F451768

General Info

Members Datasets Scaffolds Average Seq Length
477 203 954 109

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0341571|Ga0495674_0341571_15_392
Length 125
Sequence MAGRRLGEGQNPSQEMTDKIVVFSTCNSAAQAERIAHALVEQRLAACVSIVPGIRSIYHWKEQIEDAVEWLLVIKSRRDLMDELRAAIGKIHSFEVPELLALPVVDGSESYIAWLDRELRPIKDI

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
132 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.68
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 31.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0341571 3300047319 Bacteria 1217
2 Ga0070683_100006256 3300005329 Bacteria 9987
3 Ga0070683_100020176 3300005329 Bacteria 5929
4 Ga0070683_100020695 3300005329 Bacteria 5858
5 Ga0070683_100099607 3300005329 Bacteria 2735
6 Ga0070683_100103289 3300005329 Bacteria 2685
7 Ga0070683_100270375 3300005329 Bacteria 1617
8 Ga0070683_101515308 3300005329 Bacteria 645
9 Ga0070690_100048904 3300005330 Bacteria 2695
10 Ga0068869_100080435 3300005334 Unclassified 2431
11 Ga0068869_100176689 3300005334 Bacteria 1672
12 Ga0068869_100391093 3300005334 Unclassified 1142
13 Ga0070680_100002840 3300005336 Bacteria 12873
14 Ga0070682_100393180 3300005337 Bacteria 1046
15 Ga0068868_100262718 3300005338 Bacteria 1456
16 Ga0068868_100355942 3300005338 Bacteria 1255
17 Ga0070660_100327137 3300005339 Bacteria 1260
18 Ga0070689_100428584 3300005340 Unclassified 1122
19 Ga0070689_101755959 3300005340 Unclassified 565
20 Ga0070691_10002140 3300005341 Bacteria 8737
21 Ga0070661_100411250 3300005344 Bacteria 1071
22 Ga0070675_100577569 3300005354 Bacteria 1018
23 Ga0070659_100075775 3300005366 Unclassified 2682
24 Ga0070659_100213144 3300005366 Bacteria 1592
25 Ga0070667_100688227 3300005367 Unclassified 946
26 Ga0070709_10007983 3300005434 Bacteria 5815
27 Ga0070709_10313308 3300005434 Bacteria 1149
28 Ga0070714_100050986 3300005435 Bacteria 3528
29 Ga0070713_100060045 3300005436 Bacteria 3178
30 Ga0070713_100220993 3300005436 Unclassified 1718
31 Ga0070713_100310110 3300005436 Bacteria 1455
32 Ga0070713_102161122 3300005436 Unclassified 539
33 Ga0070710_10754402 3300005437 Bacteria 691
34 Ga0070711_100233928 3300005439 Bacteria 1434
35 Ga0070711_100846645 3300005439 Unclassified 778
36 Ga0070705_100187671 3300005440 Bacteria 1406
37 Ga0070700_101724416 3300005441 Bacteria 538
38 Ga0070694_101271025 3300005444 Unclassified 618
39 Ga0070694_101535458 3300005444 Unclassified 564
40 Ga0070662_100314387 3300005457 Bacteria 1276
41 Ga0070681_10000363 3300005458 Bacteria 36626
42 Ga0070681_10081604 3300005458 Bacteria 3190
43 Ga0070681_10658787 3300005458 Unclassified 962
44 Ga0068867_100793770 3300005459 Unclassified 844
45 Ga0068867_101732561 3300005459 Unclassified 586
46 Ga0070706_100307351 3300005467 Bacteria 1479
47 Ga0070699_101496233 3300005518 Unclassified 619
48 Ga0070679_100001244 3300005530 Bacteria 22437
49 Ga0070679_100433202 3300005530 Bacteria 1260
50 Ga0070684_100001498 3300005535 Bacteria 16852
51 Ga0070684_100050878 3300005535 Bacteria 3599
52 Ga0070684_100151412 3300005535 Unclassified 2101
53 Ga0070684_100256230 3300005535 Bacteria 1600
54 Ga0070684_100695281 3300005535 Unclassified 948
55 Ga0070684_100764775 3300005535 Bacteria 902
56 Ga0070684_100992503 3300005535 Unclassified 788
57 Ga0070697_100139479 3300005536 Bacteria 2038
58 Ga0068853_100006019 3300005539 Bacteria 9595
59 Ga0068853_100160778 3300005539 Bacteria 2027
60 Ga0070686_100297823 3300005544 Bacteria 1195
61 Ga0070695_100010382 3300005545 Bacteria 5561
62 Ga0070695_100140777 3300005545 Bacteria 1673
63 Ga0070695_101827020 3300005545 Unclassified 510
64 Ga0070693_100036227 3300005547 Bacteria 2741
65 Ga0070693_100095818 3300005547 Bacteria 1798
66 Ga0068855_100034816 3300005563 Bacteria 6002
67 Ga0068855_100130968 3300005563 Bacteria 2864
68 Ga0068855_100666703 3300005563 Bacteria 1116
69 Ga0068855_100809741 3300005563 Bacteria 995
70 Ga0070664_100719388 3300005564 Bacteria 931
71 Ga0068857_100007306 3300005577 Bacteria 9516
72 Ga0068857_100345331 3300005577 Bacteria 1377
73 Ga0068857_100528923 3300005577 Unclassified 1109
74 Ga0068854_100423836 3300005578 Unclassified 1106
75 Ga0068856_100004081 3300005614 Bacteria 14601
76 Ga0068856_100078290 3300005614 Bacteria 3278
77 Ga0068856_100413143 3300005614 Bacteria 1369
78 Ga0068856_100445838 3300005614 Unclassified 1315
79 Ga0068856_101234218 3300005614 Unclassified 764
80 Ga0068856_101752520 3300005614 Unclassified 633
81 Ga0068852_100014805 3300005616 Bacteria 6024
82 Ga0068852_101075027 3300005616 Unclassified 824
83 Ga0068852_101210314 3300005616 Unclassified 776
