F451709

General Info

Members Datasets Scaffolds Average Seq Length
477 293 477 237

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10312185|Ga0157379_103121851
Length 229
Sequence MRFPAPLIPATLIKRYKRFLADVTLPDGTAITAHVANPGAMTGLAAPGSRVWLSRSDNPSRKLSHSWELIEVDLGQGPELVGVNTAHPNPLVGTALAVGAFIRREVKYGKNSRVDFLLEGAGRPSCYVEIKNVHLMRQPGLAEFPDAKTERGRKHLDELGDMVEAGHRAVMLYLIQIGSATRFALARDIDPKYGAAFDRARARGVEAMAWRCVITRDGIEIATPVPMVD

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.87
Nodule 0
Rhizoplane 11.95
Rhizosphere 81.34
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1007293 3300001977 Bacteria 1695
2 JGI24749J21850_1003378 3300002076 Bacteria 2233
3 JGI24744J21845_10005049 3300002077 Bacteria 2728
4 JGI24034J26672_10010157 3300002239 Bacteria 1395
5 JGI24742J22300_10032776 3300002244 Bacteria 911
6 rootL2_10107034 3300003322 Bacteria 1260
7 Ga0070676_10028756 3300005328 Bacteria 3158
8 Ga0070683_100175249 3300005329 Bacteria 2036
9 Ga0070690_100214828 3300005330 Bacteria 1345
10 Ga0070670_100148073 3300005331 Bacteria 2031
11 Ga0068869_100062305 3300005334 Bacteria 2738
12 Ga0070666_10064432 3300005335 Bacteria 2486
13 Ga0070682_100118641 3300005337 Bacteria 1773
14 Ga0068868_100012622 3300005338 Bacteria 6178
15 Ga0070660_100105337 3300005339 Bacteria 2238
16 Ga0070689_100011988 3300005340 Bacteria 6228
17 Ga0070687_100008637 3300005343 Bacteria 4324
18 Ga0070669_100416016 3300005353 Bacteria 1102
19 Ga0070675_100006738 3300005354 Bacteria 8834
20 Ga0070671_100005864 3300005355 Bacteria 9787
21 Ga0070674_100066196 3300005356 Bacteria 2538
22 Ga0070673_100015427 3300005364 Bacteria 5365
23 Ga0070688_100138048 3300005365 Bacteria 1653
24 Ga0070713_100071856 3300005436 Bacteria 2925
25 Ga0070701_10026158 3300005438 Bacteria 2843
26 Ga0070701_10197957 3300005438 Bacteria 1186
27 Ga0070700_100549779 3300005441 Bacteria 897
28 Ga0070694_100149245 3300005444 Bacteria 1706
29 Ga0070663_100025158 3300005455 Bacteria 4017
30 Ga0070681_10155735 3300005458 Bacteria 2210
31 Ga0068867_100137511 3300005459 Bacteria 1906
32 Ga0070685_10011432 3300005466 Bacteria 4646
33 Ga0070679_100082703 3300005530 Bacteria 3200
34 Ga0070684_100023458 3300005535 Bacteria 5162
35 Ga0070684_100034563 3300005535 Bacteria 4322
36 Ga0070697_100030782 3300005536 Bacteria 4313
37 Ga0070672_100055964 3300005543 Bacteria 3092
38 Ga0070672_100108906 3300005543 Bacteria 2256
39 Ga0070672_100521790 3300005543 Bacteria 1029
40 Ga0070686_100007036 3300005544 Bacteria 6271
41 Ga0070686_100054622 3300005544 Bacteria 2556
42 Ga0070686_100511215 3300005544 Bacteria 934
43 Ga0070695_100015879 3300005545 Bacteria 4551
44 Ga0070695_100202600 3300005545 Bacteria 1419
45 Ga0070695_100374040 3300005545 Bacteria 1073
46 Ga0070696_100014043 3300005546 Bacteria 5377
47 Ga0070696_100326199 3300005546 Unclassified 1183
48 Ga0070665_100494777 3300005548 Bacteria 1234
49 Ga0070704_100013544 3300005549 Bacteria 5063
50 Ga0070664_100009979 3300005564 Bacteria 7696
51 Ga0068856_100081475 3300005614 Bacteria 3211
52 Ga0070702_100001377 3300005615 Bacteria 9917
53 Ga0068852_100168443 3300005616 Bacteria 2051
54 Ga0068859_100104866 3300005617 Bacteria 2886
55 Ga0068859_100346699 3300005617 Bacteria 1580
56 Ga0068864_100014555 3300005618 Bacteria 6536
57 Ga0068861_100130493 3300005719 Bacteria 2039
58 Ga0068851_10060705 3300005834 Bacteria 1936
59 Ga0068870_10068366 3300005840 Bacteria 1930
60 Ga0068870_10381819 3300005840 Bacteria 912
61 Ga0068863_100111493 3300005841 Bacteria 2605
62 Ga0068863_100729415 3300005841 Bacteria 986
63 Ga0068858_100019000 3300005842 Bacteria 6430
64 Ga0068858_100301378 3300005842 Bacteria 1529
65 Ga0068860_100010168 3300005843 Bacteria 9321
66 Ga0068860_100272686 3300005843 Bacteria 1652
67 Ga0081455_10011443 3300005937 Bacteria 8914
68 Ga0081455_10052942 3300005937 Bacteria 3471
69 Ga0081455_10063357 3300005937 Bacteria 3103
70 Ga0081455_10202816 3300005937 Bacteria 1484
71 Ga0081538_10034597 3300005981 Bacteria 3336
72 Ga0081540_1001034 3300005983 Bacteria 24931
73 Ga0081540_1002311 3300005983 Bacteria 15633
74 Ga0081540_1016614 3300005983 Bacteria 4595
75 Ga0070717_10583148 3300006028 Bacteria 1014
76 Ga0075365_10020587 3300006038 Bacteria 4093
77 Ga0075364_10018750 3300006051 Bacteria 4337
78 Ga0075364_10075285 3300006051 Bacteria 2227
79 Ga0070715_10005422 3300006163 Bacteria 4252
80 Ga0070716_100021024 3300006173 Bacteria 3433
81 Ga0070712_100463352 3300006175 Bacteria 1057
82 Ga0075362_10016281 3300006177 Bacteria 3042
83 Ga0075367_10076487 3300006178 Bacteria 2020
84 Ga0075369_10009394 3300006186 Bacteria 3797
85 Ga0075366_10048536 3300006195 Bacteria 2518
86 Ga0075366_10072707 3300006195 Bacteria 2049
87 Ga0097621_100106537 3300006237 Bacteria 2365
88 Ga0097621_100123408 3300006237 Bacteria 2199
89 Ga0075370_10065307 3300006353 Bacteria 2075
90 Ga0068871_100199337 3300006358 Bacteria 1727
91 Ga0075428_100444680 3300006844 Bacteria 1388
92 Ga0075430_100000015 3300006846 Bacteria 89952
93 Ga0075430_100002472 3300006846 Bacteria 15389
94 Ga0075431_100084357 3300006847 Bacteria 3280
95 Ga0075431_100106374 3300006847 Bacteria 2894
96 Ga0075433_10006324 3300006852 Bacteria 9358
97 Ga0075433_10484008 3300006852 Bacteria 1090
98 Ga0075434_100036001 3300006871 Bacteria 4895
99 Ga0075434_100115118 3300006871 Bacteria 2701
100 Ga0075429_100033803 3300006880 Bacteria 4442
101 Ga0075429_100049619 3300006880 Bacteria 3650
102 Ga0068865_100007886 3300006881 Bacteria 6569
103 Ga0075436_100001731 3300006914 Bacteria 14950
104 Ga0097620_100104869 3300006931 Bacteria 2886
105 Ga0097620_100346690 3300006931 Bacteria 1580
106 Ga0075435_100175665 3300007076 Bacteria 1809
107 Ga0105244_10075130 3300009036 Bacteria 1680
108 Ga0111539_10127047 3300009094 Bacteria 2986
109 Ga0111539_10600554 3300009094 Bacteria 1282
110 Ga0105245_10027869 3300009098 Bacteria 4978
111 Ga0105245_10747403 3300009098 Bacteria 1014
112 Ga0105247_10046830 3300009101 Bacteria 2655
113 Ga0114129_10027820 3300009147 Bacteria 8007
114 Ga0114129_10178275 3300009147 Bacteria 2893
115 Ga0114129_11033519 3300009147 Bacteria 1033
116 Ga0114129_11220788 3300009147 Unclassified 936
117 Ga0105243_10038873 3300009148 Bacteria 3708
118 Ga0105241_10813483 3300009174 Bacteria 862
119 Ga0105241_10825622 3300009174 Bacteria 855
120 Ga0105242_10240019 3300009176 Bacteria 1629
121 Ga0105242_10359383 3300009176 Bacteria 1347
122 Ga0105248_10382853 3300009177 Bacteria 1584
123 Ga0105237_10025992 3300009545 Bacteria 5985
124 Ga0105249_10000711 3300009553 Bacteria 30203
125 Ga0105249_10008451 3300009553 Bacteria 8969
126 Ga0105249_10857926 3300009553 Bacteria 974
127 Ga0105246_10216592 3300011119 Bacteria 1498
128 Ga0163162_10059098 3300013306 Bacteria 3865
129 Ga0163162_10092036 3300013306 Bacteria 3115
130 Ga0163162_10307088 3300013306 Bacteria 1719
131 Ga0163163_10046009 3300014325 Bacteria 4285
132 Ga0163163_10168348 3300014325 Bacteria 2238
133 Ga0157380_10062422 3300014326 Bacteria 2985
134 Ga0157380_10352890 3300014326 Bacteria 1377
135 Ga0157380_10817166 3300014326 Bacteria 951
136 Ga0157377_10019360 3300014745 Bacteria 3555
137 Ga0157379_10312185 3300014968 Bacteria 1434
138 Ga0157376_10016909 3300014969 Bacteria 5551
139 Ga0157376_10089850 3300014969 Bacteria 2657
140 Ga0157376_10425761 3300014969 Bacteria 1289
141 Ga0182007_10032901 3300015262 Bacteria 1759
142 Ga0213876_10050293 3300021384 Bacteria 2202
143 Ga0209758_1000925 3300025297 Bacteria 39673
144 Ga0207692_10030366 3300025898 Bacteria 2577
145 Ga0207710_10013235 3300025900 Bacteria 3475
146 Ga0207710_10127230 3300025900 Bacteria 1221
147 Ga0207688_10000344 3300025901 Bacteria 21559
148 Ga0207680_10025638 3300025903 Bacteria 3255
149 Ga0207647_10022214 3300025904 Bacteria 4219
150 Ga0207685_10180437 3300025905 Bacteria 978
151 Ga0207645_10013416 3300025907 Bacteria 5521
152 Ga0207645_10064763 3300025907 Bacteria 2335
