F451709
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 477 | 293 | 477 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10312185|Ga0157379_103121851 |
| Length | 229 |
| Sequence | MRFPAPLIPATLIKRYKRFLADVTLPDGTAITAHVANPGAMTGLAAPGSRVWLSRSDNPSRKLSHSWELIEVDLGQGPELVGVNTAHPNPLVGTALAVGAFIRREVKYGKNSRVDFLLEGAGRPSCYVEIKNVHLMRQPGLAEFPDAKTERGRKHLDELGDMVEAGHRAVMLYLIQIGSATRFALARDIDPKYGAAFDRARARGVEAMAWRCVITRDGIEIATPVPMVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 159 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 191 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 290 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 291 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.87 |
| Nodule | 0 |
| Rhizoplane | 11.95 |
| Rhizosphere | 81.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1007293 | 3300001977 | Bacteria | 1695 |
| 2 | JGI24749J21850_1003378 | 3300002076 | Bacteria | 2233 |
| 3 | JGI24744J21845_10005049 | 3300002077 | Bacteria | 2728 |
| 4 | JGI24034J26672_10010157 | 3300002239 | Bacteria | 1395 |
| 5 | JGI24742J22300_10032776 | 3300002244 | Bacteria | 911 |
| 6 | rootL2_10107034 | 3300003322 | Bacteria | 1260 |
| 7 | Ga0070676_10028756 | 3300005328 | Bacteria | 3158 |
| 8 | Ga0070683_100175249 | 3300005329 | Bacteria | 2036 |
| 9 | Ga0070690_100214828 | 3300005330 | Bacteria | 1345 |
| 10 | Ga0070670_100148073 | 3300005331 | Bacteria | 2031 |
| 11 | Ga0068869_100062305 | 3300005334 | Bacteria | 2738 |
| 12 | Ga0070666_10064432 | 3300005335 | Bacteria | 2486 |
| 13 | Ga0070682_100118641 | 3300005337 | Bacteria | 1773 |
| 14 | Ga0068868_100012622 | 3300005338 | Bacteria | 6178 |
| 15 | Ga0070660_100105337 | 3300005339 | Bacteria | 2238 |
| 16 | Ga0070689_100011988 | 3300005340 | Bacteria | 6228 |
| 17 | Ga0070687_100008637 | 3300005343 | Bacteria | 4324 |
| 18 | Ga0070669_100416016 | 3300005353 | Bacteria | 1102 |
| 19 | Ga0070675_100006738 | 3300005354 | Bacteria | 8834 |
| 20 | Ga0070671_100005864 | 3300005355 | Bacteria | 9787 |
| 21 | Ga0070674_100066196 | 3300005356 | Bacteria | 2538 |
| 22 | Ga0070673_100015427 | 3300005364 | Bacteria | 5365 |
| 23 | Ga0070688_100138048 | 3300005365 | Bacteria | 1653 |
| 24 | Ga0070713_100071856 | 3300005436 | Bacteria | 2925 |
| 25 | Ga0070701_10026158 | 3300005438 | Bacteria | 2843 |
| 26 | Ga0070701_10197957 | 3300005438 | Bacteria | 1186 |
| 27 | Ga0070700_100549779 | 3300005441 | Bacteria | 897 |
| 28 | Ga0070694_100149245 | 3300005444 | Bacteria | 1706 |
| 29 | Ga0070663_100025158 | 3300005455 | Bacteria | 4017 |
| 30 | Ga0070681_10155735 | 3300005458 | Bacteria | 2210 |
| 31 | Ga0068867_100137511 | 3300005459 | Bacteria | 1906 |
| 32 | Ga0070685_10011432 | 3300005466 | Bacteria | 4646 |