84 Ga0068852_101558926 3300005616 Unclassified 683
85 Ga0068852_101744738 3300005616 Unclassified 645
86 Ga0068859_100455058 3300005617 Bacteria 1376
87 Ga0068859_102476809 3300005617 Unclassified 571
88 Ga0068864_100153363 3300005618 Bacteria 2089
89 Ga0068864_100194356 3300005618 Bacteria 1861
90 Ga0068864_100314494 3300005618 Unclassified 1469
91 Ga0068864_101782164 3300005618 Unclassified 621
92 Ga0068866_10349514 3300005718 Bacteria 939
93 Ga0068866_10625437 3300005718 Unclassified 730
94 Ga0068861_101721792 3300005719 Unclassified 620
95 Ga0068863_100493075 3300005841 Unclassified 1206
96 Ga0068863_101499728 3300005841 Unclassified 683
97 Ga0068858_100047316 3300005842 Bacteria 3988
98 Ga0068858_100061995 3300005842 Bacteria 3457
99 Ga0068858_100410329 3300005842 Unclassified 1302
100 Ga0068858_100482303 3300005842 Unclassified 1197
101 Ga0068860_100384695 3300005843 Unclassified 1385
102 Ga0097621_100005031 3300006237 Bacteria 9279
103 Ga0097621_100011394 3300006237 Bacteria 6546
104 Ga0097621_100075642 3300006237 Bacteria 2792
105 Ga0097621_100420901 3300006237 Bacteria 1199
106 Ga0097621_101928939 3300006237 Bacteria 564
107 Ga0068871_100009366 3300006358 Bacteria 7092
108 Ga0068871_100067428 3300006358 Bacteria 2935
109 Ga0068871_100139249 3300006358 Unclassified 2062
110 Ga0068871_100423806 3300006358 Unclassified 1189
111 Ga0068871_100468932 3300006358 Unclassified 1131
112 Ga0068871_101441544 3300006358 Unclassified 650
113 Ga0075433_10750899 3300006852 Bacteria 853
114 Ga0068865_100003469 3300006881 Bacteria 9447
115 Ga0068865_100139140 3300006881 Bacteria 1828
116 Ga0097620_100455051 3300006931 Bacteria 1376
117 Ga0097620_101424823 3300006931 Bacteria 764
118 Ga0097620_102478734 3300006931 Unclassified 571
119 Ga0075435_101126066 3300007076 Bacteria 686
120 Ga0075435_101442127 3300007076 Unclassified 603
121 Ga0099794_10743495 3300007265 Bacteria 523
122 Ga0105240_10001515 3300009093 Bacteria 39538
123 Ga0105240_10014962 3300009093 Bacteria 10571
124 Ga0105240_10105606 3300009093 Bacteria 3419
125 Ga0105240_10152991 3300009093 Bacteria 2746
126 Ga0105240_10187706 3300009093 Unclassified 2433
127 Ga0105240_10198810 3300009093 Bacteria 2351
128 Ga0105240_10461790 3300009093 Bacteria 1419
129 Ga0105240_10708073 3300009093 Unclassified 1098
130 Ga0105245_10000833 3300009098 Bacteria 28081
131 Ga0105245_10034587 3300009098 Bacteria 4482
132 Ga0105245_10037568 3300009098 Bacteria 4306
133 Ga0105245_10067705 3300009098 Bacteria 3234
134 Ga0105245_10195702 3300009098 Bacteria 1939
135 Ga0105245_10370514 3300009098 Bacteria 1424
136 Ga0105245_10811376 3300009098 Bacteria 974
137 Ga0105247_10335776 3300009101 Bacteria 1059
138 Ga0105243_10039892 3300009148 Bacteria 3664
139 Ga0105243_10058180 3300009148 Bacteria 3080
140 Ga0105243_10059866 3300009148 Bacteria 3041
141 Ga0105243_10631775 3300009148 Bacteria 1035
142 Ga0105241_10010541 3300009174 Bacteria 6782
143 Ga0105241_10014086 3300009174 Bacteria 5860
144 Ga0105241_10048221 3300009174 Bacteria 3241
145 Ga0105241_10093551 3300009174 Bacteria 2375
146 Ga0105241_10110184 3300009174 Bacteria 2202
147 Ga0105241_10179799 3300009174 Bacteria 1754
148 Ga0105241_10540758 3300009174 Unclassified 1044
149 Ga0105241_11475874 3300009174 Unclassified 654
150 Ga0105241_11573127 3300009174 Unclassified 635
151 Ga0105242_10092971 3300009176 Bacteria 2542
152 Ga0105242_10309034 3300009176 Bacteria 1446
153 Ga0105242_10659547 3300009176 Bacteria 1019
154 Ga0105242_10772853 3300009176 Unclassified 948
155 Ga0105248_10006908 3300009177 Bacteria 12440
156 Ga0105248_10062612 3300009177 Bacteria 4177
157 Ga0105248_10155992 3300009177 Bacteria 2576
158 Ga0105248_10195679 3300009177 Bacteria 2278
159 Ga0105248_10229676 3300009177 Bacteria 2089
160 Ga0105248_11724640 3300009177 Unclassified 710
161 Ga0105237_10011000 3300009545 Bacteria 9604
162 Ga0105237_10024193 3300009545 Bacteria 6214
163 Ga0105237_10425742 3300009545 Bacteria 1333
164 Ga0105237_10442455 3300009545 Bacteria 1305
165 Ga0105237_10585922 3300009545 Bacteria 1122
166 Ga0105237_10705895 3300009545 Unclassified 1015
167 Ga0105238_10002354 3300009551 Bacteria 19010
168 Ga0105238_10007051 3300009551 Bacteria 11238
169 Ga0105238_10009359 3300009551 Bacteria 9812
170 Ga0105238_10012184 3300009551 Bacteria 8668
171 Ga0105238_10063839 3300009551 Bacteria 3683
172 Ga0105238_10176072 3300009551 Bacteria 2116
173 Ga0105249_10024725 3300009553 Bacteria 5399
174 Ga0105249_10980908 3300009553 Bacteria 913
175 Ga0105239_10006275 3300010375 Bacteria 13832