153 Ga0207643_10163716 3300025908 Bacteria 1339
154 Ga0207654_10386203 3300025911 Bacteria 971
155 Ga0207707_10239070 3300025912 Bacteria 1579
156 Ga0207671_10482324 3300025914 Bacteria 988
157 Ga0207693_10033192 3300025915 Bacteria 4073
158 Ga0207663_10217334 3300025916 Bacteria 1389
159 Ga0207662_10026057 3300025918 Bacteria 3371
160 Ga0207657_10022265 3300025919 Bacteria 5938
161 Ga0207657_10024392 3300025919 Bacteria 5602
162 Ga0207652_10060020 3300025921 Bacteria 3280
163 Ga0207694_10722226 3300025924 Bacteria 840
164 Ga0207650_10001141 3300025925 Bacteria 19510
165 Ga0207659_10063346 3300025926 Bacteria 2673
166 Ga0207659_10485015 3300025926 Bacteria 1045
167 Ga0207687_10024211 3300025927 Bacteria 4053
168 Ga0207700_10011687 3300025928 Bacteria 5613
169 Ga0207700_10106776 3300025928 Bacteria 2245
170 Ga0207664_10082568 3300025929 Bacteria 2618
171 Ga0207664_10094416 3300025929 Bacteria 2458
172 Ga0207644_10014875 3300025931 Bacteria 5216
173 Ga0207644_10034959 3300025931 Bacteria 3519
174 Ga0207706_10004119 3300025933 Bacteria 13719
175 Ga0207686_10023561 3300025934 Bacteria 3558
176 Ga0207686_10115683 3300025934 Bacteria 1817
177 Ga0207709_10021135 3300025935 Bacteria 3681
178 Ga0207709_10221616 3300025935 Bacteria 1364
179 Ga0207670_10010975 3300025936 Bacteria 5236
180 Ga0207670_10062814 3300025936 Bacteria 2539
181 Ga0207670_10193602 3300025936 Bacteria 1540
182 Ga0207669_10040350 3300025937 Bacteria 2707
183 Ga0207669_10050237 3300025937 Bacteria 2491
184 Ga0207704_10061505 3300025938 Bacteria 2330
185 Ga0207665_10035161 3300025939 Bacteria 3324
186 Ga0207691_10016132 3300025940 Bacteria 7096
187 Ga0207691_10080795 3300025940 Bacteria 2923
188 Ga0207691_10428055 3300025940 Bacteria 1127
189 Ga0207711_10010900 3300025941 Bacteria 7555
190 Ga0207711_10046016 3300025941 Bacteria 3729
191 Ga0207689_10010387 3300025942 Bacteria 8020
192 Ga0207679_10279270 3300025945 Bacteria 1432
193 Ga0207651_10141408 3300025960 Bacteria 1859
194 Ga0207712_10011604 3300025961 Bacteria 5618
195 Ga0207668_10316628 3300025972 Bacteria 1293
196 Ga0207668_10648045 3300025972 Bacteria 924
197 Ga0207658_10009317 3300025986 Bacteria 6658
198 Ga0207658_10130232 3300025986 Bacteria 2020
199 Ga0207677_10001708 3300026023 Bacteria 11605
200 Ga0207677_10188079 3300026023 Bacteria 1631
201 Ga0207703_10007814 3300026035 Bacteria 8462
202 Ga0207639_10055275 3300026041 Bacteria 3037
203 Ga0207678_10008970 3300026067 Bacteria 8802
204 Ga0207708_10002952 3300026075 Bacteria 12541
205 Ga0207708_10190699 3300026075 Unclassified 1631
206 Ga0207702_10087780 3300026078 Bacteria 2716
207 Ga0207641_10030974 3300026088 Bacteria 4434
208 Ga0207641_10493696 3300026088 Bacteria 1188
209 Ga0207648_10006335 3300026089 Bacteria 11766
210 Ga0207648_10127201 3300026089 Bacteria 2242
211 Ga0207676_10001967 3300026095 Bacteria 14966
212 Ga0207676_10065350 3300026095 Bacteria 2896
213 Ga0207676_10384735 3300026095 Bacteria 1307
214 Ga0207674_10063071 3300026116 Bacteria 3742
215 Ga0207675_100014775 3300026118 Bacteria 7284
216 Ga0207675_100216869 3300026118 Bacteria 1842
217 Ga0207683_10368135 3300026121 Bacteria 1320
218 Ga0207698_10039460 3300026142 Bacteria 3499
219 Ga0207428_10038474 3300027907 Bacteria 3888
220 Ga0268264_10007811 3300028381 Bacteria 8901
221 Ga0265329_10056018 3300031242 Bacteria 1250
222 Ga0265340_10000573 3300031247 Bacteria 20425
223 Ga0265339_10001994 3300031249 Bacteria 14995
224 Ga0265331_10015506 3300031250 Bacteria 4021
225 Ga0265316_10080682 3300031344 Bacteria 2495
226 Ga0316575_10023815 3300031665 Bacteria 2368
227 Ga0316579_10247164 3300031691 Bacteria 863
228 Ga0265314_10084309 3300031711 Bacteria 2086
229 Ga0265342_10000175 3300031712 Bacteria 71083
230 Ga0373959_0032958 3300034820 Bacteria 1055
231 Ga0373928_0027783 3300035084 Bacteria 1234
232 Ga0373934_0054274 3300035086 Bacteria 1591
233 Ga0373923_0000038 3300035111 Bacteria 20095
234 Ga0373936_0004827 3300035113 Bacteria 5084
235 Ga0373936_0031400 3300035113 Bacteria 2098
236 Ga0373941_0184340 3300035115 Bacteria 785
237 Ga0373945_0005100 3300035116 Bacteria 4190
238 Ga0373945_0047677 3300035116 Bacteria 1568
239 Ga0373953_0007624 3300035117 Bacteria 3634
240 Ga0373954_0001191 3300035118 Bacteria 10445
241 Ga0373956_0056181 3300035119 Bacteria 1776
242 Ga0373957_0014910 3300035120 Bacteria 2664
243 Ga0373960_0032277 3300035121 Bacteria 1470
244 Ga0373943_0002600 3300035170 Bacteria 8209
245 Ga0373943_0003464 3300035170 Bacteria 7174
246 Ga0373946_0001741 3300035171 Bacteria 7593
247 Ga0373946_0007686 3300035171 Bacteria 3949
248 Ga0373955_0000211 3300035172 Bacteria 24370
249 Ga0373942_0029202 3300035207 Bacteria 1446
250 Ga0373961_0045001 3300035241 Bacteria 1290
251 Ga0373962_0093001 3300035242 Bacteria 931
252 Ga0373924_0005832 3300035410 Bacteria 4384
253 Ga0373931_0008781 3300035691 Bacteria 4808
254 Ga0373931_0113690 3300035691 Bacteria 1539
255 Ga0373935_0000189 3300035692 Bacteria 29172
256 Ga0373935_0016441 3300035692 Bacteria 4475
257 Ga0373935_0033071 3300035692 Bacteria 3217
258 Ga0373935_0089708 3300035692 Bacteria 2011
259 Ga0373935_0281329 3300035692 Bacteria 1171
260 Ga0373927_0009208 3300035695 Bacteria 6624
261 Ga0373927_0011842 3300035695 Bacteria 5810
262 Ga0373927_0060671 3300035695 Bacteria 2447
263 Ga0373927_0122288 3300035695 Bacteria 1699
264 Ga0373927_0296889 3300035695 Bacteria 1063
265 Ga0373933_0004328 3300035724 Bacteria 7796
266 Ga0373947_0004910 3300035725 Bacteria 7826
267 Ga0373947_0015833 3300035725 Bacteria 4331
268 Ga0373937_0000009 3300036401 Bacteria 169521
269 Ga0373937_0343420 3300036401 Bacteria 1414
270 Ga0373925_0000194 3300037068 Bacteria 66124
271 Ga0373925_0013924 3300037068 Bacteria 5822
272 Ga0373925_0090176 3300037068 Bacteria 2343
273 Ga0395901_0471276 3300038443 Bacteria 1282
274 Ga0436365_1088661 3300039437 Bacteria 2692
275 Ga0436363_0991563 3300039450 Bacteria 7209
276 Ga0495617_120876 3300046452 Bacteria 844
277 Ga0495627_086082 3300046453 Bacteria 907
278 Ga0495592_0000422 3300046454 Bacteria 32126
279 Ga0495592_0142588 3300046454 Bacteria 1665
280 Ga0495603_0110159 3300046455 Bacteria 1606
281 Ga0495629_0004190 3300046459 Bacteria 10826
282 Ga0495641_0005591 3300046461 Bacteria 8416
283 Ga0495651_0000300 3300046462 Bacteria 38562
284 Ga0495651_0119948 3300046462 Bacteria 1934
285 Ga0495653_0000032 3300046463 Bacteria 132763
286 Ga0495653_0181475 3300046463 Bacteria 1444
287 Ga0495582_0001274 3300046473 Bacteria 14160
288 Ga0495582_0180537 3300046473 Bacteria 1202
289 Ga0495605_0056685 3300046474 Bacteria 1889
290 Ga0495662_0017803 3300046476 Bacteria 3440
291 Ga0495662_0031285 3300046476 Bacteria 2570
292 Ga0495664_0000010 3300046477 Bacteria 268381
293 Ga0495664_0166814 3300046477 Bacteria 1336
294 Ga0495584_0003670 3300046491 Bacteria 8364
295 Ga0495585_0140006 3300046492 Bacteria 1268
296 Ga0495594_0006899 3300046499 Bacteria 5842
297 Ga0495596_0040638 3300046500 Bacteria 1836
298 Ga0495608_0000008 3300046511 Bacteria 268629
299 Ga0495608_0503104 3300046511 Bacteria 734
300 Ga0495618_0000002 3300046514 Bacteria 271353
301 Ga0495628_0000009 3300046516 Bacteria 237611
302 Ga0495628_0434755 3300046516 Bacteria 955
303 Ga0495630_0002397 3300046517 Bacteria 13021
304 Ga0495630_0411605 3300046517 Unclassified 1036
305 Ga0495652_0000011 3300046529 Bacteria 255329
306 Ga0495652_0214199 3300046529 Bacteria 1452
307 Ga0495665_0120431 3300046531 Bacteria 1375
308 Ga0495640_0000094 3300046533 Bacteria 51238
309 Ga0495640_0086556 3300046533 Bacteria 2074
310 Ga0495640_0202528 3300046533 Bacteria 1257
311 Ga0495587_0000086 3300046536 Bacteria 72022
312 Ga0495598_0157460 3300046537 Bacteria 797
313 Ga0495645_0000010 3300046543 Bacteria 238337
314 Ga0495645_0237115 3300046543 Bacteria 1219
315 Ga0495667_0000005 3300046559 Bacteria 268252
316 Ga0495656_0047232 3300046615 Bacteria 1825