| 33 | Ga0070679_100082703 | 3300005530 | Bacteria | 3200 |
| 34 | Ga0070684_100023458 | 3300005535 | Bacteria | 5162 |
| 35 | Ga0070684_100034563 | 3300005535 | Bacteria | 4322 |
| 36 | Ga0070697_100030782 | 3300005536 | Bacteria | 4313 |
| 37 | Ga0070672_100055964 | 3300005543 | Bacteria | 3092 |
| 38 | Ga0070672_100108906 | 3300005543 | Bacteria | 2256 |
| 39 | Ga0070672_100521790 | 3300005543 | Bacteria | 1029 |
| 40 | Ga0070686_100007036 | 3300005544 | Bacteria | 6271 |
| 41 | Ga0070686_100054622 | 3300005544 | Bacteria | 2556 |
| 42 | Ga0070686_100511215 | 3300005544 | Bacteria | 934 |
| 43 | Ga0070695_100015879 | 3300005545 | Bacteria | 4551 |
| 44 | Ga0070695_100202600 | 3300005545 | Bacteria | 1419 |
| 45 | Ga0070695_100374040 | 3300005545 | Bacteria | 1073 |
| 46 | Ga0070696_100014043 | 3300005546 | Bacteria | 5377 |
| 47 | Ga0070696_100326199 | 3300005546 | Unclassified | 1183 |
| 48 | Ga0070665_100494777 | 3300005548 | Bacteria | 1234 |
| 49 | Ga0070704_100013544 | 3300005549 | Bacteria | 5063 |
| 50 | Ga0070664_100009979 | 3300005564 | Bacteria | 7696 |
| 51 | Ga0068856_100081475 | 3300005614 | Bacteria | 3211 |
| 52 | Ga0070702_100001377 | 3300005615 | Bacteria | 9917 |
| 53 | Ga0068852_100168443 | 3300005616 | Bacteria | 2051 |
| 54 | Ga0068859_100104866 | 3300005617 | Bacteria | 2886 |
| 55 | Ga0068859_100346699 | 3300005617 | Bacteria | 1580 |
| 56 | Ga0068864_100014555 | 3300005618 | Bacteria | 6536 |
| 57 | Ga0068861_100130493 | 3300005719 | Bacteria | 2039 |
| 58 | Ga0068851_10060705 | 3300005834 | Bacteria | 1936 |
| 59 | Ga0068870_10068366 | 3300005840 | Bacteria | 1930 |
| 60 | Ga0068870_10381819 | 3300005840 | Bacteria | 912 |
| 61 | Ga0068863_100111493 | 3300005841 | Bacteria | 2605 |
| 62 | Ga0068863_100729415 | 3300005841 | Bacteria | 986 |
| 63 | Ga0068858_100019000 | 3300005842 | Bacteria | 6430 |
| 64 | Ga0068858_100301378 | 3300005842 | Bacteria | 1529 |
| 65 | Ga0068860_100010168 | 3300005843 | Bacteria | 9321 |
| 66 | Ga0068860_100272686 | 3300005843 | Bacteria | 1652 |
| 67 | Ga0081455_10011443 | 3300005937 | Bacteria | 8914 |
| 68 | Ga0081455_10052942 | 3300005937 | Bacteria | 3471 |
| 69 | Ga0081455_10063357 | 3300005937 | Bacteria | 3103 |
| 70 | Ga0081455_10202816 | 3300005937 | Bacteria | 1484 |
| 71 | Ga0081538_10034597 | 3300005981 | Bacteria | 3336 |
| 72 | Ga0081540_1001034 | 3300005983 | Bacteria | 24931 |
| 73 | Ga0081540_1002311 | 3300005983 | Bacteria | 15633 |
| 74 | Ga0081540_1016614 | 3300005983 | Bacteria | 4595 |
| 75 | Ga0070717_10583148 | 3300006028 | Bacteria | 1014 |
| 76 | Ga0075365_10020587 | 3300006038 | Bacteria | 4093 |
| 77 | Ga0075364_10018750 | 3300006051 | Bacteria | 4337 |
| 78 | Ga0075364_10075285 | 3300006051 | Bacteria | 2227 |