176 Ga0105239_10011963 3300010375 Bacteria 9675
177 Ga0105239_10021173 3300010375 Bacteria 7171
178 Ga0105239_10100044 3300010375 Bacteria 3206
179 Ga0105239_10388702 3300010375 Unclassified 1578
180 Ga0105239_10442843 3300010375 Bacteria 1473
181 Ga0105246_10006392 3300011119 Bacteria 7196
182 Ga0105246_10025681 3300011119 Bacteria 3841
183 Ga0105246_10159608 3300011119 Bacteria 1716
184 Ga0105246_10450031 3300011119 Bacteria 1082
185 Ga0105246_10664480 3300011119 Unclassified 909
186 Ga0157373_10225033 3300013100 Bacteria 1324
187 Ga0157371_10024195 3300013102 Bacteria 4436
188 Ga0157370_10004024 3300013104 Bacteria 17079
189 Ga0157370_10048072 3300013104 Bacteria 4088
190 Ga0157370_10507936 3300013104 Unclassified 1107
191 Ga0157369_10008896 3300013105 Bacteria 11505
192 Ga0157369_10013405 3300013105 Bacteria 9270
193 Ga0157369_10135457 3300013105 Bacteria 2608
194 Ga0157369_10857031 3300013105 Unclassified 932
195 Ga0157374_10013544 3300013296 Bacteria 7120
196 Ga0157374_10353782 3300013296 Bacteria 1460
197 Ga0157378_10006968 3300013297 Bacteria 9859
198 Ga0157378_10015425 3300013297 Bacteria 6692
199 Ga0157378_10815280 3300013297 Bacteria 960
200 Ga0163162_10356227 3300013306 Bacteria 1596
201 Ga0163162_10717164 3300013306 Unclassified 1121
202 Ga0163162_10730711 3300013306 Bacteria 1110
203 Ga0163162_11985954 3300013306 Unclassified 666
204 Ga0157372_10002440 3300013307 Bacteria 20141
205 Ga0157372_10031962 3300013307 Bacteria 5767
206 Ga0157372_10121880 3300013307 Bacteria 2996
207 Ga0157372_10198780 3300013307 Unclassified 2322
208 Ga0157372_10446319 3300013307 Bacteria 1508
209 Ga0157372_10447464 3300013307 Bacteria 1505
210 Ga0157375_10001998 3300013308 Bacteria 17597
211 Ga0157375_10459700 3300013308 Bacteria 1438
212 Ga0157375_10941572 3300013308 Unclassified 1006
213 Ga0163163_10017997 3300014325 Bacteria 6601
214 Ga0163163_10437056 3300014325 Bacteria 1368
215 Ga0163163_10871080 3300014325 Unclassified 964
216 Ga0163163_10911903 3300014325 Bacteria 942
217 Ga0182008_10050296 3300014497 Bacteria 2068
218 Ga0157377_10401620 3300014745 Unclassified 933
219 Ga0157379_10051790 3300014968 Bacteria 3666
220 Ga0157376_10070897 3300014969 Bacteria 2960
221 Ga0157376_10705552 3300014969 Unclassified 1014
222 Ga0157376_10989165 3300014969 Bacteria 863
223 Ga0182007_10010123 3300015262 Bacteria 3745
224 Ga0182005_1052294 3300015265 Bacteria 1112
225 Ga0213873_10104665 3300021358 Unclassified 817
226 Ga0207692_11065798 3300025898 Unclassified 535
227 Ga0207699_10024984 3300025906 Unclassified 3275
228 Ga0207699_10697480 3300025906 Bacteria 743
229 Ga0207684_10256180 3300025910 Bacteria 1510
230 Ga0207654_10023673 3300025911 Bacteria 3293
231 Ga0207654_10118905 3300025911 Bacteria 1656
232 Ga0207654_10331226 3300025911 Unclassified 1043
233 Ga0207654_10436069 3300025911 Unclassified 916
234 Ga0207654_10516335 3300025911 Unclassified 845
235 Ga0207654_10552695 3300025911 Bacteria 818
236 Ga0207707_10001288 3300025912 Bacteria 23359
237 Ga0207707_10063512 3300025912 Bacteria 3214
238 Ga0207707_10162669 3300025912 Bacteria 1951
239 Ga0207695_10005184 3300025913 Bacteria 17448
240 Ga0207695_10108501 3300025913 Bacteria 2760
241 Ga0207695_10121997 3300025913 Bacteria 2573
242 Ga0207671_10018157 3300025914 Bacteria 5404
243 Ga0207671_10208337 3300025914 Bacteria 1529
244 Ga0207671_10709238 3300025914 Unclassified 800
245 Ga0207671_11184323 3300025914 Unclassified 598
246 Ga0207671_11195075 3300025914 Unclassified 595
247 Ga0207663_10075743 3300025916 Bacteria 2184
248 Ga0207663_11036753 3300025916 Bacteria 658
249 Ga0207663_11142005 3300025916 Unclassified 627
250 Ga0207660_10007708 3300025917 Bacteria 6969
251 Ga0207657_10258466 3300025919 Bacteria 1386
252 Ga0207649_10750220 3300025920 Bacteria 759
253 Ga0207649_11093087 3300025920 Bacteria 629
254 Ga0207652_10025575 3300025921 Bacteria 4909
255 Ga0207652_10388083 3300025921 Bacteria 1260
256 Ga0207652_10658789 3300025921 Unclassified 936
257 Ga0207694_10002227 3300025924 Bacteria 15911
258 Ga0207694_10018693 3300025924 Bacteria 5238
259 Ga0207694_10114766 3300025924 Bacteria 2145
260 Ga0207694_10158793 3300025924 Bacteria 1825
261 Ga0207694_10651183 3300025924 Bacteria 887
262 Ga0207687_10000181 3300025927 Bacteria 41696
263 Ga0207687_10011665 3300025927 Bacteria 5746
264 Ga0207687_10056513 3300025927 Bacteria 2753
265 Ga0207687_10489995 3300025927 Unclassified 1025
266 Ga0207687_10536266 3300025927 Unclassified 980
267 Ga0207687_11368086 3300025927 Unclassified 608
268 Ga0207700_10086697 3300025928 Bacteria 2460
269 Ga0207700_10093593 3300025928 Bacteria 2378
