iso_pu_bacteria 2883087390 2883095626 203
59 iso_pu_bacteria 2904615490 2904620097 203
60 iso_pu_bacteria 2921643360 2921648362 203
61 iso_pu_bacteria 642555112 642598135 203
62 iso_pu_bacteria 642555113 642618197 203
63 3300002705 JGI25156J39149_1000172 JGI25156J39149_100017236 204
64 3300003323 rootH1_10205646 rootH1_102056463 204
65 3300003354 JGI25160J50197_1000037 JGI25160J50197_100003713 204
66 3300003761 Ga0055535_1001097 Ga0055535_100109712 204
67 3300003762 Ga0055542_1000318 Ga0055542_100031823 204
68 3300005262 Ga0065165_1002556 Ga0065165_10025565 204
69 3300005335 Ga0070666_10046890 Ga0070666_100468901 204
70 3300005340 Ga0070689_100001027 Ga0070689_10000102714 204
71 3300005365 Ga0070688_100163393 Ga0070688_1001633932 204
72 3300005367 Ga0070667_100000136 Ga0070667_1000001363 204
73 3300005367 Ga0070667_100020512 Ga0070667_1000205125 204
74 3300005367 Ga0070667_100368228 Ga0070667_1003682282 204
75 3300005455 Ga0070663_100000565 Ga0070663_1000005653 204
76 3300005455 Ga0070663_100013381 Ga0070663_1000133814 204
77 3300005455 Ga0070663_100062975 Ga0070663_1000629751 204
78 3300005455 Ga0070663_100559008 Ga0070663_1005590081 204
79 3300005455 Ga0070663_101000417 Ga0070663_1010004171 204
80 3300005466 Ga0070685_10005257 Ga0070685_100052576 204
81 3300005539 Ga0068853_100010235 Ga0068853_1000102352 204
82 3300005546 Ga0070696_100077471 Ga0070696_1000774712 204
83 3300005842 Ga0068858_101208536 Ga0068858_1012085361 204
84 3300005843 Ga0068860_100371641 Ga0068860_1003716411 204
85 3300006852 Ga0075433_10215915 Ga0075433_102159152 204
86 3300006871 Ga0075434_101124208 Ga0075434_1011242081 204
87 3300007076 Ga0075435_100096523 Ga0075435_1000965233 204
88 3300009093 Ga0105240_10090113 Ga0105240_100901132 204
89 3300009093 Ga0105240_10942621 Ga0105240_109426212 204
90 3300009101 Ga0105247_10117039 Ga0105247_101170392 204
91 3300009174 Ga0105241_10299166 Ga0105241_102991662 204
92 3300009177 Ga0105248_10000896 Ga0105248_100008964 204
93 3300009177 Ga0105248_10001703 Ga0105248_100017035 204
94 3300009177 Ga0105248_10017622 Ga0105248_100176223 204
95 3300009545 Ga0105237_10001196 Ga0105237_100011963 204
96 3300009553 Ga0105249_10000512 Ga0105249_100005123 204
97 3300010375 Ga0105239_10032168 Ga0105239_100321682 204
98 3300013102 Ga0157371_10182013 Ga0157371_101820132 204
99 3300013104 Ga0157370_10205024 Ga0157370_102050242 204
100 3300013105 Ga0157369_10051414 Ga0157369_100514143 204
101 3300013306 Ga0163162_10001682 Ga0163162_1000168220 204
102 3300013306 Ga0163162_10332829 Ga0163162_103328292 204
103 3300013307 Ga0157372_10090252 Ga0157372_100902522 204
104 3300013308 Ga0157375_10823070 Ga0157375_108230701 204
105 3300014969 Ga0157376_10527262 Ga0157376_105272622 204
106 3300016635 Ga0183361_10020 Ga0183361_1002040 204
107 3300025228 Ga0209672_100441 Ga0209672_10044113 204
108 3300025228 Ga0209672_100974 Ga0209672_1009743 204
109 3300025242 Ga0209258_100412 Ga0209258_10041223 204
110 3300025254 Ga0209148_1000390 Ga0209148_100039023 204
111 3300025256 Ga0209759_1000044 Ga0209759_100004462 204
112 3300025261 Ga0209233_1012635 Ga0209233_10126352 204
113 3300025272 Ga0209455_1004999 Ga0209455_10049995 204
114 3300025295 Ga0209564_1003924 Ga0209564_10039246 204
115 3300025302 Ga0207426_1000004 Ga0207426_1000004520 204
116 3300025903 Ga0207680_10595780 Ga0207680_105957801 204
117 3300025913 Ga0207695_10325223 Ga0207695_103252232 204
118 3300025913 Ga0207695_10646713 Ga0207695_106467132 204