317 Ga0495634_0000223 3300046642 Bacteria 53103
318 Ga0495635_0000008 3300046663 Bacteria 268349
319 Ga0495657_0000058 3300046675 Bacteria 97827
320 Ga0495599_0000007 3300046678 Bacteria 236638
321 Ga0495599_0306943 3300046678 Bacteria 957
322 Ga0495623_0000085 3300046679 Bacteria 55527
323 Ga0495646_0000021 3300046680 Bacteria 115358
324 Ga0495658_0024042 3300046683 Bacteria 3240
325 Ga0495658_0135165 3300046683 Bacteria 1504
326 Ga0495669_0092994 3300046684 Bacteria 1394
327 Ga0495613_0020157 3300046689 Bacteria 4968
328 Ga0495613_0103187 3300046689 Bacteria 2059
329 Ga0495624_0008312 3300046690 Bacteria 7255
330 Ga0495671_0102996 3300046692 Bacteria 1395
331 Ga0495600_0000001 3300046809 Bacteria 214870
332 Ga0495604_0000012 3300047317 Bacteria 268341
333 Ga0495674_0000011 3300047319 Bacteria 270911
334 Ga0495674_0297944 3300047319 Bacteria 1318
335 Ga0495676_0017745 3300047321 Bacteria 6286
336 Ga0495680_0000245 3300047322 Bacteria 59987
337 Ga0495675_0002083 3300047444 Bacteria 11942
338 Ga0495675_0177297 3300047444 Bacteria 1306
339 Ga0495681_0163997 3300047470 Bacteria 924
340 Ga0495684_0000084 3300047471 Bacteria 65600
341 Ga0495593_0000733 3300047673 Bacteria 19034
342 Ga0495593_0249963 3300047673 Bacteria 888
343 Ga0495602_0000073 3300048088 Bacteria 98745
344 Ga0496100_0002178 3300048903 Bacteria 9879
345 Ga0496100_0094057 3300048903 Bacteria 2052
346 Ga0496100_0104996 3300048903 Bacteria 1953
347 Ga0496100_0111865 3300048903 Bacteria 1898
348 Ga0496101_0003990 3300048904 Bacteria 9234
349 Ga0496101_0095326 3300048904 Bacteria 2219
350 Ga0496102_0000871 3300048905 Bacteria 28857
351 Ga0496102_0010266 3300048905 Bacteria 8052
352 Ga0496103_0003369 3300048906 Bacteria 9767
353 Ga0496103_0003600 3300048906 Bacteria 9454
354 Ga0496103_0313909 3300048906 Bacteria 1008
355 Ga0496103_0447325 3300048906 Bacteria 829
356 Ga0496104_0000445 3300048907 Bacteria 35921
357 Ga0496104_0000880 3300048907 Bacteria 25856
358 Ga0496104_0002378 3300048907 Bacteria 16215
359 Ga0496104_0005871 3300048907 Bacteria 10756
360 Ga0496104_0164149 3300048907 Bacteria 2130
361 Ga0496105_0000514 3300048908 Bacteria 25562
362 Ga0496105_0006690 3300048908 Bacteria 8873
363 Ga0496105_0080877 3300048908 Bacteria 2684
364 Ga0496105_0088570 3300048908 Bacteria 2557
365 Ga0496106_0007908 3300048909 Bacteria 7858
366 Ga0496106_0061247 3300048909 Bacteria 2854
367 Ga0496106_0141897 3300048909 Bacteria 1890
368 Ga0496106_0319960 3300048909 Bacteria 1245
369 Ga0496107_0000769 3300048910 Bacteria 18509
370 Ga0496107_0060279 3300048910 Bacteria 2746
371 Ga0496107_0297076 3300048910 Bacteria 1202
372 Ga0496108_0003421 3300048911 Bacteria 12733
373 Ga0496108_0005851 3300048911 Bacteria 9969
374 Ga0496108_0442487 3300048911 Bacteria 1135
375 Ga0496108_0452102 3300048911 Bacteria 1122
376 Ga0496109_0002011 3300048912 Bacteria 16871
377 Ga0496109_0046860 3300048912 Bacteria 3927
378 Ga0496109_0601801 3300048912 Bacteria 1035
379 Ga0496109_0982848 3300048912 Bacteria 782
380 Ga0496110_0002034 3300048913 Bacteria 15073
381 Ga0496110_0012856 3300048913 Bacteria 6897
382 Ga0496110_0175660 3300048913 Bacteria 1944
383 Ga0496110_0550176 3300048913 Bacteria 1049
384 Ga0496111_0000072 3300048914 Bacteria 41891
385 Ga0496111_0000641 3300048914 Bacteria 18442
386 Ga0496112_0000112 3300048915 Bacteria 50370
387 Ga0496112_0009026 3300048915 Bacteria 8954
388 Ga0496113_0000058 3300048916 Bacteria 47947
389 Ga0496113_0001260 3300048916 Bacteria 13973
390 Ga0496113_0032424 3300048916 Bacteria 3798
391 Ga0496113_0242153 3300048916 Bacteria 1439
392 Ga0496113_0646119 3300048916 Bacteria 846
393 Ga0496114_0016624 3300048917 Bacteria 5931
394 Ga0496114_0017394 3300048917 Bacteria 5802
395 Ga0496114_0260038 3300048917 Bacteria 1528
396 Ga0496114_0377686 3300048917 Bacteria 1254
397 Ga0496115_0013126 3300048918 Bacteria 6256
398 Ga0496115_0022047 3300048918 Bacteria 4927
399 Ga0496115_0055864 3300048918 Bacteria 3172
400 Ga0496115_0066392 3300048918 Bacteria 2915
401 Ga0501036_0290382 3300049572 Bacteria 1368
402 Ga0501039_0365910 3300049575 Bacteria 1133
403 Ga0501040_0254894 3300049576 Bacteria 1252
404 Ga0501071_0401230 3300049587 Bacteria 1047
405 Ga0501072_0086528 3300049588 Bacteria 2487
406 Ga0501072_0140284 3300049588 Bacteria 1927
407 Ga0501073_0233707 3300049589 Bacteria 1270
408 Ga0501074_0305981 3300049590 Bacteria 1129
409 Ga0501075_0124913 3300049591 Bacteria 1959
410 Ga0501075_0147293 3300049591 Bacteria 1794
411 Ga0501079_0220169 3300049741 Bacteria 1483
412 Ga0501079_0484858 3300049741 Unclassified 972
413 Ga0501080_0079145 3300049742 Bacteria 3056
414 Ga0501081_0093692 3300049743 Bacteria 2115
415 Ga0501081_0143487 3300049743 Bacteria 1712
416 Ga0501045_0637183 3300049824 Bacteria 788
417 nmdc:mga03683_14426_c1 3300050489 Bacteria 2924
418 nmdc:mga03n38_34639_c1 3300050490 Bacteria 2158
419 nmdc:mga00v17_42897_c1 3300050491 Bacteria 2722
420 nmdc:mga0yw44_271252_c1 3300050492 Bacteria 1132
421 nmdc:mga0yw44_501_c1 3300050492 Bacteria 13990
422 nmdc:mga0yw44_8423_c1 3300050492 Bacteria 5137
423 nmdc:mga0k408_18592_c1 3300050493 Bacteria 3880
424 nmdc:mga0k408_333725_c1 3300050493 Bacteria 904
425 nmdc:mga0k408_357889_c1 3300050493 Bacteria 870
426 nmdc:mga0k408_73512_c1 3300050493 Bacteria 1997
427 nmdc:mga06z11_23381_c1 3300050494 Bacteria 2903
428 nmdc:mga06z11_67316_c1 3300050494 Bacteria 1885
429 nmdc:mga04h51_3760_c1 3300050495 Bacteria 3720
430 nmdc:mga07m45_30674_c1 3300050496 Bacteria 2979
431 nmdc:mga07m45_63074_c1 3300050496 Bacteria 2101
432 nmdc:mga05p37_106824_c1 3300050507 Bacteria 3444
433 nmdc:mga05p37_210744_c1 3300050507 Bacteria 2349
434 nmdc:mga05p37_40386_c1 3300050507 Bacteria 5730
435 nmdc:mga05p37_50472_c1 3300050507 Bacteria 5117
436 nmdc:mga05p37_853690_c1 3300050507 Bacteria 988
437 nmdc:mga09592_21633_c1 3300050508 Bacteria 5301
438 nmdc:mga0qj67_60_c1 3300050509 Bacteria 80228
439 nmdc:mga0qj67_70370_c1 3300050509 Bacteria 2791
440 nmdc:mga06r32_29045_c1 3300050510 Bacteria 5178
441 nmdc:mga06r32_290594_c1 3300050510 Bacteria 1621
442 nmdc:mga06r32_56117_c1 3300050510 Bacteria 3780
443 nmdc:mga08y16_115077_c1 3300050511 Bacteria 2800
444 nmdc:mga08y16_609216_c1 3300050511 Bacteria 1100
445 nmdc:mga08y16_718063_c1 3300050511 Unclassified 998
446 nmdc:mga0n895_120457_c1 3300050512 Bacteria 2645
447 nmdc:mga0n895_16977_c1 3300050512 Bacteria 6697
448 nmdc:mga0n895_26569_c1 3300050512 Bacteria 5485
449 nmdc:mga0n895_29161_c1 3300050512 Bacteria 5259
450 nmdc:mga0n895_78332_c1 3300050512 Bacteria 2298
451 nmdc:mga0rr50_527385_c1 3300050513 Bacteria 1005
452 nmdc:mga08x19_112578_c1 3300050514 Bacteria 1816
453 nmdc:mga08x19_39937_c1 3300050514 Bacteria 2985
454 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
455 nmdc:mga0a205_19052_c1 3300050515 Bacteria 6465
456 nmdc:mga0a205_461170_c1 3300050515 Bacteria 1130
457 Ga0495601_0000009 3300053077 Bacteria 270622
458 Ga0495601_0064102 3300053077 Bacteria 2336
459 Ga0495601_0117244 3300053077 Bacteria 1727
460 Ga0495601_0199444 3300053077 Bacteria 1308
461 Ga0495612_0000019 3300053078 Bacteria 137844
462 Ga0495612_0020957 3300053078 Bacteria 2622
463 Ga0495595_0000015 3300053084 Bacteria 144946
464 Ga0495595_0030029 3300053084 Bacteria 2436
465 Ga0495595_0109817 3300053084 Bacteria 1336
466 Ga0495595_0356251 3300053084 Bacteria 739
467 Ga0495619_0000012 3300053085 Bacteria 268349
468 Ga0495619_0008018 3300053085 Bacteria 6683
469 Ga0495619_0037660 3300053085 Bacteria 3153
470 Ga0500593_002603 3300053117 Bacteria 6661
471 Ga0500642_0211606 3300053130 Bacteria 900
472 Ga0500559_0154682 3300053136 Bacteria 1077
473 Ga0501084_0036290 3300054114 Bacteria 4118
474 Ga0501084_0037753 3300054114 Bacteria 4037
475 Ga0501084_0383110 3300054114 Bacteria 1188
476 Ga0501082_0147036 3300060353 Bacteria 2046
477 Ga0501082_0206020 3300060353 Bacteria 1711