270 Ga0207664_10159818 3300025929 Bacteria 1921
271 Ga0207690_10442443 3300025932 Unclassified 1043
272 Ga0207706_10232745 3300025933 Bacteria 1612
273 Ga0207686_10037661 3300025934 Bacteria 2920
274 Ga0207686_10693122 3300025934 Unclassified 809
275 Ga0207686_10753510 3300025934 Unclassified 777
276 Ga0207686_11199449 3300025934 Unclassified 621
277 Ga0207709_10096248 3300025935 Bacteria 1947
278 Ga0207709_10670377 3300025935 Bacteria 827
279 Ga0207670_10115761 3300025936 Bacteria 1940
280 Ga0207670_10562943 3300025936 Unclassified 932
281 Ga0207704_10142923 3300025938 Bacteria 1677
282 Ga0207711_10001785 3300025941 Bacteria 19692
283 Ga0207711_10715395 3300025941 Unclassified 934
284 Ga0207711_11299699 3300025941 Unclassified 669
285 Ga0207711_11472525 3300025941 Unclassified 624
286 Ga0207689_10024605 3300025942 Bacteria 5050
287 Ga0207689_10281520 3300025942 Bacteria 1377
288 Ga0207689_10586658 3300025942 Unclassified 937
289 Ga0207661_10008868 3300025944 Bacteria 7198
290 Ga0207661_10009599 3300025944 Bacteria 6949
291 Ga0207661_10019198 3300025944 Bacteria 5092
292 Ga0207661_10054934 3300025944 Bacteria 3192
293 Ga0207661_10500514 3300025944 Unclassified 1110
294 Ga0207661_11042305 3300025944 Bacteria 753
295 Ga0207679_10611751 3300025945 Bacteria 983
296 Ga0207679_10933607 3300025945 Bacteria 794
297 Ga0207679_11233677 3300025945 Bacteria 686
298 Ga0207667_10002297 3300025949 Bacteria 24016
299 Ga0207667_10005315 3300025949 Bacteria 15692
300 Ga0207667_10285291 3300025949 Bacteria 1687
301 Ga0207667_10547603 3300025949 Bacteria 1170
302 Ga0207667_10683586 3300025949 Bacteria 1030
303 Ga0207667_10996111 3300025949 Bacteria 826
304 Ga0207712_10148392 3300025961 Bacteria 1808
305 Ga0207640_10406961 3300025981 Unclassified 1109
306 Ga0207658_10362536 3300025986 Bacteria 1265
307 Ga0207677_10608029 3300026023 Bacteria 960
308 Ga0207703_10025662 3300026035 Bacteria 4636
309 Ga0207703_10272672 3300026035 Bacteria 1533
310 Ga0207703_10291447 3300026035 Bacteria 1485
311 Ga0207703_10292061 3300026035 Bacteria 1484
312 Ga0207703_10494126 3300026035 Unclassified 1148
313 Ga0207703_10746678 3300026035 Bacteria 932
314 Ga0207639_10142561 3300026041 Bacteria 1998
315 Ga0207639_10165210 3300026041 Bacteria 1869
316 Ga0207639_10612899 3300026041 Bacteria 1004
317 Ga0207639_10726830 3300026041 Bacteria 922
318 Ga0207702_10024999 3300026078 Bacteria 4954
319 Ga0207702_10395880 3300026078 Bacteria 1331
320 Ga0207702_10547784 3300026078 Unclassified 1131
321 Ga0207702_10611964 3300026078 Unclassified 1069
322 Ga0207702_10955284 3300026078 Unclassified 850
323 Ga0207641_10653773 3300026088 Unclassified 1033
324 Ga0207641_11105313 3300026088 Unclassified 791
325 Ga0207648_10045230 3300026089 Bacteria 3862
326 Ga0207648_10254893 3300026089 Bacteria 1565
327 Ga0207648_11429878 3300026089 Unclassified 650
328 Ga0207648_11553080 3300026089 Unclassified 622
329 Ga0207676_10232130 3300026095 Unclassified 1650
330 Ga0207676_10292992 3300026095 Unclassified 1483
331 Ga0207676_10338472 3300026095 Unclassified 1387
332 Ga0207674_10000419 3300026116 Bacteria 55323
333 Ga0207674_10004178 3300026116 Bacteria 17448
334 Ga0207674_10274524 3300026116 Unclassified 1633
335 Ga0207674_10457901 3300026116 Bacteria 1233
336 Ga0207674_10975073 3300026116 Bacteria 817
337 Ga0207683_11799735 3300026121 Bacteria 562
338 Ga0207698_10007081 3300026142 Bacteria 7024
339 Ga0207698_10145324 3300026142 Unclassified 2050
340 Ga0207698_11193561 3300026142 Unclassified 775
341 Ga0268264_10259138 3300028381 Bacteria 1619
342 Ga0265340_10099814 3300031247 Bacteria 1350
343 Ga0265331_10490327 3300031250 Unclassified 553
344 Ga0265316_10772479 3300031344 Bacteria 675
345 Ga0265313_10003744 3300031595 Bacteria 12096
346 Ga0316579_10150315 3300031691 Bacteria 1123
347 Ga0316579_10182920 3300031691 Bacteria 1013
348 Ga0316579_10223832 3300031691 Bacteria 910
349 Ga0265314_10000880 3300031711 Bacteria 35806
350 Ga0316577_10020290 3300031733 Bacteria 3684
351 Ga0316577_10085817 3300031733 Bacteria 1762
352 Ga0316577_10105712 3300031733 Bacteria 1579
353 Ga0316577_10379028 3300031733 Bacteria 803
354 Ga0316577_10759943 3300031733 Unclassified 550
355 Ga0316593_10068212 3300032168 Bacteria 1227
356 Ga0316593_10072405 3300032168 Bacteria 1193
357 Ga0316596_1224119 3300033541 Bacteria 526
358 Ga0373934_0002904 3300035086 Bacteria 6271
359 Ga0373934_0210616 3300035086 Unclassified 801
360 Ga0373923_0052794 3300035111 Bacteria 1708
361 Ga0373923_0523699 3300035111 Unclassified 579
362 Ga0373936_0081705 3300035113 Unclassified 1346