119 3300025914 Ga0207671_10007784 Ga0207671_100077843 204
120 3300025924 Ga0207694_10098585 Ga0207694_100985852 204
121 3300025929 Ga0207664_10636567 Ga0207664_106365671 204
122 3300025936 Ga0207670_10010677 Ga0207670_100106777 204
123 3300025941 Ga0207711_10000283 Ga0207711_1000028332 204
124 3300025941 Ga0207711_10029320 Ga0207711_100293205 204
125 3300025941 Ga0207711_10073428 Ga0207711_100734283 204
126 3300025961 Ga0207712_10006154 Ga0207712_100061543 204
127 3300025986 Ga0207658_10000547 Ga0207658_100005473 204
128 3300025986 Ga0207658_10030799 Ga0207658_100307992 204
129 3300026041 Ga0207639_10024463 Ga0207639_100244636 204
130 3300026067 Ga0207678_10000304 Ga0207678_1000030429 204
131 3300026067 Ga0207678_10024156 Ga0207678_100241564 204
132 3300026067 Ga0207678_10355393 Ga0207678_103553932 204
133 3300026067 Ga0207678_10435355 Ga0207678_104353551 204
134 3300026067 Ga0207678_10799635 Ga0207678_107996351 204
135 3300026121 Ga0207683_10159957 Ga0207683_101599572 204
136 3300031456 Ga0307513_10040756 Ga0307513_100407567 204
137 3300031456 Ga0307513_10350152 Ga0307513_103501522 204
138 3300031507 Ga0307509_10033311 Ga0307509_100333116 204
139 3300031548 Ga0307408_100196775 Ga0307408_1001967751 204
140 3300031731 Ga0307405_10312835 Ga0307405_103128351 204
141 3300035692 Ga0373935_0276895 Ga0373935_0276895_346_1008 204
142 3300035695 Ga0373927_0129239 Ga0373927_0129239_854_1516 204
143 3300035695 Ga0373927_0530128 Ga0373927_0530128_94_720 204
144 3300037068 Ga0373925_0813468 Ga0373925_0813468_20_682 204
145 3300037471 Ga0395905_0000082 Ga0395905_0000082_147048_147680 204
146 3300037471 Ga0395905_0225558 Ga0395905_0225558_799_1431 204
147 3300044656 Ga0466969_0014801 Ga0466969_0014801_2135_2770 204
148 3300044684 Ga0466966_0112821 Ga0466966_0112821_560_1195 204
149 3300044765 Ga0466970_0084618 Ga0466970_0084618_393_1028 204
150 3300045049 Ga0466959_0057639 Ga0466959_0057639_2088_2723 204
151 3300046454 Ga0495592_0021515 Ga0495592_0021515_1794_2426 204
152 3300046455 Ga0495603_0000929 Ga0495603_0000929_12885_13517 204
153 3300046455 Ga0495603_0016507 Ga0495603_0016507_3281_3913 204
154 3300046455 Ga0495603_0055396 Ga0495603_0055396_1011_1643 204
155 3300046455 Ga0495603_0350325 Ga0495603_0350325_72_698 204
156 3300046458 Ga0495591_002408 Ga0495591_002408_9346_9978 204
157 3300046459 Ga0495629_0000143 Ga0495629_0000143_10277_10909 204
158 3300046459 Ga0495629_0008830 Ga0495629_0008830_2545_3177 204
159 3300046459 Ga0495629_0013120 Ga0495629_0013120_3281_3913 204
160 3300046459 Ga0495629_0142398 Ga0495629_0142398_743_1375 204
161 3300046460 Ga0495638_0016629 Ga0495638_0016629_4008_4640 204
162 3300046461 Ga0495641_0009380 Ga0495641_0009380_5000_5632 204
163 3300046461 Ga0495641_0061181 Ga0495641_0061181_942_1574 204
164 3300046462 Ga0495651_0007548 Ga0495651_0007548_2667_3299 204
165 3300046462 Ga0495651_0057173 Ga0495651_0057173_625_1257 204
166 3300046462 Ga0495651_0064271 Ga0495651_0064271_1567_2199 204
167 3300046462 Ga0495651_0179739 Ga0495651_0179739_432_1064 204
168 3300046463 Ga0495653_0000737 Ga0495653_0000737_13790_14422 204
169 3300046463 Ga0495653_0019368 Ga0495653_0019368_1608_2240 204
170 3300046471 Ga0495650_0006581 Ga0495650_0006581_5587_6219 204
171 3300046471 Ga0495650_0017015 Ga0495650_0017015_511_1143 204
172 3300046471 Ga0495650_0160494 Ga0495650_0160494_71_709 204
173 3300046472 Ga0495580_0000009 Ga0495580_0000009_12124_12756 204
174 3300046472 Ga0495580_0001158 Ga0495580_0001158_3280_3912 204