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0002600 Ga0373943_0002600_17_748 214
2 3300053084 Ga0495595_0356251 Ga0495595_0356251_47_724 214
3 3300060353 Ga0501082_0147036 Ga0501082_0147036_1212_1961 216
4 3300014968 Ga0157379_10312185 Ga0157379_103121851 219
5 3300050507 nmdc:mga05p37_210744_c1 nmdc:mga05p37_210744_c1_1529_2245 219
6 3300046500 Ga0495596_0040638 Ga0495596_0040638_866_1579 222
7 3300005983 Ga0081540_1001034 Ga0081540_100103414 225
8 3300006846 Ga0075430_100000015 Ga0075430_10000001530 225
9 3300049572 Ga0501036_0290382 Ga0501036_0290382_473_1183 225
10 3300049591 Ga0501075_0124913 Ga0501075_0124913_337_1047 225
11 3300049824 Ga0501045_0637183 Ga0501045_0637183_40_750 225
12 3300050509 nmdc:mga0qj67_60_c1 nmdc:mga0qj67_60_c1_13846_14556 225
13 3300001977 JGI24746J21847_1007293 JGI24746J21847_10072932 226
14 3300002076 JGI24749J21850_1003378 JGI24749J21850_10033782 226
15 3300002077 JGI24744J21845_10005049 JGI24744J21845_100050494 226
16 3300002239 JGI24034J26672_10010157 JGI24034J26672_100101572 226
17 3300002244 JGI24742J22300_10032776 JGI24742J22300_100327761 226
18 3300003322 rootL2_10107034 rootL2_101070341 226
19 3300005328 Ga0070676_10028756 Ga0070676_100287562 226
20 3300005329 Ga0070683_100175249 Ga0070683_1001752491 226
21 3300005330 Ga0070690_100214828 Ga0070690_1002148282 226
22 3300005331 Ga0070670_100148073 Ga0070670_1001480732 226
23 3300005334 Ga0068869_100062305 Ga0068869_1000623052 226
24 3300005335 Ga0070666_10064432 Ga0070666_100644323 226
25 3300005337 Ga0070682_100118641 Ga0070682_1001186412 226
26 3300005338 Ga0068868_100012622 Ga0068868_1000126222 226
27 3300005339 Ga0070660_100105337 Ga0070660_1001053372 226
28 3300005340 Ga0070689_100011988 Ga0070689_1000119886 226
29 3300005343 Ga0070687_100008637 Ga0070687_1000086371 226
30 3300005353 Ga0070669_100416016 Ga0070669_1004160161 226
31 3300005354 Ga0070675_100006738 Ga0070675_10000673810 226
32 3300005355 Ga0070671_100005864 Ga0070671_1000058642 226
33 3300005356 Ga0070674_100066196 Ga0070674_1000661963 226
34 3300005364 Ga0070673_100015427 Ga0070673_1000154275 226
35 3300005365 Ga0070688_100138048 Ga0070688_1001380482 226
36 3300005436 Ga0070713_100071856 Ga0070713_1000718563 226
37 3300005438 Ga0070701_10026158 Ga0070701_100261582 226
38 3300005438 Ga0070701_10197957 Ga0070701_101979571 226
39 3300005441 Ga0070700_100549779 Ga0070700_1005497791 226
40 3300005444 Ga0070694_100149245 Ga0070694_1001492451 226
41 3300005455 Ga0070663_100025158 Ga0070663_1000251582 226
42 3300005458 Ga0070681_10155735 Ga0070681_101557352 226
43 3300005459 Ga0068867_100137511 Ga0068867_1001375111 226
44 3300005466 Ga0070685_10011432 Ga0070685_100114321 226
45 3300005530 Ga0070679_100082703 Ga0070679_1000827033 226
46 3300005535 Ga0070684_100023458 Ga0070684_1000234584 226
47 3300005535 Ga0070684_100034563 Ga0070684_1000345632 226
48 3300005536 Ga0070697_100030782 Ga0070697_1000307823 226
49 3300005543 Ga0070672_100055964 Ga0070672_1000559642 226
50 3300005543 Ga0070672_100108906 Ga0070672_1001089061 226
51 3300005543 Ga0070672_100521790 Ga0070672_1005217901 226
52 3300005544 Ga0070686_100007036 Ga0070686_1000070363 226
53 3300005544 Ga0070686_100054622 Ga0070686_1000546222 226
54 3300005544 Ga0070686_100511215 Ga0070686_1005112151 226
55 3300005545 Ga0070695_100015879 Ga0070695_1000158796 226
56 3300005545 Ga0070695_100202600 Ga0070695_1002026002 226
57 3300005545 Ga0070695_100374040 Ga0070695_1003740402 226
58 3300005546 Ga0070696_100014043 Ga0070696_1000140432 226
59 3300005546 Ga0070696_100326199 Ga0070696_1003261992 226
60 3300005548 Ga0070665_100494777 Ga0070665_1004947772 226
61 3300005549 Ga0070704_100013544 Ga0070704_1000135446 226
62 3300005564 Ga0070664_100009979 Ga0070664_1000099795 226
63 3300005614 Ga0068856_100081475 Ga0068856_1000814751 226
64 3300005615 Ga0070702_100001377 Ga0070702_10000137710 226
65 3300005616 Ga0068852_100168443 Ga0068852_1001684433 226
66 3300005617 Ga0068859_100104866 Ga0068859_1001048663 226
67 3300005617 Ga0068859_100346699 Ga0068859_1003466992 226
68 3300005618 Ga0068864_100014555 Ga0068864_1000145552 226
69 3300005719 Ga0068861_100130493 Ga0068861_1001304931 226
70 3300005834 Ga0068851_10060705 Ga0068851_100607052 226
71 3300005840 Ga0068870_10068366 Ga0068870_100683663 226
72 3300005840 Ga0068870_10381819 Ga0068870_103818191 226
73 3300005841 Ga0068863_100111493 Ga0068863_1001114933 226
74 3300005841 Ga0068863_100729415 Ga0068863_1007294152 226
75 3300005842 Ga0068858_100019000 Ga0068858_1000190005 226
76 3300005842 Ga0068858_100301378 Ga0068858_1003013782 226
77 3300005843 Ga0068860_100010168 Ga0068860_1000101685 226
78 3300005843 Ga0068860_100272686 Ga0068860_1002726861 226
79 3300005937 Ga0081455_10011443 Ga0081455_100114439 226
80 3300005937 Ga0081455_10052942 Ga0081455_100529422 226
81 3300005937 Ga0081455_10063357 Ga0081455_100633572 226
82 3300005937 Ga0081455_10202816 Ga0081455_102028162 226
83 3300005981 Ga0081538_10034597 Ga0081538_100345973 226
84 3300005983 Ga0081540_1002311 Ga0081540_100231116 226
85 3300005983 Ga0081540_1016614 Ga0081540_10166142 226
86 3300006028 Ga0070717_10583148 Ga0070717_105831482 226
87 3300006038 Ga0075365_10020587 Ga0075365_100205873 226
88 3300006051 Ga0075364_10018750 Ga0075364_100187505 226
89 3300006051 Ga0075364_10075285 Ga0075364_100752852 226
90 3300006163 Ga0070715_10005422 Ga0070715_100054222 226
91 3300006173 Ga0070716_100021024 Ga0070716_1000210242 226
92 3300006175 Ga0070712_100463352 Ga0070712_1004633521 226
93 3300006177 Ga0075362_10016281 Ga0075362_100162813 226
94 3300006178 Ga0075367_10076487 Ga0075367_100764872 226
95 3300006186 Ga0075369_10009394 Ga0075369_100093944 226
96 3300006195 Ga0075366_10048536 Ga0075366_100485361 226
97 3300006195 Ga0075366_10072707 Ga0075366_100727072 226
98 3300006237 Ga0097621_100106537 Ga0097621_1001065373 226
99 3300006237 Ga0097621_100123408 Ga0097621_1001234083 226
100 3300006353 Ga0075370_10065307 Ga0075370_100653072 226
101 3300006358 Ga0068871_100199337 Ga0068871_1001993372 226
102 3300006844 Ga0075428_100444680 Ga0075428_1004446802 226
103 3300006846 Ga0075430_100002472 Ga0075430_10000247214 226
104 3300006847 Ga0075431_100084357 Ga0075431_1000843572 226
105 3300006847 Ga0075431_100106374 Ga0075431_1001063743 226
106 3300006852 Ga0075433_10006324 Ga0075433_100063247 226
107 3300006852 Ga0075433_10484008 Ga0075433_104840082 226
108 3300006871 Ga0075434_100036001 Ga0075434_1000360012 226
109 3300006871 Ga0075434_100115118 Ga0075434_1001151183 226
110 3300006880 Ga0075429_100033803 Ga0075429_1000338033 226
111 3300006880 Ga0075429_100049619 Ga0075429_1000496192 226
112 3300006881 Ga0068865_100007886 Ga0068865_1000078868 226
113 3300006914 Ga0075436_100001731 Ga0075436_1000017314 226
114 3300006931 Ga0097620_100104869 Ga0097620_1001048693 226
115 3300006931 Ga0097620_100346690 Ga0097620_1003466902 226
116 3300007076 Ga0075435_100175665 Ga0075435_1001756652 226
117 3300009036 Ga0105244_10075130 Ga0105244_100751301 226
118 3300009094 Ga0111539_10127047 Ga0111539_101270473 226
119 3300009094 Ga0111539_10600554 Ga0111539_106005542 226
120 3300009098 Ga0105245_10027869 Ga0105245_100278692 226
121 3300009098 Ga0105245_10747403 Ga0105245_107474032 226
122 3300009101 Ga0105247_10046830 Ga0105247_100468303 226
123 3300009147 Ga0114129_10027820 Ga0114129_100278205 226
124 3300009147 Ga0114129_10178275 Ga0114129_101782752 226
125 3300009147 Ga0114129_11033519 Ga0114129_110335191 226
126 3300009147 Ga0114129_11220788 Ga0114129_112207881 226