363 Ga0373936_0171660 3300035113 Unclassified 948
364 Ga0373936_0255116 3300035113 Unclassified 784
365 Ga0373941_0489004 3300035115 Unclassified 522
366 Ga0373953_0009232 3300035117 Unclassified 3384
367 Ga0373954_0003508 3300035118 Bacteria 6663
368 Ga0373954_0003988 3300035118 Bacteria 6309
369 Ga0373957_0018024 3300035120 Bacteria 2468
370 Ga0373943_0023578 3300035170 Bacteria 2863
371 Ga0373955_0018841 3300035172 Unclassified 3441
372 Ga0373955_0021160 3300035172 Bacteria 3279
373 Ga0373924_0045567 3300035410 Bacteria 1804
374 Ga0373924_0450335 3300035410 Unclassified 577
375 Ga0373935_0058380 3300035692 Bacteria 2465
376 Ga0373935_0316255 3300035692 Unclassified 1107
377 Ga0373935_0396332 3300035692 Bacteria 991
378 Ga0373935_1093942 3300035692 Unclassified 593
379 Ga0373927_0247189 3300035695 Bacteria 1172
380 Ga0373927_0344735 3300035695 Bacteria 982
381 Ga0373933_0005976 3300035724 Bacteria 6623
382 Ga0373933_0075437 3300035724 Bacteria 2059
383 Ga0373933_0163831 3300035724 Bacteria 1413
384 Ga0373933_0426617 3300035724 Unclassified 866
385 Ga0373947_0009201 3300035725 Bacteria 5676
386 Ga0373947_0288717 3300035725 Bacteria 1092
387 Ga0373947_1182428 3300035725 Unclassified 521
388 Ga0373937_0020077 3300036401 Bacteria 5986
389 Ga0373937_0224462 3300036401 Bacteria 1768
390 Ga0373937_0399912 3300036401 Bacteria 1303
391 Ga0373937_1480768 3300036401 Bacteria 626
392 Ga0373937_1925554 3300036401 Bacteria 537
393 Ga0316582_0022937 3300036647 Bacteria 3714
394 Ga0316584_0000412 3300036712 Bacteria 22363
395 Ga0316584_0113118 3300036712 Bacteria 2031
396 Ga0316584_0117006 3300036712 Bacteria 1993
397 Ga0316584_1044885 3300036712 Bacteria 544
398 Ga0373925_0012823 3300037068 Bacteria 6073
399 Ga0373925_0014740 3300037068 Bacteria 5648
400 Ga0373925_0473424 3300037068 Unclassified 1027
401 Ga0316581_0020926 3300037588 Bacteria 1919
402 Ga0436360_1305878 3300039438 Unclassified 660
403 Ga0436361_0334215 3300039447 Unclassified 948
404 Ga0436362_0573525 3300039453 Bacteria 2846
405 Ga0436362_0675865 3300039453 Unclassified 554
406 Ga0451800_0556462 3300041459 Unclassified 619
407 Ga0451802_1392088 3300041460 Unclassified 1188
408 Ga0451853_0368846 3300041512 Unclassified 993
409 Ga0439448_0160569 3300042005 Bacteria 782
410 Ga0495592_0054476 3300046454 Bacteria 2963
411 Ga0495651_0224971 3300046462 Bacteria 1296
412 Ga0495580_0047291 3300046472 Bacteria 3050
413 Ga0495580_0091338 3300046472 Bacteria 2119
414 Ga0495582_0120784 3300046473 Unclassified 1476
415 Ga0495639_0005847 3300046475 Bacteria 5289
416 Ga0495639_0018717 3300046475 Bacteria 3017
417 Ga0495594_0155580 3300046499 Unclassified 1298
418 Ga0495594_0440189 3300046499 Bacteria 741
419 Ga0495594_0490194 3300046499 Unclassified 698
420 Ga0495628_0385131 3300046516 Bacteria 1026
421 Ga0495628_1204390 3300046516 Bacteria 514
422 Ga0495630_0371574 3300046517 Bacteria 1095
423 Ga0495630_1345680 3300046517 Bacteria 538
424 Ga0495652_0028538 3300046529 Bacteria 4909
425 Ga0495652_0239579 3300046529 Bacteria 1351
426 Ga0495665_0336239 3300046531 Unclassified 770
427 Ga0495640_0577853 3300046533 Unclassified 680
428 Ga0495586_0628166 3300046535 Unclassified 621
429 Ga0495586_0890279 3300046535 Unclassified 513
430 Ga0495587_0000791 3300046536 Bacteria 21120
431 Ga0495587_0055093 3300046536 Bacteria 2343
432 Ga0495645_0093214 3300046543 Bacteria 2150
433 Ga0495635_0219899 3300046663 Unclassified 1285
434 Ga0495635_0471761 3300046663 Unclassified 828
435 Ga0495599_0028819 3300046678 Bacteria 3479
436 Ga0495599_0167456 3300046678 Unclassified 1357
437 Ga0495658_0042015 3300046683 Bacteria 2551
438 Ga0495658_0979474 3300046683 Bacteria 540
439 Ga0495613_0398427 3300046689 Unclassified 939
440 Ga0495613_0824906 3300046689 Unclassified 604
441 Ga0495600_0228091 3300046809 Bacteria 1190
442 Ga0495600_0401518 3300046809 Unclassified 853
443 Ga0495581_0067274 3300047315 Bacteria 2072
444 Ga0495674_0109482 3300047319 Bacteria 2343
445 Ga0495676_0062693 3300047321 Bacteria 2901
446 Ga0495675_0158010 3300047444 Unclassified 1397
447 Ga0495684_0381764 3300047471 Unclassified 993
448 Ga0495684_0532035 3300047471 Bacteria 803
449 Ga0495684_0821453 3300047471 Unclassified 605
450 Ga0495602_0034390 3300048088 Bacteria 4741
451 Ga0495602_0617368 3300048088 Unclassified 744
452 Ga0495614_0120729 3300048089 Bacteria 1155
453 Ga0496102_0189480 3300048905 Bacteria 1938
454 Ga0496104_0303179 3300048907 Bacteria 1510
455 Ga0496104_0565870 3300048907 Unclassified 1047
456 Ga0496106_0958078 3300048909 Unclassified 674
457 Ga0496107_1212647 3300048910 Unclassified 542