175 3300046472 Ga0495580_0004987 Ga0495580_0004987_770_1402 204
176 3300046472 Ga0495580_0007285 Ga0495580_0007285_4755_5387 204
177 3300046472 Ga0495580_0014393 Ga0495580_0014393_5255_5887 204
178 3300046472 Ga0495580_0249810 Ga0495580_0249810_309_941 204
179 3300046473 Ga0495582_0009904 Ga0495582_0009904_1361_1993 204
180 3300046473 Ga0495582_0014553 Ga0495582_0014553_2210_2842 204
181 3300046474 Ga0495605_0003628 Ga0495605_0003628_8510_9142 204
182 3300046475 Ga0495639_0030013 Ga0495639_0030013_883_1515 204
183 3300046476 Ga0495662_0006159 Ga0495662_0006159_3281_3913 204
184 3300046476 Ga0495662_0026940 Ga0495662_0026940_566_1198 204
185 3300046477 Ga0495664_0005113 Ga0495664_0005113_30_662 204
186 3300046477 Ga0495664_0006308 Ga0495664_0006308_2683_3315 204
187 3300046492 Ga0495585_0083268 Ga0495585_0083268_20_652 204
188 3300046499 Ga0495594_0145935 Ga0495594_0145935_156_788 204
189 3300046506 Ga0495583_0005202 Ga0495583_0005202_5344_5976 204
190 3300046507 Ga0495606_0055818 Ga0495606_0055818_127_759 204
191 3300046511 Ga0495608_0001297 Ga0495608_0001297_12676_13308 204
192 3300046513 Ga0495616_0095289 Ga0495616_0095289_281_913 204
193 3300046514 Ga0495618_0001439 Ga0495618_0001439_5084_5716 204
194 3300046514 Ga0495618_0011071 Ga0495618_0011071_3266_3898 204
195 3300046516 Ga0495628_0006405 Ga0495628_0006405_435_1067 204
196 3300046516 Ga0495628_0012972 Ga0495628_0012972_5230_5862 204
197 3300046516 Ga0495628_0024596 Ga0495628_0024596_3043_3675 204
198 3300046516 Ga0495628_0635627 Ga0495628_0635627_80_712 204
199 3300046517 Ga0495630_0009569 Ga0495630_0009569_4669_5301 204
200 3300046517 Ga0495630_0024698 Ga0495630_0024698_2978_3610 204
201 3300046518 Ga0495631_0076659 Ga0495631_0076659_755_1387 204
202 3300046523 Ga0495644_0019982 Ga0495644_0019982_1789_2421 204
203 3300046523 Ga0495644_0058371 Ga0495644_0058371_557_1189 204
204 3300046524 Ga0495648_0002735 Ga0495648_0002735_5546_6178 204
205 3300046524 Ga0495648_0020269 Ga0495648_0020269_2119_2751 204
206 3300046524 Ga0495648_0051925 Ga0495648_0051925_1812_2444 204
207 3300046524 Ga0495648_0165056 Ga0495648_0165056_185_817 204
208 3300046524 Ga0495648_0192046 Ga0495648_0192046_277_909 204
209 3300046526 Ga0495666_0000120 Ga0495666_0000120_31848_32480 204
210 3300046526 Ga0495666_0001152 Ga0495666_0001152_3271_3903 204
211 3300046528 Ga0495642_0000612 Ga0495642_0000612_7512_8144 204
212 3300046528 Ga0495642_0100549 Ga0495642_0100549_187_819 204
213 3300046528 Ga0495642_0126984 Ga0495642_0126984_288_920 204
214 3300046528 Ga0495642_0142104 Ga0495642_0142104_256_888 204
215 3300046529 Ga0495652_0036294 Ga0495652_0036294_376_1008 204
216 3300046529 Ga0495652_0039967 Ga0495652_0039967_2495_3127 204
217 3300046529 Ga0495652_0228095 Ga0495652_0228095_634_1266 204
218 3300046530 Ga0495654_0115975 Ga0495654_0115975_566_1198 204
219 3300046531 Ga0495665_0005605 Ga0495665_0005605_1563_2195 204
220 3300046531 Ga0495665_0018655 Ga0495665_0018655_51_683 204
221 3300046531 Ga0495665_0066174 Ga0495665_0066174_977_1609 204
222 3300046533 Ga0495640_0004132 Ga0495640_0004132_431_1063 204
223 3300046533 Ga0495640_0017927 Ga0495640_0017927_1445_2077 204
224 3300046535 Ga0495586_0009056 Ga0495586_0009056_1607_2239 204
225 3300046535 Ga0495586_0032462 Ga0495586_0032462_532_1164 204
226 3300046536 Ga0495587_0006325 Ga0495587_0006325_3267_3899 204
227 3300046536 Ga0495587_0016108 Ga0495587_0016108_2981_3613 204
228 3300046543 Ga0495645_0000185 Ga0495645_0000185_3249_3881 204