| 79 | Ga0070715_10005422 | 3300006163 | Bacteria | 4252 |
| 80 | Ga0070716_100021024 | 3300006173 | Bacteria | 3433 |
| 81 | Ga0070712_100463352 | 3300006175 | Bacteria | 1057 |
| 82 | Ga0075362_10016281 | 3300006177 | Bacteria | 3042 |
| 83 | Ga0075367_10076487 | 3300006178 | Bacteria | 2020 |
| 84 | Ga0075369_10009394 | 3300006186 | Bacteria | 3797 |
| 85 | Ga0075366_10048536 | 3300006195 | Bacteria | 2518 |
| 86 | Ga0075366_10072707 | 3300006195 | Bacteria | 2049 |
| 87 | Ga0097621_100106537 | 3300006237 | Bacteria | 2365 |
| 88 | Ga0097621_100123408 | 3300006237 | Bacteria | 2199 |
| 89 | Ga0075370_10065307 | 3300006353 | Bacteria | 2075 |
| 90 | Ga0068871_100199337 | 3300006358 | Bacteria | 1727 |
| 91 | Ga0075428_100444680 | 3300006844 | Bacteria | 1388 |
| 92 | Ga0075430_100000015 | 3300006846 | Bacteria | 89952 |
| 93 | Ga0075430_100002472 | 3300006846 | Bacteria | 15389 |
| 94 | Ga0075431_100084357 | 3300006847 | Bacteria | 3280 |
| 95 | Ga0075431_100106374 | 3300006847 | Bacteria | 2894 |
| 96 | Ga0075433_10006324 | 3300006852 | Bacteria | 9358 |
| 97 | Ga0075433_10484008 | 3300006852 | Bacteria | 1090 |
| 98 | Ga0075434_100036001 | 3300006871 | Bacteria | 4895 |
| 99 | Ga0075434_100115118 | 3300006871 | Bacteria | 2701 |
| 100 | Ga0075429_100033803 | 3300006880 | Bacteria | 4442 |
| 101 | Ga0075429_100049619 | 3300006880 | Bacteria | 3650 |
| 102 | Ga0068865_100007886 | 3300006881 | Bacteria | 6569 |
| 103 | Ga0075436_100001731 | 3300006914 | Bacteria | 14950 |
| 104 | Ga0097620_100104869 | 3300006931 | Bacteria | 2886 |
| 105 | Ga0097620_100346690 | 3300006931 | Bacteria | 1580 |
| 106 | Ga0075435_100175665 | 3300007076 | Bacteria | 1809 |
| 107 | Ga0105244_10075130 | 3300009036 | Bacteria | 1680 |
| 108 | Ga0111539_10127047 | 3300009094 | Bacteria | 2986 |
| 109 | Ga0111539_10600554 | 3300009094 | Bacteria | 1282 |
| 110 | Ga0105245_10027869 | 3300009098 | Bacteria | 4978 |
| 111 | Ga0105245_10747403 | 3300009098 | Bacteria | 1014 |
| 112 | Ga0105247_10046830 | 3300009101 | Bacteria | 2655 |
| 113 | Ga0114129_10027820 | 3300009147 | Bacteria | 8007 |
| 114 | Ga0114129_10178275 | 3300009147 | Bacteria | 2893 |
| 115 | Ga0114129_11033519 | 3300009147 | Bacteria | 1033 |
| 116 | Ga0114129_11220788 | 3300009147 | Unclassified | 936 |
| 117 | Ga0105243_10038873 | 3300009148 | Bacteria | 3708 |
| 118 | Ga0105241_10813483 | 3300009174 | Bacteria | 862 |
| 119 | Ga0105241_10825622 | 3300009174 | Bacteria | 855 |
| 120 | Ga0105242_10240019 | 3300009176 | Bacteria | 1629 |
| 121 | Ga0105242_10359383 | 3300009176 | Bacteria | 1347 |
| 122 | Ga0105248_10382853 | 3300009177 | Bacteria | 1584 |
| 123 | Ga0105237_10025992 | 3300009545 | Bacteria | 5985 |
| 124 | Ga0105249_10000711 | 3300009553 | Bacteria | 30203 |