127 3300009148 Ga0105243_10038873 Ga0105243_100388734 226
128 3300009174 Ga0105241_10813483 Ga0105241_108134832 226
129 3300009174 Ga0105241_10825622 Ga0105241_108256221 226
130 3300009176 Ga0105242_10240019 Ga0105242_102400192 226
131 3300009176 Ga0105242_10359383 Ga0105242_103593831 226
132 3300009177 Ga0105248_10382853 Ga0105248_103828532 226
133 3300009545 Ga0105237_10025992 Ga0105237_100259926 226
134 3300009553 Ga0105249_10000711 Ga0105249_1000071130 226
135 3300009553 Ga0105249_10008451 Ga0105249_100084515 226
136 3300009553 Ga0105249_10857926 Ga0105249_108579262 226
137 3300011119 Ga0105246_10216592 Ga0105246_102165921 226
138 3300013306 Ga0163162_10059098 Ga0163162_100590984 226
139 3300013306 Ga0163162_10092036 Ga0163162_100920363 226
140 3300013306 Ga0163162_10307088 Ga0163162_103070881 226
141 3300014325 Ga0163163_10046009 Ga0163163_100460096 226
142 3300014325 Ga0163163_10168348 Ga0163163_101683483 226
143 3300014326 Ga0157380_10062422 Ga0157380_100624224 226
144 3300014326 Ga0157380_10352890 Ga0157380_103528902 226
145 3300014326 Ga0157380_10817166 Ga0157380_108171661 226
146 3300014745 Ga0157377_10019360 Ga0157377_100193604 226
147 3300014969 Ga0157376_10016909 Ga0157376_100169095 226
148 3300014969 Ga0157376_10089850 Ga0157376_100898502 226
149 3300014969 Ga0157376_10425761 Ga0157376_104257612 226
150 3300015262 Ga0182007_10032901 Ga0182007_100329012 226
151 3300021384 Ga0213876_10050293 Ga0213876_100502932 226
152 3300025297 Ga0209758_1000925 Ga0209758_100092512 226
153 3300025898 Ga0207692_10030366 Ga0207692_100303663 226
154 3300025900 Ga0207710_10013235 Ga0207710_100132354 226
155 3300025900 Ga0207710_10127230 Ga0207710_101272301 226
156 3300025901 Ga0207688_10000344 Ga0207688_1000034412 226
157 3300025903 Ga0207680_10025638 Ga0207680_100256382 226
158 3300025904 Ga0207647_10022214 Ga0207647_100222142 226
159 3300025905 Ga0207685_10180437 Ga0207685_101804372 226
160 3300025907 Ga0207645_10013416 Ga0207645_100134165 226
161 3300025907 Ga0207645_10064763 Ga0207645_100647632 226
162 3300025908 Ga0207643_10163716 Ga0207643_101637161 226
163 3300025911 Ga0207654_10386203 Ga0207654_103862031 226
164 3300025912 Ga0207707_10239070 Ga0207707_102390702 226
165 3300025914 Ga0207671_10482324 Ga0207671_104823241 226
166 3300025915 Ga0207693_10033192 Ga0207693_100331924 226
167 3300025916 Ga0207663_10217334 Ga0207663_102173342 226
168 3300025918 Ga0207662_10026057 Ga0207662_100260574 226
169 3300025919 Ga0207657_10022265 Ga0207657_100222654 226
170 3300025919 Ga0207657_10024392 Ga0207657_100243923 226
171 3300025921 Ga0207652_10060020 Ga0207652_100600202 226
172 3300025924 Ga0207694_10722226 Ga0207694_107222261 226
173 3300025925 Ga0207650_10001141 Ga0207650_100011414 226
174 3300025926 Ga0207659_10063346 Ga0207659_100633463 226
175 3300025926 Ga0207659_10485015 Ga0207659_104850152 226
176 3300025927 Ga0207687_10024211 Ga0207687_100242113 226
177 3300025928 Ga0207700_10011687 Ga0207700_100116876 226
178 3300025928 Ga0207700_10106776 Ga0207700_101067763 226
179 3300025929 Ga0207664_10082568 Ga0207664_100825682 226
180 3300025929 Ga0207664_10094416 Ga0207664_100944161 226
181 3300025931 Ga0207644_10014875 Ga0207644_100148754 226
182 3300025931 Ga0207644_10034959 Ga0207644_100349592 226
183 3300025933 Ga0207706_10004119 Ga0207706_1000411914 226
184 3300025934 Ga0207686_10023561 Ga0207686_100235612 226
185 3300025934 Ga0207686_10115683 Ga0207686_101156832 226
186 3300025935 Ga0207709_10021135 Ga0207709_100211355 226
187 3300025935 Ga0207709_10221616 Ga0207709_102216162 226
188 3300025936 Ga0207670_10010975 Ga0207670_100109752 226
189 3300025936 Ga0207670_10062814 Ga0207670_100628142 226
190 3300025936 Ga0207670_10193602 Ga0207670_101936022 226
191 3300025937 Ga0207669_10040350 Ga0207669_100403502 226
192 3300025937 Ga0207669_10050237 Ga0207669_100502372 226
193 3300025938 Ga0207704_10061505 Ga0207704_100615051 226
194 3300025939 Ga0207665_10035161 Ga0207665_100351612 226
195 3300025940 Ga0207691_10016132 Ga0207691_100161328 226
196 3300025940 Ga0207691_10080795 Ga0207691_100807951 226
197 3300025940 Ga0207691_10428055 Ga0207691_104280552 226
198 3300025941 Ga0207711_10010900 Ga0207711_100109005 226
199 3300025941 Ga0207711_10046016 Ga0207711_100460163 226
200 3300025942 Ga0207689_10010387 Ga0207689_100103875 226
201 3300025945 Ga0207679_10279270 Ga0207679_102792702 226
202 3300025960 Ga0207651_10141408 Ga0207651_101414081 226
203 3300025961 Ga0207712_10011604 Ga0207712_100116044 226
204 3300025972 Ga0207668_10316628 Ga0207668_103166282 226
205 3300025972 Ga0207668_10648045 Ga0207668_106480451 226
206 3300025986 Ga0207658_10009317 Ga0207658_100093173 226
207 3300025986 Ga0207658_10130232 Ga0207658_101302322 226
208 3300026023 Ga0207677_10001708 Ga0207677_100017084 226
209 3300026023 Ga0207677_10188079 Ga0207677_101880792 226
210 3300026035 Ga0207703_10007814 Ga0207703_100078147 226
211 3300026041 Ga0207639_10055275 Ga0207639_100552754 226
212 3300026067 Ga0207678_10008970 Ga0207678_100089703 226
213 3300026075 Ga0207708_10002952 Ga0207708_1000295212 226
214 3300026075 Ga0207708_10190699 Ga0207708_101906991 226
215 3300026078 Ga0207702_10087780 Ga0207702_100877801 226
216 3300026088 Ga0207641_10030974 Ga0207641_100309742 226
217 3300026088 Ga0207641_10493696 Ga0207641_104936962 226
218 3300026089 Ga0207648_10006335 Ga0207648_1000633510 226
219 3300026089 Ga0207648_10127201 Ga0207648_101272011 226
220 3300026095 Ga0207676_10001967 Ga0207676_100019672 226
221 3300026095 Ga0207676_10065350 Ga0207676_100653503 226
222 3300026095 Ga0207676_10384735 Ga0207676_103847352 226
223 3300026116 Ga0207674_10063071 Ga0207674_100630714 226
224 3300026118 Ga0207675_100014775 Ga0207675_1000147755 226
225 3300026118 Ga0207675_100216869 Ga0207675_1002168692 226
226 3300026121 Ga0207683_10368135 Ga0207683_103681352 226
227 3300026142 Ga0207698_10039460 Ga0207698_100394603 226
228 3300027907 Ga0207428_10038474 Ga0207428_100384742 226
229 3300028381 Ga0268264_10007811 Ga0268264_100078115 226
230 3300031242 Ga0265329_10056018 Ga0265329_100560181 226
231 3300031247 Ga0265340_10000573 Ga0265340_1000057317 226
232 3300031249 Ga0265339_10001994 Ga0265339_100019946 226
233 3300031250 Ga0265331_10015506 Ga0265331_100155062 226
234 3300031344 Ga0265316_10080682 Ga0265316_100806822 226
235 3300031665 Ga0316575_10023815 Ga0316575_100238152 226
236 3300031691 Ga0316579_10247164 Ga0316579_102471641 226
237 3300031711 Ga0265314_10084309 Ga0265314_100843092 226
238 3300031712 Ga0265342_10000175 Ga0265342_1000017524 226
239 3300034820 Ga0373959_0032958 Ga0373959_0032958_248_961 226
240 3300035084 Ga0373928_0027783 Ga0373928_0027783_507_1220 226
241 3300035086 Ga0373934_0054274 Ga0373934_0054274_637_1407 226
242 3300035111 Ga0373923_0000038 Ga0373923_0000038_7201_7968 226
243 3300035113 Ga0373936_0004827 Ga0373936_0004827_2850_3617 226
244 3300035113 Ga0373936_0031400 Ga0373936_0031400_1295_2056 226
245 3300035115 Ga0373941_0184340 Ga0373941_0184340_62_775 226
246 3300035116 Ga0373945_0005100 Ga0373945_0005100_1012_1725 226
247 3300035116 Ga0373945_0047677 Ga0373945_0047677_492_1259 226
248 3300035117 Ga0373953_0007624 Ga0373953_0007624_170_937 226
249 3300035118 Ga0373954_0001191 Ga0373954_0001191_1783_2550 226
250 3300035119 Ga0373956_0056181 Ga0373956_0056181_835_1602 226
251 3300035120 Ga0373957_0014910 Ga0373957_0014910_183_950 226
252 3300035121 Ga0373960_0032277 Ga0373960_0032277_88_801 226
253 3300035170 Ga0373943_0003464 Ga0373943_0003464_3670_4383 226