458 Ga0496112_1174788 3300048915 Unclassified 684
459 Ga0501034_0004126 3300049571 Bacteria 16277
460 Ga0501034_1058778 3300049571 Bacteria 693
461 Ga0501037_0291399 3300049573 Bacteria 1135
462 Ga0501038_0412695 3300049574 Bacteria 1043
463 Ga0501047_0021967 3300049581 Bacteria 6129
464 Ga0501047_0897022 3300049581 Unclassified 700
465 Ga0501081_0452447 3300049743 Bacteria 954
466 Ga0501035_0061032 3300049822 Bacteria 3356
467 Ga0501035_0180792 3300049822 Bacteria 1817
468 Ga0501044_0003630 3300049823 Bacteria 17364
469 Ga0501044_0021010 3300049823 Bacteria 6969
470 Ga0501044_0595854 3300049823 Unclassified 999
471 nmdc:mga0rr50_1070656_c1 3300050513 Bacteria 686
472 nmdc:mga0a205_916064_c1 3300050515 Bacteria 723
473 Ga0495601_0105651 3300053077 Bacteria 1821
474 Ga0495612_0009584 3300053078 Bacteria 3922
475 Ga0495595_0622766 3300053084 Unclassified 552
476 Ga0495619_1029697 3300053085 Unclassified 550
477 Ga0500568_0000912 3300053139 Bacteria 20424
478 Ga0495674_0341571
479 Ga0070683_100006256
480 Ga0070683_100020176
481 Ga0070683_100020695
482 Ga0070683_100099607
483 Ga0070683_100103289
484 Ga0070683_100270375
485 Ga0070683_101515308
486 Ga0070690_100048904
487 Ga0068869_100080435
488 Ga0068869_100176689
489 Ga0068869_100391093
490 Ga0070680_100002840
491 Ga0070682_100393180
492 Ga0068868_100262718
493 Ga0068868_100355942
494 Ga0070660_100327137
495 Ga0070689_100428584
496 Ga0070689_101755959
497 Ga0070691_10002140
498 Ga0070661_100411250
499 Ga0070675_100577569
500 Ga0070659_100075775
501 Ga0070659_100213144
502 Ga0070667_100688227
503 Ga0070709_10007983
504 Ga0070709_10313308
505 Ga0070714_100050986
506 Ga0070713_100060045
507 Ga0070713_100220993
508 Ga0070713_100310110
509 Ga0070713_102161122
510 Ga0070710_10754402
511 Ga0070711_100233928
512 Ga0070711_100846645
513 Ga0070705_100187671
514 Ga0070700_101724416
515 Ga0070694_101271025
516 Ga0070694_101535458
517 Ga0070662_100314387
518 Ga0070681_10000363
519 Ga0070681_10081604
520 Ga0070681_10658787
521 Ga0068867_100793770
522 Ga0068867_101732561
523 Ga0070706_100307351
524 Ga0070699_101496233
525 Ga0070679_100001244
526 Ga0070679_100433202
527 Ga0070684_100001498
528 Ga0070684_100050878
529 Ga0070684_100151412
530 Ga0070684_100256230
531 Ga0070684_100695281
532 Ga0070684_100764775
533 Ga0070684_100992503
534 Ga0070697_100139479
535 Ga0068853_100006019
536 Ga0068853_100160778
537 Ga0070686_100297823
538 Ga0070695_100010382
539 Ga0070695_100140777
540 Ga0070695_101827020
541 Ga0070693_100036227
542 Ga0070693_100095818
543 Ga0068855_100034816
544 Ga0068855_100130968
545 Ga0068855_100666703
546 Ga0068855_100809741
547 Ga0070664_100719388
548 Ga0068857_100007306
549 Ga0068857_100345331
550 Ga0068857_100528923
551 Ga0068854_100423836
552 Ga0068856_100004081
553 Ga0068856_100078290
554 Ga0068856_100413143
555 Ga0068856_100445838
556 Ga0068856_101234218
557 Ga0068856_101752520
558 Ga0068852_100014805
559 Ga0068852_101075027
560 Ga0068852_101210314
561 Ga0068852_101558926
562 Ga0068852_101744738
563 Ga0068859_100455058
564 Ga0068859_102476809
565 Ga0068864_100153363
566 Ga0068864_100194356
567 Ga0068864_100314494
568 Ga0068864_101782164
569 Ga0068866_10349514
570 Ga0068866_10625437
571 Ga0068861_101721792
572 Ga0068863_100493075
573 Ga0068863_101499728
574 Ga0068858_100047316
575 Ga0068858_100061995
576 Ga0068858_100410329
577 Ga0068858_100482303
578 Ga0068860_100384695
579 Ga0097621_100005031
580 Ga0097621_100011394
581 Ga0097621_100075642
582 Ga0097621_100420901
583 Ga0097621_101928939
584 Ga0068871_100009366
585 Ga0068871_100067428
586 Ga0068871_100139249
587 Ga0068871_100423806
588 Ga0068871_100468932
589 Ga0068871_101441544
590 Ga0075433_10750899
591 Ga0068865_100003469
592 Ga0068865_100139140
593 Ga0097620_100455051
594 Ga0097620_101424823
595 Ga0097620_102478734
596 Ga0075435_101126066
597 Ga0075435_101442127
598 Ga0099794_10743495
599 Ga0105240_10001515
600 Ga0105240_10014962
601 Ga0105240_10105606
602 Ga0105240_10152991
603 Ga0105240_10187706
604 Ga0105240_10198810
605 Ga0105240_10461790
606 Ga0105240_10708073
607 Ga0105245_10000833
608 Ga0105245_10034587
609 Ga0105245_10037568
610 Ga0105245_10067705
611 Ga0105245_10195702
612 Ga0105245_10370514
613 Ga0105245_10811376
614 Ga0105247_10335776
615 Ga0105243_10039892
616 Ga0105243_10058180
617 Ga0105243_10059866
618 Ga0105243_10631775
619 Ga0105241_10010541
620 Ga0105241_10014086
621 Ga0105241_10048221
622 Ga0105241_10093551
623 Ga0105241_10110184
624 Ga0105241_10179799
625 Ga0105241_10540758
626 Ga0105241_11475874
627 Ga0105241_11573127
628 Ga0105242_10092971