| 125 | Ga0105249_10008451 | 3300009553 | Bacteria | 8969 |
| 126 | Ga0105249_10857926 | 3300009553 | Bacteria | 974 |
| 127 | Ga0105246_10216592 | 3300011119 | Bacteria | 1498 |
| 128 | Ga0163162_10059098 | 3300013306 | Bacteria | 3865 |
| 129 | Ga0163162_10092036 | 3300013306 | Bacteria | 3115 |
| 130 | Ga0163162_10307088 | 3300013306 | Bacteria | 1719 |
| 131 | Ga0163163_10046009 | 3300014325 | Bacteria | 4285 |
| 132 | Ga0163163_10168348 | 3300014325 | Bacteria | 2238 |
| 133 | Ga0157380_10062422 | 3300014326 | Bacteria | 2985 |
| 134 | Ga0157380_10352890 | 3300014326 | Bacteria | 1377 |
| 135 | Ga0157380_10817166 | 3300014326 | Bacteria | 951 |
| 136 | Ga0157377_10019360 | 3300014745 | Bacteria | 3555 |
| 137 | Ga0157379_10312185 | 3300014968 | Bacteria | 1434 |
| 138 | Ga0157376_10016909 | 3300014969 | Bacteria | 5551 |
| 139 | Ga0157376_10089850 | 3300014969 | Bacteria | 2657 |
| 140 | Ga0157376_10425761 | 3300014969 | Bacteria | 1289 |
| 141 | Ga0182007_10032901 | 3300015262 | Bacteria | 1759 |
| 142 | Ga0213876_10050293 | 3300021384 | Bacteria | 2202 |
| 143 | Ga0209758_1000925 | 3300025297 | Bacteria | 39673 |
| 144 | Ga0207692_10030366 | 3300025898 | Bacteria | 2577 |
| 145 | Ga0207710_10013235 | 3300025900 | Bacteria | 3475 |
| 146 | Ga0207710_10127230 | 3300025900 | Bacteria | 1221 |
| 147 | Ga0207688_10000344 | 3300025901 | Bacteria | 21559 |
| 148 | Ga0207680_10025638 | 3300025903 | Bacteria | 3255 |
| 149 | Ga0207647_10022214 | 3300025904 | Bacteria | 4219 |
| 150 | Ga0207685_10180437 | 3300025905 | Bacteria | 978 |
| 151 | Ga0207645_10013416 | 3300025907 | Bacteria | 5521 |
| 152 | Ga0207645_10064763 | 3300025907 | Bacteria | 2335 |
| 153 | Ga0207643_10163716 | 3300025908 | Bacteria | 1339 |
| 154 | Ga0207654_10386203 | 3300025911 | Bacteria | 971 |
| 155 | Ga0207707_10239070 | 3300025912 | Bacteria | 1579 |
| 156 | Ga0207671_10482324 | 3300025914 | Bacteria | 988 |
| 157 | Ga0207693_10033192 | 3300025915 | Bacteria | 4073 |
| 158 | Ga0207663_10217334 | 3300025916 | Bacteria | 1389 |
| 159 | Ga0207662_10026057 | 3300025918 | Bacteria | 3371 |
| 160 | Ga0207657_10022265 | 3300025919 | Bacteria | 5938 |
| 161 | Ga0207657_10024392 | 3300025919 | Bacteria | 5602 |
| 162 | Ga0207652_10060020 | 3300025921 | Bacteria | 3280 |
| 163 | Ga0207694_10722226 | 3300025924 | Bacteria | 840 |
| 164 | Ga0207650_10001141 | 3300025925 | Bacteria | 19510 |
| 165 | Ga0207659_10063346 | 3300025926 | Bacteria | 2673 |
| 166 | Ga0207659_10485015 | 3300025926 | Bacteria | 1045 |
| 167 | Ga0207687_10024211 | 3300025927 | Bacteria | 4053 |
| 168 | Ga0207700_10011687 | 3300025928 | Bacteria | 5613 |
| 169 | Ga0207700_10106776 | 3300025928 | Bacteria | 2245 |
| 170 | Ga0207664_10082568 | 3300025929 | Bacteria | 2618 |