254 3300035171 Ga0373946_0001741 Ga0373946_0001741_2177_2890 226
255 3300035171 Ga0373946_0007686 Ga0373946_0007686_2103_2870 226
256 3300035172 Ga0373955_0000211 Ga0373955_0000211_2205_2972 226
257 3300035207 Ga0373942_0029202 Ga0373942_0029202_455_1168 226
258 3300035241 Ga0373961_0045001 Ga0373961_0045001_545_1258 226
259 3300035242 Ga0373962_0093001 Ga0373962_0093001_84_797 226
260 3300035410 Ga0373924_0005832 Ga0373924_0005832_2134_2901 226
261 3300035691 Ga0373931_0008781 Ga0373931_0008781_3611_4357 226
262 3300035691 Ga0373931_0113690 Ga0373931_0113690_426_1139 226
263 3300035692 Ga0373935_0000189 Ga0373935_0000189_20_787 226
264 3300035692 Ga0373935_0016441 Ga0373935_0016441_1067_1780 226
265 3300035692 Ga0373935_0033071 Ga0373935_0033071_1936_2652 226
266 3300035692 Ga0373935_0089708 Ga0373935_0089708_1261_1974 226
267 3300035692 Ga0373935_0281329 Ga0373935_0281329_219_932 226
268 3300035695 Ga0373927_0009208 Ga0373927_0009208_5589_6302 226
269 3300035695 Ga0373927_0011842 Ga0373927_0011842_2164_2931 226
270 3300035695 Ga0373927_0060671 Ga0373927_0060671_405_1118 226
271 3300035695 Ga0373927_0122288 Ga0373927_0122288_268_981 226
272 3300035695 Ga0373927_0296889 Ga0373927_0296889_127_840 226
273 3300035724 Ga0373933_0004328 Ga0373933_0004328_5173_5940 226
274 3300035725 Ga0373947_0004910 Ga0373947_0004910_4514_5227 226
275 3300035725 Ga0373947_0015833 Ga0373947_0015833_531_1298 226
276 3300036401 Ga0373937_0000009 Ga0373937_0000009_47634_48401 226
277 3300036401 Ga0373937_0343420 Ga0373937_0343420_590_1366 226
278 3300037068 Ga0373925_0000194 Ga0373925_0000194_63797_64564 226
279 3300037068 Ga0373925_0013924 Ga0373925_0013924_4021_4734 226
280 3300037068 Ga0373925_0090176 Ga0373925_0090176_1349_2062 226
281 3300038443 Ga0395901_0471276 Ga0395901_0471276_64_777 226
282 3300039437 Ga0436365_1088661 Ga0436365_1088661_982_1695 226
283 3300039450 Ga0436363_0991563 Ga0436363_0991563_4068_4781 226
284 3300046452 Ga0495617_120876 Ga0495617_120876_19_732 226
285 3300046453 Ga0495627_086082 Ga0495627_086082_74_787 226
286 3300046454 Ga0495592_0000422 Ga0495592_0000422_14653_15420 226
287 3300046454 Ga0495592_0142588 Ga0495592_0142588_388_1101 226
288 3300046455 Ga0495603_0110159 Ga0495603_0110159_418_1131 226
289 3300046459 Ga0495629_0004190 Ga0495629_0004190_22_789 226
290 3300046461 Ga0495641_0005591 Ga0495641_0005591_4327_5040 226
291 3300046462 Ga0495651_0000300 Ga0495651_0000300_23790_24557 226
292 3300046462 Ga0495651_0119948 Ga0495651_0119948_432_1145 226
293 3300046463 Ga0495653_0000032 Ga0495653_0000032_16835_17602 226
294 3300046463 Ga0495653_0181475 Ga0495653_0181475_117_830 226
295 3300046473 Ga0495582_0001274 Ga0495582_0001274_6760_7473 226
296 3300046473 Ga0495582_0180537 Ga0495582_0180537_285_1052 226
297 3300046474 Ga0495605_0056685 Ga0495605_0056685_840_1559 226
298 3300046476 Ga0495662_0017803 Ga0495662_0017803_1184_1900 226
299 3300046476 Ga0495662_0031285 Ga0495662_0031285_1580_2347 226
300 3300046477 Ga0495664_0000010 Ga0495664_0000010_220110_220877 226
301 3300046477 Ga0495664_0166814 Ga0495664_0166814_425_1138 226
302 3300046491 Ga0495584_0003670 Ga0495584_0003670_5460_6173 226
303 3300046492 Ga0495585_0140006 Ga0495585_0140006_415_1128 226
304 3300046499 Ga0495594_0006899 Ga0495594_0006899_4536_5249 226
305 3300046511 Ga0495608_0000008 Ga0495608_0000008_47772_48539 226
306 3300046511 Ga0495608_0503104 Ga0495608_0503104_11_724 226
307 3300046514 Ga0495618_0000002 Ga0495618_0000002_222383_223150 226
308 3300046516 Ga0495628_0000009 Ga0495628_0000009_220138_220905 226
309 3300046516 Ga0495628_0434755 Ga0495628_0434755_222_935 226
310 3300046517 Ga0495630_0002397 Ga0495630_0002397_8136_8903 226
311 3300046517 Ga0495630_0411605 Ga0495630_0411605_241_960 226
312 3300046529 Ga0495652_0000011 Ga0495652_0000011_47462_48229 226
313 3300046529 Ga0495652_0214199 Ga0495652_0214199_670_1383 226
314 3300046531 Ga0495665_0120431 Ga0495665_0120431_594_1307 226
315 3300046533 Ga0495640_0000094 Ga0495640_0000094_47462_48229 226
316 3300046533 Ga0495640_0086556 Ga0495640_0086556_1204_1920 226
317 3300046533 Ga0495640_0202528 Ga0495640_0202528_401_1114 226
318 3300046536 Ga0495587_0000086 Ga0495587_0000086_23801_24568 226
319 3300046537 Ga0495598_0157460 Ga0495598_0157460_50_763 226
320 3300046543 Ga0495645_0000010 Ga0495645_0000010_16835_17602 226
321 3300046543 Ga0495645_0237115 Ga0495645_0237115_300_1013 226
322 3300046559 Ga0495667_0000005 Ga0495667_0000005_220138_220905 226
323 3300046615 Ga0495656_0047232 Ga0495656_0047232_223_936 226
324 3300046642 Ga0495634_0000223 Ga0495634_0000223_3104_3871 226
325 3300046663 Ga0495635_0000008 Ga0495635_0000008_47445_48212 226
326 3300046675 Ga0495657_0000058 Ga0495657_0000058_2198_2965 226
327 3300046678 Ga0495599_0000007 Ga0495599_0000007_47462_48229 226
328 3300046678 Ga0495599_0306943 Ga0495599_0306943_195_908 226
329 3300046679 Ga0495623_0000085 Ga0495623_0000085_41210_41977 226
330 3300046680 Ga0495646_0000021 Ga0495646_0000021_47417_48184 226
331 3300046683 Ga0495658_0024042 Ga0495658_0024042_1028_1741 226
332 3300046683 Ga0495658_0135165 Ga0495658_0135165_105_872 226
333 3300046684 Ga0495669_0092994 Ga0495669_0092994_454_1167 226
334 3300046689 Ga0495613_0020157 Ga0495613_0020157_3045_3812 226
335 3300046689 Ga0495613_0103187 Ga0495613_0103187_356_1069 226
336 3300046690 Ga0495624_0008312 Ga0495624_0008312_3122_3835 226
337 3300046692 Ga0495671_0102996 Ga0495671_0102996_74_787 226
338 3300046809 Ga0495600_0000001 Ga0495600_0000001_47462_48229 226
339 3300047317 Ga0495604_0000012 Ga0495604_0000012_220125_220892 226
340 3300047319 Ga0495674_0000011 Ga0495674_0000011_222411_223178 226
341 3300047319 Ga0495674_0297944 Ga0495674_0297944_363_1076 226
342 3300047321 Ga0495676_0017745 Ga0495676_0017745_4002_4715 226
343 3300047322 Ga0495680_0000245 Ga0495680_0000245_23829_24596 226
344 3300047444 Ga0495675_0002083 Ga0495675_0002083_4130_4897 226
345 3300047444 Ga0495675_0177297 Ga0495675_0177297_470_1183 226
346 3300047470 Ga0495681_0163997 Ga0495681_0163997_34_747 226
347 3300047471 Ga0495684_0000084 Ga0495684_0000084_47999_48766 226
348 3300047673 Ga0495593_0000733 Ga0495593_0000733_3060_3827 226
349 3300047673 Ga0495593_0249963 Ga0495593_0249963_12_788 226
350 3300048088 Ga0495602_0000073 Ga0495602_0000073_47445_48212 226
351 3300048903 Ga0496100_0002178 Ga0496100_0002178_3881_4594 226
352 3300048903 Ga0496100_0094057 Ga0496100_0094057_803_1516 226
353 3300048903 Ga0496100_0104996 Ga0496100_0104996_527_1240 226
354 3300048903 Ga0496100_0111865 Ga0496100_0111865_1060_1773 226
355 3300048904 Ga0496101_0003990 Ga0496101_0003990_5171_5884 226
356 3300048904 Ga0496101_0095326 Ga0496101_0095326_1331_2044 226
357 3300048905 Ga0496102_0000871 Ga0496102_0000871_12562_13275 226
358 3300048905 Ga0496102_0010266 Ga0496102_0010266_4561_5274 226
359 3300048906 Ga0496103_0003369 Ga0496103_0003369_549_1262 226
360 3300048906 Ga0496103_0003600 Ga0496103_0003600_1601_2314 226
361 3300048906 Ga0496103_0313909 Ga0496103_0313909_188_901 226
362 3300048906 Ga0496103_0447325 Ga0496103_0447325_13_726 226
363 3300048907 Ga0496104_0000445 Ga0496104_0000445_4592_5305 226
364 3300048907 Ga0496104_0000880 Ga0496104_0000880_5354_6067 226
365 3300048907 Ga0496104_0002378 Ga0496104_0002378_14328_15041 226
366 3300048907 Ga0496104_0005871 Ga0496104_0005871_5569_6282 226
367 3300048907 Ga0496104_0164149 Ga0496104_0164149_544_1290 226
368 3300048908 Ga0496105_0000514 Ga0496105_0000514_21117_21830 226