629 Ga0105242_10309034
630 Ga0105242_10659547
631 Ga0105242_10772853
632 Ga0105248_10006908
633 Ga0105248_10062612
634 Ga0105248_10155992
635 Ga0105248_10195679
636 Ga0105248_10229676
637 Ga0105248_11724640
638 Ga0105237_10011000
639 Ga0105237_10024193
640 Ga0105237_10425742
641 Ga0105237_10442455
642 Ga0105237_10585922
643 Ga0105237_10705895
644 Ga0105238_10002354
645 Ga0105238_10007051
646 Ga0105238_10009359
647 Ga0105238_10012184
648 Ga0105238_10063839
649 Ga0105238_10176072
650 Ga0105249_10024725
651 Ga0105249_10980908
652 Ga0105239_10006275
653 Ga0105239_10011963
654 Ga0105239_10021173
655 Ga0105239_10100044
656 Ga0105239_10388702
657 Ga0105239_10442843
658 Ga0105246_10006392
659 Ga0105246_10025681
660 Ga0105246_10159608
661 Ga0105246_10450031
662 Ga0105246_10664480
663 Ga0157373_10225033
664 Ga0157371_10024195
665 Ga0157370_10004024
666 Ga0157370_10048072
667 Ga0157370_10507936
668 Ga0157369_10008896
669 Ga0157369_10013405
670 Ga0157369_10135457
671 Ga0157369_10857031
672 Ga0157374_10013544
673 Ga0157374_10353782
674 Ga0157378_10006968
675 Ga0157378_10015425
676 Ga0157378_10815280
677 Ga0163162_10356227
678 Ga0163162_10717164
679 Ga0163162_10730711
680 Ga0163162_11985954
681 Ga0157372_10002440
682 Ga0157372_10031962
683 Ga0157372_10121880
684 Ga0157372_10198780
685 Ga0157372_10446319
686 Ga0157372_10447464
687 Ga0157375_10001998
688 Ga0157375_10459700
689 Ga0157375_10941572
690 Ga0163163_10017997
691 Ga0163163_10437056
692 Ga0163163_10871080
693 Ga0163163_10911903
694 Ga0182008_10050296
695 Ga0157377_10401620
696 Ga0157379_10051790
697 Ga0157376_10070897
698 Ga0157376_10705552
699 Ga0157376_10989165
700 Ga0182007_10010123
701 Ga0182005_1052294
702 Ga0213873_10104665
703 Ga0207692_11065798
704 Ga0207699_10024984
705 Ga0207699_10697480
706 Ga0207684_10256180
707 Ga0207654_10023673
708 Ga0207654_10118905
709 Ga0207654_10331226
710 Ga0207654_10436069
711 Ga0207654_10516335
712 Ga0207654_10552695
713 Ga0207707_10001288
714 Ga0207707_10063512
715 Ga0207707_10162669
716 Ga0207695_10005184
717 Ga0207695_10108501
718 Ga0207695_10121997
719 Ga0207671_10018157
720 Ga0207671_10208337
721 Ga0207671_10709238
722 Ga0207671_11184323
723 Ga0207671_11195075
724 Ga0207663_10075743
725 Ga0207663_11036753
726 Ga0207663_11142005
727 Ga0207660_10007708
728 Ga0207657_10258466
729 Ga0207649_10750220
730 Ga0207649_11093087
731 Ga0207652_10025575
732 Ga0207652_10388083
733 Ga0207652_10658789
734 Ga0207694_10002227
735 Ga0207694_10018693
736 Ga0207694_10114766
737 Ga0207694_10158793
738 Ga0207694_10651183
739 Ga0207687_10000181
740 Ga0207687_10011665
741 Ga0207687_10056513
742 Ga0207687_10489995
743 Ga0207687_10536266
744 Ga0207687_11368086
745 Ga0207700_10086697
746 Ga0207700_10093593
747 Ga0207664_10159818
748 Ga0207690_10442443
749 Ga0207706_10232745
750 Ga0207686_10037661
751 Ga0207686_10693122
752 Ga0207686_10753510
753 Ga0207686_11199449
754 Ga0207709_10096248
755 Ga0207709_10670377
756 Ga0207670_10115761
757 Ga0207670_10562943
758 Ga0207704_10142923
759 Ga0207711_10001785
760 Ga0207711_10715395
761 Ga0207711_11299699
762 Ga0207711_11472525
763 Ga0207689_10024605
764 Ga0207689_10281520
765 Ga0207689_10586658
766 Ga0207661_10008868
767 Ga0207661_10009599
768 Ga0207661_10019198
769 Ga0207661_10054934
770 Ga0207661_10500514
771 Ga0207661_11042305
772 Ga0207679_10611751
773 Ga0207679_10933607
774 Ga0207679_11233677
775 Ga0207667_10002297
776 Ga0207667_10005315
777 Ga0207667_10285291
778 Ga0207667_10547603
779 Ga0207667_10683586
780 Ga0207667_10996111
781 Ga0207712_10148392
782 Ga0207640_10406961
783 Ga0207658_10362536
784 Ga0207677_10608029
785 Ga0207703_10025662
786 Ga0207703_10272672
787 Ga0207703_10291447
788 Ga0207703_10292061
789 Ga0207703_10494126
790 Ga0207703_10746678
791 Ga0207639_10142561
792 Ga0207639_10165210
793 Ga0207639_10612899
794 Ga0207639_10726830
795 Ga0207702_10024999
796 Ga0207702_10395880
797 Ga0207702_10547784
798 Ga0207702_10611964
799 Ga0207702_10955284
800 Ga0207641_10653773
801 Ga0207641_11105313
802 Ga0207648_10045230
803 Ga0207648_10254893
804 Ga0207648_11429878
805 Ga0207648_11553080
806 Ga0207676_10232130
807 Ga0207676_10292992
808 Ga0207676_10338472
809 Ga0207674_10000419
810 Ga0207674_10004178
811 Ga0207674_10274524
812 Ga0207674_10457901
813 Ga0207674_10975073
814 Ga0207683_11799735
815 Ga0207698_10007081
816 Ga0207698_10145324
817 Ga0207698_11193561
818 Ga0268264_10259138
819 Ga0265340_10099814
820 Ga0265331_10490327
821 Ga0265316_10772479
822 Ga0265313_10003744
823 Ga0316579_10150315
824 Ga0316579_10182920
825 Ga0316579_10223832
826 Ga0265314_10000880