| 171 | Ga0207664_10094416 | 3300025929 | Bacteria | 2458 |
| 172 | Ga0207644_10014875 | 3300025931 | Bacteria | 5216 |
| 173 | Ga0207644_10034959 | 3300025931 | Bacteria | 3519 |
| 174 | Ga0207706_10004119 | 3300025933 | Bacteria | 13719 |
| 175 | Ga0207686_10023561 | 3300025934 | Bacteria | 3558 |
| 176 | Ga0207686_10115683 | 3300025934 | Bacteria | 1817 |
| 177 | Ga0207709_10021135 | 3300025935 | Bacteria | 3681 |
| 178 | Ga0207709_10221616 | 3300025935 | Bacteria | 1364 |
| 179 | Ga0207670_10010975 | 3300025936 | Bacteria | 5236 |
| 180 | Ga0207670_10062814 | 3300025936 | Bacteria | 2539 |
| 181 | Ga0207670_10193602 | 3300025936 | Bacteria | 1540 |
| 182 | Ga0207669_10040350 | 3300025937 | Bacteria | 2707 |
| 183 | Ga0207669_10050237 | 3300025937 | Bacteria | 2491 |
| 184 | Ga0207704_10061505 | 3300025938 | Bacteria | 2330 |
| 185 | Ga0207665_10035161 | 3300025939 | Bacteria | 3324 |
| 186 | Ga0207691_10016132 | 3300025940 | Bacteria | 7096 |
| 187 | Ga0207691_10080795 | 3300025940 | Bacteria | 2923 |
| 188 | Ga0207691_10428055 | 3300025940 | Bacteria | 1127 |
| 189 | Ga0207711_10010900 | 3300025941 | Bacteria | 7555 |
| 190 | Ga0207711_10046016 | 3300025941 | Bacteria | 3729 |
| 191 | Ga0207689_10010387 | 3300025942 | Bacteria | 8020 |
| 192 | Ga0207679_10279270 | 3300025945 | Bacteria | 1432 |
| 193 | Ga0207651_10141408 | 3300025960 | Bacteria | 1859 |
| 194 | Ga0207712_10011604 | 3300025961 | Bacteria | 5618 |
| 195 | Ga0207668_10316628 | 3300025972 | Bacteria | 1293 |
| 196 | Ga0207668_10648045 | 3300025972 | Bacteria | 924 |
| 197 | Ga0207658_10009317 | 3300025986 | Bacteria | 6658 |
| 198 | Ga0207658_10130232 | 3300025986 | Bacteria | 2020 |
| 199 | Ga0207677_10001708 | 3300026023 | Bacteria | 11605 |
| 200 | Ga0207677_10188079 | 3300026023 | Bacteria | 1631 |
| 201 | Ga0207703_10007814 | 3300026035 | Bacteria | 8462 |
| 202 | Ga0207639_10055275 | 3300026041 | Bacteria | 3037 |
| 203 | Ga0207678_10008970 | 3300026067 | Bacteria | 8802 |
| 204 | Ga0207708_10002952 | 3300026075 | Bacteria | 12541 |
| 205 | Ga0207708_10190699 | 3300026075 | Unclassified | 1631 |
| 206 | Ga0207702_10087780 | 3300026078 | Bacteria | 2716 |
| 207 | Ga0207641_10030974 | 3300026088 | Bacteria | 4434 |
| 208 | Ga0207641_10493696 | 3300026088 | Bacteria | 1188 |
| 209 | Ga0207648_10006335 | 3300026089 | Bacteria | 11766 |
| 210 | Ga0207648_10127201 | 3300026089 | Bacteria | 2242 |
| 211 | Ga0207676_10001967 | 3300026095 | Bacteria | 14966 |
| 212 | Ga0207676_10065350 | 3300026095 | Bacteria | 2896 |
| 213 | Ga0207676_10384735 | 3300026095 | Bacteria | 1307 |
| 214 | Ga0207674_10063071 | 3300026116 | Bacteria | 3742 |
| 215 | Ga0207675_100014775 | 3300026118 | Bacteria | 7284 |