369 3300048908 Ga0496105_0006690 Ga0496105_0006690_4126_4839 226
370 3300048908 Ga0496105_0080877 Ga0496105_0080877_362_1075 226
371 3300048908 Ga0496105_0088570 Ga0496105_0088570_1270_1983 226
372 3300048909 Ga0496106_0007908 Ga0496106_0007908_2538_3251 226
373 3300048909 Ga0496106_0061247 Ga0496106_0061247_93_806 226
374 3300048909 Ga0496106_0141897 Ga0496106_0141897_123_836 226
375 3300048909 Ga0496106_0319960 Ga0496106_0319960_88_801 226
376 3300048910 Ga0496107_0000769 Ga0496107_0000769_5981_6694 226
377 3300048910 Ga0496107_0060279 Ga0496107_0060279_268_981 226
378 3300048910 Ga0496107_0297076 Ga0496107_0297076_423_1169 226
379 3300048911 Ga0496108_0003421 Ga0496108_0003421_282_995 226
380 3300048911 Ga0496108_0005851 Ga0496108_0005851_3743_4456 226
381 3300048911 Ga0496108_0442487 Ga0496108_0442487_131_844 226
382 3300048911 Ga0496108_0452102 Ga0496108_0452102_359_1072 226
383 3300048912 Ga0496109_0002011 Ga0496109_0002011_8906_9619 226
384 3300048912 Ga0496109_0046860 Ga0496109_0046860_3137_3850 226
385 3300048912 Ga0496109_0601801 Ga0496109_0601801_297_1010 226
386 3300048912 Ga0496109_0982848 Ga0496109_0982848_55_768 226
387 3300048913 Ga0496110_0002034 Ga0496110_0002034_5853_6566 226
388 3300048913 Ga0496110_0012856 Ga0496110_0012856_2292_3005 226
389 3300048913 Ga0496110_0175660 Ga0496110_0175660_151_864 226
390 3300048913 Ga0496110_0550176 Ga0496110_0550176_80_793 226
391 3300048914 Ga0496111_0000072 Ga0496111_0000072_14586_15299 226
392 3300048914 Ga0496111_0000641 Ga0496111_0000641_6274_6987 226
393 3300048915 Ga0496112_0000112 Ga0496112_0000112_12083_12796 226
394 3300048915 Ga0496112_0009026 Ga0496112_0009026_7737_8450 226
395 3300048916 Ga0496113_0000058 Ga0496113_0000058_29100_29813 226
396 3300048916 Ga0496113_0001260 Ga0496113_0001260_4638_5351 226
397 3300048916 Ga0496113_0032424 Ga0496113_0032424_1917_2630 226
398 3300048916 Ga0496113_0242153 Ga0496113_0242153_149_862 226
399 3300048916 Ga0496113_0646119 Ga0496113_0646119_10_723 226
400 3300048917 Ga0496114_0016624 Ga0496114_0016624_624_1337 226
401 3300048917 Ga0496114_0017394 Ga0496114_0017394_1259_1972 226
402 3300048917 Ga0496114_0260038 Ga0496114_0260038_341_1054 226
403 3300048917 Ga0496114_0377686 Ga0496114_0377686_329_1042 226
404 3300048918 Ga0496115_0013126 Ga0496115_0013126_3101_3814 226
405 3300048918 Ga0496115_0022047 Ga0496115_0022047_2951_3664 226
406 3300048918 Ga0496115_0055864 Ga0496115_0055864_1707_2420 226
407 3300048918 Ga0496115_0066392 Ga0496115_0066392_255_968 226
408 3300049575 Ga0501039_0365910 Ga0501039_0365910_116_832 226
409 3300049576 Ga0501040_0254894 Ga0501040_0254894_342_1055 226
410 3300049587 Ga0501071_0401230 Ga0501071_0401230_52_765 226
411 3300049588 Ga0501072_0086528 Ga0501072_0086528_799_1512 226
412 3300049588 Ga0501072_0140284 Ga0501072_0140284_1105_1821 226
413 3300049589 Ga0501073_0233707 Ga0501073_0233707_62_778 226
414 3300049590 Ga0501074_0305981 Ga0501074_0305981_13_726 226
415 3300049591 Ga0501075_0147293 Ga0501075_0147293_32_745 226
416 3300049741 Ga0501079_0220169 Ga0501079_0220169_719_1432 226
417 3300049741 Ga0501079_0484858 Ga0501079_0484858_147_860 226
418 3300049742 Ga0501080_0079145 Ga0501080_0079145_70_786 226
419 3300049743 Ga0501081_0093692 Ga0501081_0093692_1355_2068 226
420 3300049743 Ga0501081_0143487 Ga0501081_0143487_517_1230 226
421 3300050489 nmdc:mga03683_14426_c1 nmdc:mga03683_14426_c1_2104_2817 226
422 3300050490 nmdc:mga03n38_34639_c1 nmdc:mga03n38_34639_c1_607_1329 226
423 3300050491 nmdc:mga00v17_42897_c1 nmdc:mga00v17_42897_c1_1646_2359 226
424 3300050492 nmdc:mga0yw44_271252_c1 nmdc:mga0yw44_271252_c1_148_861 226
425 3300050492 nmdc:mga0yw44_501_c1 nmdc:mga0yw44_501_c1_575_1288 226
426 3300050492 nmdc:mga0yw44_8423_c1 nmdc:mga0yw44_8423_c1_4312_5025 226
427 3300050493 nmdc:mga0k408_18592_c1 nmdc:mga0k408_18592_c1_1401_2114 226
428 3300050493 nmdc:mga0k408_333725_c1 nmdc:mga0k408_333725_c1_20_742 226
429 3300050493 nmdc:mga0k408_357889_c1 nmdc:mga0k408_357889_c1_43_756 226
430 3300050493 nmdc:mga0k408_73512_c1 nmdc:mga0k408_73512_c1_832_1545 226
431 3300050494 nmdc:mga06z11_23381_c1 nmdc:mga06z11_23381_c1_423_1145 226
432 3300050494 nmdc:mga06z11_67316_c1 nmdc:mga06z11_67316_c1_260_982 226
433 3300050495 nmdc:mga04h51_3760_c1 nmdc:mga04h51_3760_c1_1213_1935 226
434 3300050496 nmdc:mga07m45_30674_c1 nmdc:mga07m45_30674_c1_981_1703 226
435 3300050496 nmdc:mga07m45_63074_c1 nmdc:mga07m45_63074_c1_1124_1837 226
436 3300050507 nmdc:mga05p37_106824_c1 nmdc:mga05p37_106824_c1_1241_1990 226
437 3300050507 nmdc:mga05p37_40386_c1 nmdc:mga05p37_40386_c1_3012_3725 226
438 3300050507 nmdc:mga05p37_50472_c1 nmdc:mga05p37_50472_c1_3464_4177 226
439 3300050507 nmdc:mga05p37_853690_c1 nmdc:mga05p37_853690_c1_28_741 226
440 3300050508 nmdc:mga09592_21633_c1 nmdc:mga09592_21633_c1_3592_4341 226
441 3300050509 nmdc:mga0qj67_70370_c1 nmdc:mga0qj67_70370_c1_889_1638 226
442 3300050510 nmdc:mga06r32_29045_c1 nmdc:mga06r32_29045_c1_936_1649 226
443 3300050510 nmdc:mga06r32_290594_c1 nmdc:mga06r32_290594_c1_609_1322 226
444 3300050510 nmdc:mga06r32_56117_c1 nmdc:mga06r32_56117_c1_2987_3736 226
445 3300050511 nmdc:mga08y16_115077_c1 nmdc:mga08y16_115077_c1_957_1670 226
446 3300050511 nmdc:mga08y16_609216_c1 nmdc:mga08y16_609216_c1_41_754 226
447 3300050511 nmdc:mga08y16_718063_c1 nmdc:mga08y16_718063_c1_178_891 226
448 3300050512 nmdc:mga0n895_120457_c1 nmdc:mga0n895_120457_c1_477_1253 226
449 3300050512 nmdc:mga0n895_16977_c1 nmdc:mga0n895_16977_c1_4461_5219 226
450 3300050512 nmdc:mga0n895_26569_c1 nmdc:mga0n895_26569_c1_3614_4435 226
451 3300050512 nmdc:mga0n895_29161_c1 nmdc:mga0n895_29161_c1_1650_2363 226
452 3300050512 nmdc:mga0n895_78332_c1 nmdc:mga0n895_78332_c1_906_1619 226
453 3300050513 nmdc:mga0rr50_527385_c1 nmdc:mga0rr50_527385_c1_205_981 226
454 3300050514 nmdc:mga08x19_112578_c1 nmdc:mga08x19_112578_c1_1014_1790 226
455 3300050514 nmdc:mga08x19_39937_c1 nmdc:mga08x19_39937_c1_431_1201 226
456 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_324645_325358 226
457 3300050515 nmdc:mga0a205_19052_c1 nmdc:mga0a205_19052_c1_5175_5996 226
458 3300050515 nmdc:mga0a205_461170_c1 nmdc:mga0a205_461170_c1_234_947 226
459 3300053077 Ga0495601_0000009 Ga0495601_0000009_47445_48212 226
460 3300053077 Ga0495601_0064102 Ga0495601_0064102_849_1562 226
461 3300053077 Ga0495601_0117244 Ga0495601_0117244_617_1330 226
462 3300053077 Ga0495601_0199444 Ga0495601_0199444_202_915 226
463 3300053078 Ga0495612_0000019 Ga0495612_0000019_89616_90383 226
464 3300053078 Ga0495612_0020957 Ga0495612_0020957_1411_2124 226
465 3300053084 Ga0495595_0000015 Ga0495595_0000015_28700_29467 226
466 3300053084 Ga0495595_0030029 Ga0495595_0030029_889_1602 226
467 3300053084 Ga0495595_0109817 Ga0495595_0109817_510_1223 226
468 3300053085 Ga0495619_0000012 Ga0495619_0000012_47445_48212 226
469 3300053085 Ga0495619_0008018 Ga0495619_0008018_4548_5261 226
470 3300053085 Ga0495619_0037660 Ga0495619_0037660_1840_2553 226
471 3300053117 Ga0500593_002603 Ga0500593_002603_1074_1787 226
472 3300053130 Ga0500642_0211606 Ga0500642_0211606_72_785 226
473 3300053136 Ga0500559_0154682 Ga0500559_0154682_263_1024 226
474 3300054114 Ga0501084_0036290 Ga0501084_0036290_2574_3287 226
475 3300054114 Ga0501084_0037753 Ga0501084_0037753_378_1094 226
476 3300054114 Ga0501084_0383110 Ga0501084_0383110_155_868 226
477 3300060353 Ga0501082_0206020 Ga0501082_0206020_312_1028 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03749