229 3300046543 Ga0495645_0012507 Ga0495645_0012507_2069_2701 204
230 3300046543 Ga0495645_0035527 Ga0495645_0035527_2774_3406 204
231 3300046557 Ga0495622_0000115 Ga0495622_0000115_37547_38179 204
232 3300046557 Ga0495622_0125231 Ga0495622_0125231_309_941 204
233 3300046559 Ga0495667_0232867 Ga0495667_0232867_373_1005 204
234 3300046642 Ga0495634_0010866 Ga0495634_0010866_3043_3675 204
235 3300046642 Ga0495634_0013209 Ga0495634_0013209_1300_1932 204
236 3300046648 Ga0495611_0030765 Ga0495611_0030765_1606_2238 204
237 3300046660 Ga0495625_0139973 Ga0495625_0139973_167_799 204
238 3300046663 Ga0495635_0007446 Ga0495635_0007446_2657_3289 204
239 3300046663 Ga0495635_0009724 Ga0495635_0009724_3280_3912 204
240 3300046665 Ga0495661_0002143 Ga0495661_0002143_1541_2173 204
241 3300046665 Ga0495661_0011745 Ga0495661_0011745_3232_3864 204
242 3300046674 Ga0495588_0061778 Ga0495588_0061778_19_651 204
243 3300046674 Ga0495588_0077478 Ga0495588_0077478_30_662 204
244 3300046675 Ga0495657_0436849 Ga0495657_0436849_110_742 204
245 3300046678 Ga0495599_0006460 Ga0495599_0006460_1708_2340 204
246 3300046678 Ga0495599_0009180 Ga0495599_0009180_3704_4336 204
247 3300046678 Ga0495599_0010321 Ga0495599_0010321_4352_4984 204
248 3300046679 Ga0495623_0001156 Ga0495623_0001156_398_1030 204
249 3300046679 Ga0495623_0016674 Ga0495623_0016674_852_1484 204
250 3300046679 Ga0495623_0021498 Ga0495623_0021498_2225_2857 204
251 3300046680 Ga0495646_0003033 Ga0495646_0003033_9269_9901 204
252 3300046680 Ga0495646_0003614 Ga0495646_0003614_5738_6370 204
253 3300046680 Ga0495646_0012954 Ga0495646_0012954_1496_2128 204
254 3300046680 Ga0495646_0022234 Ga0495646_0022234_236_868 204
255 3300046684 Ga0495669_0047484 Ga0495669_0047484_573_1205 204
256 3300046684 Ga0495669_0275252 Ga0495669_0275252_35_667 204
257 3300046689 Ga0495613_0009998 Ga0495613_0009998_2668_3300 204
258 3300046689 Ga0495613_0026844 Ga0495613_0026844_3280_3912 204
259 3300046689 Ga0495613_0031318 Ga0495613_0031318_1823_2455 204
260 3300046690 Ga0495624_0006337 Ga0495624_0006337_3108_3740 204
261 3300046690 Ga0495624_0015397 Ga0495624_0015397_1253_1885 204
262 3300046690 Ga0495624_0055155 Ga0495624_0055155_167_799 204
263 3300046691 Ga0495670_0004048 Ga0495670_0004048_5129_5761 204
264 3300046692 Ga0495671_0065520 Ga0495671_0065520_275_907 204
265 3300046692 Ga0495671_0205134 Ga0495671_0205134_234_866 204
266 3300046794 Ga0495589_0001700 Ga0495589_0001700_574_1206 204
267 3300046794 Ga0495589_0004999 Ga0495589_0004999_3079_3711 204
268 3300046794 Ga0495589_0015709 Ga0495589_0015709_962_1594 204
269 3300046794 Ga0495589_0058608 Ga0495589_0058608_513_1145 204
270 3300046809 Ga0495600_0001350 Ga0495600_0001350_10347_10979 204
271 3300046809 Ga0495600_0114148 Ga0495600_0114148_91_723 204
272 3300046809 Ga0495600_0131611 Ga0495600_0131611_16_648 204
273 3300047315 Ga0495581_0001554 Ga0495581_0001554_375_1007 204
274 3300047315 Ga0495581_0018191 Ga0495581_0018191_3272_3904 204
275 3300047315 Ga0495581_0027121 Ga0495581_0027121_1741_2373 204
276 3300047317 Ga0495604_0000506 Ga0495604_0000506_16845_17477 204
277 3300047317 Ga0495604_0014415 Ga0495604_0014415_1300_1932 204
278 3300047317 Ga0495604_0033752 Ga0495604_0033752_3252_3884 204
279 3300047319 Ga0495674_0008135 Ga0495674_0008135_7175_7807 204
280 3300047319 Ga0495674_0015958 Ga0495674_0015958_3043_3675 204
281 3300047319 Ga0495674_0046809 Ga0495674_0046809_1541_2173 204