827 Ga0316577_10020290
828 Ga0316577_10085817
829 Ga0316577_10105712
830 Ga0316577_10379028
831 Ga0316577_10759943
832 Ga0316593_10068212
833 Ga0316593_10072405
834 Ga0316596_1224119
835 Ga0373934_0002904
836 Ga0373934_0210616
837 Ga0373923_0052794
838 Ga0373923_0523699
839 Ga0373936_0081705
840 Ga0373936_0171660
841 Ga0373936_0255116
842 Ga0373941_0489004
843 Ga0373953_0009232
844 Ga0373954_0003508
845 Ga0373954_0003988
846 Ga0373957_0018024
847 Ga0373943_0023578
848 Ga0373955_0018841
849 Ga0373955_0021160
850 Ga0373924_0045567
851 Ga0373924_0450335
852 Ga0373935_0058380
853 Ga0373935_0316255
854 Ga0373935_0396332
855 Ga0373935_1093942
856 Ga0373927_0247189
857 Ga0373927_0344735
858 Ga0373933_0005976
859 Ga0373933_0075437
860 Ga0373933_0163831
861 Ga0373933_0426617
862 Ga0373947_0009201
863 Ga0373947_0288717
864 Ga0373947_1182428
865 Ga0373937_0020077
866 Ga0373937_0224462
867 Ga0373937_0399912
868 Ga0373937_1480768
869 Ga0373937_1925554
870 Ga0316582_0022937
871 Ga0316584_0000412
872 Ga0316584_0113118
873 Ga0316584_0117006
874 Ga0316584_1044885
875 Ga0373925_0012823
876 Ga0373925_0014740
877 Ga0373925_0473424
878 Ga0316581_0020926
879 Ga0436360_1305878
880 Ga0436361_0334215
881 Ga0436362_0573525
882 Ga0436362_0675865
883 Ga0451800_0556462
884 Ga0451802_1392088
885 Ga0451853_0368846
886 Ga0439448_0160569
887 Ga0495592_0054476
888 Ga0495651_0224971
889 Ga0495580_0047291
890 Ga0495580_0091338
891 Ga0495582_0120784
892 Ga0495639_0005847
893 Ga0495639_0018717
894 Ga0495594_0155580
895 Ga0495594_0440189
896 Ga0495594_0490194
897 Ga0495628_0385131
898 Ga0495628_1204390
899 Ga0495630_0371574
900 Ga0495630_1345680
901 Ga0495652_0028538
902 Ga0495652_0239579
903 Ga0495665_0336239
904 Ga0495640_0577853
905 Ga0495586_0628166
906 Ga0495586_0890279
907 Ga0495587_0000791
908 Ga0495587_0055093
909 Ga0495645_0093214
910 Ga0495635_0219899
911 Ga0495635_0471761
912 Ga0495599_0028819
913 Ga0495599_0167456
914 Ga0495658_0042015
915 Ga0495658_0979474
916 Ga0495613_0398427
917 Ga0495613_0824906
918 Ga0495600_0228091
919 Ga0495600_0401518
920 Ga0495581_0067274
921 Ga0495674_0109482
922 Ga0495676_0062693
923 Ga0495675_0158010
924 Ga0495684_0381764
925 Ga0495684_0532035
926 Ga0495684_0821453
927 Ga0495602_0034390
928 Ga0495602_0617368
929 Ga0495614_0120729
930 Ga0496102_0189480
931 Ga0496104_0303179
932 Ga0496104_0565870
933 Ga0496106_0958078
934 Ga0496107_1212647
935 Ga0496112_1174788
936 Ga0501034_0004126
937 Ga0501034_1058778
938 Ga0501037_0291399
939 Ga0501038_0412695
940 Ga0501047_0021967
941 Ga0501047_0897022
942 Ga0501081_0452447
943 Ga0501035_0061032
944 Ga0501035_0180792
945 Ga0501044_0003630
946 Ga0501044_0021010
947 Ga0501044_0595854
948 nmdc:mga0rr50_1070656_c1
949 nmdc:mga0a205_916064_c1
950 Ga0495601_0105651
951 Ga0495612_0009584
952 Ga0495595_0622766
953 Ga0495619_1029697
954 Ga0500568_0000912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03091

CutA1

CutA1 divalent ion tolerance protein

20

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p1l-assembly1.cif.gz_A structure of the periplasmic divalent cation tolerance protein cuta from archaeoglobus fulgidus 0.9826 4 105
4zk7-assembly1.cif.gz_Q crystal structure of rescued two-component self-assembling tetrahedral cage t33-31 0.9806 4 105
4zk7-assembly1.cif.gz_M crystal structure of rescued two-component self-assembling tetrahedral cage t33-31 0.9794 4 105
4y65-assembly1.cif.gz_A crystal structure of e.coli cuta1 c16a/c39a/c79a mutation 0.975 2 105
1nza-assembly1.cif.gz_A divalent cation tolerance protein (cut a1) from thermus thermophilus hb8 0.9749 4 105
ID Description Score Start End Superfamily
af_Q8I4T9_34_158_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9864 2 103 3.30.70.120
1p1lA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9826 4 105 3.30.70.120
1nzaA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9749 4 105 3.30.70.120
af_Q4CSL6_1_109_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9748 4 105 3.30.70.120
2nuhA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9726 2 105 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A147IWN7-F1-model_v4 Cation tolerance protein CutA 0.996 7 105 GO:0005507
GO:0010038
AF-A0A533Y9A1-F1-model_v4 Divalent-cation tolerance protein CutA 0.9939 3 103 GO:0005507
GO:0010038
AF-A0A7R6PDE6-F1-model_v4 Periplasmic divalent cation tolerance protein 0.9935 7 104 GO:0005507
GO:0010038
AF-K9YH22-F1-model_v4 CutA1 divalent ion tolerance protein 0.9922 2 104 GO:0005507
GO:0010038
AF-A0A1G1JZD3-F1-model_v4 Divalent-cation tolerance protein CutA 0.9913 3 104 GO:0005507
GO:0010038

Map