SfsA

Sugar fermentation stimulation protein RE domain

86

218

0.92

PF17746

SfsA_N

SfsA N-terminal OB domain

13

83

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dap-assembly1.cif.gz_A the structure of escherichia coli sfsa 0.893 1 226
4dap-assembly1.cif.gz_A the structure of escherichia coli sfsa 0.8893 1 226
4da2-assembly1.cif.gz_A the structure of pyrococcus furiosus sfsa in complex with ca2+ 0.857 1 226
4da2-assembly1.cif.gz_A the structure of pyrococcus furiosus sfsa in complex with ca2+ 0.8534 1 226
2wg5-assembly1.cif.gz_A proteasome-activating nucleotidase (pan) n-domain (57-134) from archaeoglobus fulgidus fused to gcn4 0.7885 5 54
ID Description Score Start End Superfamily
4dapA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9599 94 226 3.40.1350.60
4davA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9184 100 226 3.40.1350.60
4dapA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9181 1 83 2.40.50.580
4dapA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9074 1 83 2.40.50.580
4dapA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8254 94 226 3.40.1350.60
ID Description Score Start End GO Terms
AF-A0A7C7JZE6-F1-model_v4 DNA/RNA nuclease SfsA 0.9857 123 226 GO:0003677
AF-A0A7C7FX38-F1-model_v4 DNA/RNA nuclease SfsA 0.9846 102 226 GO:0003677
AF-A0A3S4EF02-F1-model_v4 deleted 0.9845 137 225
AF-A0A7V0WM14-F1-model_v4 DNA/RNA nuclease SfsA 0.9843 94 226 GO:0003677
AF-A0A258ZPU7-F1-model_v4 Sugar fermentation stimulation protein SfsA 0.9843 100 226 GO:0003677

Feature Viewer

pLDDT pTM Quality
92.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map