282 3300047319 Ga0495674_0183950 Ga0495674_0183950_235_867 204
283 3300047319 Ga0495674_0556404 Ga0495674_0556404_168_800 204
284 3300047320 Ga0495672_0066551 Ga0495672_0066551_890_1522 204
285 3300047320 Ga0495672_0258634 Ga0495672_0258634_46_678 204
286 3300047320 Ga0495672_0264085 Ga0495672_0264085_96_728 204
287 3300047321 Ga0495676_0007408 Ga0495676_0007408_4726_5358 204
288 3300047321 Ga0495676_0013610 Ga0495676_0013610_3170_3802 204
289 3300047321 Ga0495676_0019381 Ga0495676_0019381_336_968 204
290 3300047322 Ga0495680_0021803 Ga0495680_0021803_3252_3884 204
291 3300047322 Ga0495680_0057678 Ga0495680_0057678_1244_1876 204
292 3300047322 Ga0495680_0100401 Ga0495680_0100401_749_1381 204
293 3300047323 Ga0495683_0004809 Ga0495683_0004809_4431_5063 204
294 3300047323 Ga0495683_0059832 Ga0495683_0059832_888_1520 204
295 3300047444 Ga0495675_0006465 Ga0495675_0006465_2611_3243 204
296 3300047444 Ga0495675_0037617 Ga0495675_0037617_1784_2416 204
297 3300047444 Ga0495675_0137863 Ga0495675_0137863_112_744 204
298 3300047446 Ga0495679_001038 Ga0495679_001038_12319_12951 204
299 3300047446 Ga0495679_002598 Ga0495679_002598_5163_5795 204
300 3300047469 Ga0495673_0051169 Ga0495673_0051169_586_1218 204
301 3300047469 Ga0495673_0060636 Ga0495673_0060636_247_879 204
302 3300047470 Ga0495681_0039171 Ga0495681_0039171_312_944 204
303 3300047472 Ga0495686_0000012 Ga0495686_0000012_469410_470048 204
304 3300047472 Ga0495686_0106247 Ga0495686_0106247_108_740 204
305 3300047673 Ga0495593_0001773 Ga0495593_0001773_2711_3343 204
306 3300047673 Ga0495593_0005056 Ga0495593_0005056_2927_3559 204
307 3300047673 Ga0495593_0008877 Ga0495593_0008877_3280_3912 204
308 3300047673 Ga0495593_0024447 Ga0495593_0024447_1112_1744 204
309 3300048088 Ga0495602_0028287 Ga0495602_0028287_3043_3675 204
310 3300048088 Ga0495602_0032705 Ga0495602_0032705_3461_4093 204
311 3300048088 Ga0495602_0134727 Ga0495602_0134727_55_687 204
312 3300048089 Ga0495614_0004342 Ga0495614_0004342_3582_4214 204
313 3300048089 Ga0495614_0009233 Ga0495614_0009233_3437_4069 204
314 3300048089 Ga0495614_0011128 Ga0495614_0011128_3276_3908 204
315 3300048903 Ga0496100_0000137 Ga0496100_0000137_11875_12507 204
316 3300048903 Ga0496100_0171102 Ga0496100_0171102_50_682 204
317 3300048904 Ga0496101_0000044 Ga0496101_0000044_148748_149380 204
318 3300048904 Ga0496101_0288778 Ga0496101_0288778_291_923 204
319 3300048904 Ga0496101_0372907 Ga0496101_0372907_361_993 204
320 3300048905 Ga0496102_0000320 Ga0496102_0000320_45271_45885 204
321 3300048905 Ga0496102_0000379 Ga0496102_0000379_46443_47075 204
322 3300048905 Ga0496102_0010846 Ga0496102_0010846_7054_7686 204
323 3300048905 Ga0496102_0023246 Ga0496102_0023246_4247_4879 204
324 3300048906 Ga0496103_0000605 Ga0496103_0000605_15466_16080 204
325 3300048906 Ga0496103_0000724 Ga0496103_0000724_16161_16793 204
326 3300048906 Ga0496103_0004730 Ga0496103_0004730_4336_4968 204
327 3300048907 Ga0496104_0039574 Ga0496104_0039574_1062_1694 204
328 3300048907 Ga0496104_0152694 Ga0496104_0152694_1081_1713 204
329 3300048907 Ga0496104_0253207 Ga0496104_0253207_389_1021 204
330 3300048908 Ga0496105_0004554 Ga0496105_0004554_3021_3635 204
331 3300048908 Ga0496105_0026423 Ga0496105_0026423_2936_3568 204
332 3300048908 Ga0496105_0161742 Ga0496105_0161742_688_1320 204
333 3300048909 Ga0496106_0000003 Ga0496106_0000003_164700_165338 204
334 3300048909 Ga0496106_0054681 Ga0496106_0054681_697_1329 204
335 3300048909 Ga0496106_0567232 Ga0496106_0567232_144_776 204
336 3300048910 Ga0496107_0063657 Ga0496107_0063657_333_965 204
337 3300048910 Ga0496107_0118066 Ga0496107_0118066_891_1505 204
338 3300048910 Ga0496107_0519110 Ga0496107_0519110_69_701 204
339 3300048910 Ga0496107_0722698 Ga0496107_0722698_35_667 204
340 3300048912 Ga0496109_0059587 Ga0496109_0059587_2103_2717 204
341 3300048913 Ga0496110_0043902 Ga0496110_0043902_105_719 204
342 3300048913 Ga0496110_0364798 Ga0496110_0364798_321_953 204
343 3300048914 Ga0496111_0012034 Ga0496111_0012034_3782_4396 204
344 3300048916 Ga0496113_0055552 Ga0496113_0055552_2272_2904 204
345 3300048916 Ga0496113_0326456 Ga0496113_0326456_125_739 204
346 3300048917 Ga0496114_0002609 Ga0496114_0002609_8992_9624 204
347 3300048918 Ga0496115_0000061 Ga0496115_0000061_51699_52313 204
348 3300048918 Ga0496115_0044894 Ga0496115_0044894_2849_3481 204
349 3300048918 Ga0496115_0535313 Ga0496115_0535313_229_861 204
350 3300048919 Ga0496116_0003377 Ga0496116_0003377_3148_3762 204
351 3300048919 Ga0496116_0113009 Ga0496116_0113009_198_836 204
352 3300048920 Ga0496117_0000098 Ga0496117_0000098_183784_184416 204
353 3300048920 Ga0496117_0000281 Ga0496117_0000281_48910_49524 204
354 3300048920 Ga0496117_0004004 Ga0496117_0004004_7945_8577 204
355 3300048920 Ga0496117_0105324 Ga0496117_0105324_51_689 204
356 3300048920 Ga0496117_0259826 Ga0496117_0259826_53_691 204
357 3300048921 Ga0496118_0000167 Ga0496118_0000167_28121_28753 204
358 3300048921 Ga0496118_0000533 Ga0496118_0000533_50091_50723 204
359 3300048921 Ga0496118_0000555 Ga0496118_0000555_49065_49679 204
360 3300048921 Ga0496118_0010703 Ga0496118_0010703_1284_1952 204
361 3300048921 Ga0496118_0023634 Ga0496118_0023634_4126_4758 204
362 3300048921 Ga0496118_0219699 Ga0496118_0219699_77_715 204
363 3300048922 Ga0496119_0002464 Ga0496119_0002464_3361_3987 204
364 3300048922 Ga0496119_0005589 Ga0496119_0005589_126_740 204
365 3300048922 Ga0496119_0078200 Ga0496119_0078200_688_1320 204
366 3300048924 Ga0496121_0002679 Ga0496121_0002679_12074_12688 204
367 3300048924 Ga0496121_0006684 Ga0496121_0006684_3818_4456 204
368 3300048924 Ga0496121_0035624 Ga0496121_0035624_1464_2096 204
369 3300048924 Ga0496121_0057644 Ga0496121_0057644_16_648 204
370 3300048924 Ga0496121_0094481 Ga0496121_0094481_1032_1664 204
371 3300048924 Ga0496121_0101970 Ga0496121_0101970_302_949 204
372 3300048925 Ga0496122_0000749 Ga0496122_0000749_10925_11551 204
373 3300048925 Ga0496122_0067594 Ga0496122_0067594_1560_2174 204
374 3300048925 Ga0496122_0114325 Ga0496122_0114325_187_819 204
375 3300048926 Ga0496123_0000566 Ga0496123_0000566_51430_52056 204
376 3300048926 Ga0496123_0014068 Ga0496123_0014068_2884_3498 204
377 3300048927 Ga0496124_0000266 Ga0496124_0000266_51689_52303 204
378 3300048928 Ga0496125_0001502 Ga0496125_0001502_29660_30274 204
379 3300048929 Ga0496126_0000248 Ga0496126_0000248_108950_109618 204
380 3300048929 Ga0496126_0000819 Ga0496126_0000819_51699_52313 204
381 3300048929 Ga0496126_0160550 Ga0496126_0160550_917_1543 204
382 3300048929 Ga0496126_0246723 Ga0496126_0246723_340_972 204
383 3300049460 Ga0495682_0043804 Ga0495682_0043804_942_1574 204
384 3300049571 Ga0501034_0777534 Ga0501034_0777534_113_742 204
385 3300049572 Ga0501036_0635132 Ga0501036_0635132_208_837 204
386 3300049580 Ga0501046_0623029 Ga0501046_0623029_48_674 204
387 3300049581 Ga0501047_0043344 Ga0501047_0043344_202_831 204
388 3300049586 Ga0501070_0751196 Ga0501070_0751196_117_743 204
389 3300049823 Ga0501044_0072505 Ga0501044_0072505_1054_1680 204
390 3300050512 nmdc:mga0n895_867459_c1 nmdc:mga0n895_867459_c1_110_733 204
391 3300050513 nmdc:mga0rr50_134038_c1 nmdc:mga0rr50_134038_c1_516_1139 204
392 3300050515 nmdc:mga0a205_240275_c1 nmdc:mga0a205_240275_c1_330_953 204
393 3300053098 Ga0500650_0159422 Ga0500650_0159422_206_832 204
394 3300001915 JGI24741J21665_1000114 JGI24741J21665_100011410 206
395 3300001979 JGI24740J21852_10009799 JGI24740J21852_100097991 206
396 3300005327 Ga0070658_10000399 Ga0070658_1000039921 206
397 3300005327 Ga0070658_10302583 Ga0070658_103025832 206
398 3300005329 Ga0070683_100195955 Ga0070683_1001959552 206
399 3300005336 Ga0070680_100030363 Ga0070680_1000303631 206
400 3300005344 Ga0070661_100098986 Ga0070661_1000989863 206
401 3300005455 Ga0070663_100241328 Ga0070663_1002413281 206
402 3300005458 Ga0070681_10115466 Ga0070681_101154664 206
403 3300005530 Ga0070679_100115505 Ga0070679_1001155053 206
404 3300005535 Ga0070684_100096390 Ga0070684_1000963903 206
405 3300005539 Ga0068853_100034167 Ga0068853_1000341673 206
406 3300005563 Ga0068855_100158385 Ga0068855_1001583853 206
407 3300005577 Ga0068857_100141472 Ga0068857_1001414722 206
408 3300005614 Ga0068856_100087296 Ga0068856_1000872963 206
409 3300006175 Ga0070712_100011357 Ga0070712_1000113574 206
410 3300009093 Ga0105240_10181352 Ga0105240_101813523 206
411 3300009174 Ga0105241_10006522 Ga0105241_100065221 206
412 3300009545 Ga0105237_10850821 Ga0105237_108508211 206
413 3300009551 Ga0105238_10025570 Ga0105238_100255705 206
414 3300010375 Ga0105239_11667682 Ga0105239_116676821 206
415 3300013102 Ga0157371_10000043 Ga0157371_1000004380 206
416 3300013104 Ga0157370_10088530 Ga0157370_100885303 206
417 3300025261 Ga0209233_1018605 Ga0209233_10186052 206
418 3300025904 Ga0207647_10046310 Ga0207647_100463102 206
419 3300025906 Ga0207699_10361611 Ga0207699_103616111 206
420 3300025909 Ga0207705_10000308 Ga0207705_1000030821 206
421 3300025911 Ga0207654_10001108 Ga0207654_100011082 206
422 3300025912 Ga0207707_10195960 Ga0207707_101959603 206
423 3300025913 Ga0207695_10003440 Ga0207695_1000344012 206
424 3300025914 Ga0207671_10098055 Ga0207671_100980552 206
425 3300025915 Ga0207693_10028279 Ga0207693_100282794 206
426 3300025916 Ga0207663_10428404 Ga0207663_104284041 206
427 3300025919 Ga0207657_10003038 Ga0207657_100030382 206
428 3300025920 Ga0207649_10000572 Ga0207649_100005728 206
429 3300025924 Ga0207694_10046599 Ga0207694_100465994 206
430 3300025924 Ga0207694_10466632 Ga0207694_104666322 206
431 3300025932 Ga0207690_10000827 Ga0207690_100008279 206
432 3300025939 Ga0207665_10296693 Ga0207665_102966932 206
433 3300025949 Ga0207667_10000069 Ga0207667_1000006986 206
434 3300025949 Ga0207667_10082047 Ga0207667_100820473 206
435 3300025981 Ga0207640_10000465 Ga0207640_1000046512 206
436 3300026041 Ga0207639_10000527 Ga0207639_1000052710 206
437 3300026041 Ga0207639_10022669 Ga0207639_100226693 206
438 3300026041 Ga0207639_10117751 Ga0207639_101177512 206
439 3300026067 Ga0207678_10002800 Ga0207678_100028008 206
440 3300026078 Ga0207702_10027677 Ga0207702_100276772 206
441 3300026088 Ga0207641_10161483 Ga0207641_101614831 206
442 3300026116 Ga0207674_10002536 Ga0207674_1000253620 206
443 3300026142 Ga0207698_10017707 Ga0207698_100177073 206
444 3300031456 Ga0307513_10021646 Ga0307513_100216462 206
445 3300035170 Ga0373943_0387138 Ga0373943_0387138_52_714 206
446 3300046471 Ga0495650_0001898 Ga0495650_0001898_9933_10700 206
447 3300046472 Ga0495580_0028017 Ga0495580_0028017_1875_2528 206
448 3300046477 Ga0495664_0450480 Ga0495664_0450480_56_709 206
449 3300046506 Ga0495583_0017922 Ga0495583_0017922_2860_3513 206
450 3300046507 Ga0495606_0095892 Ga0495606_0095892_890_1543 206
451 3300046515 Ga0495620_0023213 Ga0495620_0023213_267_1034 206
452 3300046516 Ga0495628_0340849 Ga0495628_0340849_391_1044 206
453 3300046517 Ga0495630_0016134 Ga0495630_0016134_92_745 206
454 3300046524 Ga0495648_0068239 Ga0495648_0068239_1178_1831 206
455 3300046531 Ga0495665_0365039 Ga0495665_0365039_50_703 206
456 3300046665 Ga0495661_0123035 Ga0495661_0123035_388_1155 206
457 3300046684 Ga0495669_0242164 Ga0495669_0242164_42_695 206
458 3300046690 Ga0495624_0059734 Ga0495624_0059734_198_851 206
459 3300046692 Ga0495671_0009124 Ga0495671_0009124_84_737 206
460 3300046794 Ga0495589_0043676 Ga0495589_0043676_701_1354 206
461 3300047319 Ga0495674_0106682 Ga0495674_0106682_1559_2212 206
462 3300047320 Ga0495672_0067462 Ga0495672_0067462_1112_1765 206
463 3300047443 Ga0495687_050531 Ga0495687_050531_42_695 206
464 3300047446 Ga0495679_000012 Ga0495679_000012_308213_308980 206
465 3300047673 Ga0495593_0195673 Ga0495593_0195673_221_874 206
466 3300048905 Ga0496102_0415393 Ga0496102_0415393_444_1211 206
467 3300048920 Ga0496117_0237668 Ga0496117_0237668_104_757 206
468 3300048924 Ga0496121_0019834 Ga0496121_0019834_4560_5213 206
469 3300049459 Ga0495678_036250 Ga0495678_036250_795_1562 206
470 3300049460 Ga0495682_0006694 Ga0495682_0006694_359_1012 206
471 iso_pu_bacteria 2900634093 2900638962 206
472 iso_pu_bacteria 2935777560 2935778220 206
473 iso_pu_bacteria 8016603502 8016606234 206
474 iso_pu_bacteria 8016613128 8016618143 206
475 iso_pu_bacteria 8016622563 8016623466 206
476 iso_pu_bacteria 8019538911 8019540206 206
477 iso_pu_bacteria 8019547302 8019550482 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

154

197

0.98

PF07336

ABATE

Putative stress-induced transcription regulator

9

150

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.6563 14 201
3vwo-assembly1.cif.gz_A crystal structure of peptidoglycan hydrolase mutant from sphingomonas sp. a1 0.6337 111 147
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.6156 14 201
7qfu-assembly1.cif.gz_A crystal structure of atla catalytic domain from enterococcus feacalis 0.6068 111 148
2kvt-assembly1.cif.gz_A solution nmr structure of yaia from escherichia eoli. northeast structural genomics target er244 0.474 111 139
ID Description Score Start End Superfamily
2pw9C01 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 6 0.6942 111 134 4.10.80.30
2pw9C01 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 6 0.6749 111 134 4.10.80.30
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.6379 14 201 1.10.3300.10
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.6016 14 201 1.10.3300.10
af_A0A1D6PQ48_2_224_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5977 100 133 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A1E4PPL7-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9539 5 195
AF-A0A2N7SMW1-F1-model_v4 deleted 0.9522 7 157
AF-A0A6P2DWS1-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9475 2 205
AF-A0A560LKK3-F1-model_v4 Putative RNA-binding Zn ribbon-like protein 0.9409 1 205
AF-A0A6P2E6B6-F1-model_v4 Zinc finger CGNR domain-containing protein 0.9404 7 202

Feature Viewer

pLDDT pTM Quality
90.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map