| 216 | Ga0207675_100216869 | 3300026118 | Bacteria | 1842 |
| 217 | Ga0207683_10368135 | 3300026121 | Bacteria | 1320 |
| 218 | Ga0207698_10039460 | 3300026142 | Bacteria | 3499 |
| 219 | Ga0207428_10038474 | 3300027907 | Bacteria | 3888 |
| 220 | Ga0268264_10007811 | 3300028381 | Bacteria | 8901 |
| 221 | Ga0265329_10056018 | 3300031242 | Bacteria | 1250 |
| 222 | Ga0265340_10000573 | 3300031247 | Bacteria | 20425 |
| 223 | Ga0265339_10001994 | 3300031249 | Bacteria | 14995 |
| 224 | Ga0265331_10015506 | 3300031250 | Bacteria | 4021 |
| 225 | Ga0265316_10080682 | 3300031344 | Bacteria | 2495 |
| 226 | Ga0316575_10023815 | 3300031665 | Bacteria | 2368 |
| 227 | Ga0316579_10247164 | 3300031691 | Bacteria | 863 |
| 228 | Ga0265314_10084309 | 3300031711 | Bacteria | 2086 |
| 229 | Ga0265342_10000175 | 3300031712 | Bacteria | 71083 |
| 230 | Ga0373959_0032958 | 3300034820 | Bacteria | 1055 |
| 231 | Ga0373928_0027783 | 3300035084 | Bacteria | 1234 |
| 232 | Ga0373934_0054274 | 3300035086 | Bacteria | 1591 |
| 233 | Ga0373923_0000038 | 3300035111 | Bacteria | 20095 |
| 234 | Ga0373936_0004827 | 3300035113 | Bacteria | 5084 |
| 235 | Ga0373936_0031400 | 3300035113 | Bacteria | 2098 |
| 236 | Ga0373941_0184340 | 3300035115 | Bacteria | 785 |
| 237 | Ga0373945_0005100 | 3300035116 | Bacteria | 4190 |
| 238 | Ga0373945_0047677 | 3300035116 | Bacteria | 1568 |
| 239 | Ga0373953_0007624 | 3300035117 | Bacteria | 3634 |
| 240 | Ga0373954_0001191 | 3300035118 | Bacteria | 10445 |
| 241 | Ga0373956_0056181 | 3300035119 | Bacteria | 1776 |
| 242 | Ga0373957_0014910 | 3300035120 | Bacteria | 2664 |
| 243 | Ga0373960_0032277 | 3300035121 | Bacteria | 1470 |
| 244 | Ga0373943_0002600 | 3300035170 | Bacteria | 8209 |
| 245 | Ga0373943_0003464 | 3300035170 | Bacteria | 7174 |
| 246 | Ga0373946_0001741 | 3300035171 | Bacteria | 7593 |
| 247 | Ga0373946_0007686 | 3300035171 | Bacteria | 3949 |
| 248 | Ga0373955_0000211 | 3300035172 | Bacteria | 24370 |
| 249 | Ga0373942_0029202 | 3300035207 | Bacteria | 1446 |
| 250 | Ga0373961_0045001 | 3300035241 | Bacteria | 1290 |
| 251 | Ga0373962_0093001 | 3300035242 | Bacteria | 931 |
| 252 | Ga0373924_0005832 | 3300035410 | Bacteria | 4384 |
| 253 | Ga0373931_0008781 | 3300035691 | Bacteria | 4808 |
| 254 | Ga0373931_0113690 | 3300035691 | Bacteria | 1539 |
| 255 | Ga0373935_0000189 | 3300035692 | Bacteria | 29172 |
| 256 | Ga0373935_0016441 | 3300035692 | Bacteria | 4475 |
| 257 | Ga0373935_0033071 | 3300035692 | Bacteria | 3217 |
| 258 | Ga0373935_0089708 | 3300035692 | Bacteria | 2011 |
| 259 | Ga0373935_0281329 | 3300035692 | Bacteria | 1171 |
| 260 | Ga0373927_0009208 | 3300035695 | Bacteria | 6624 |
| 261 | Ga0373927_0011842 | 3300035695 | Bacteria | 5810 |
| 262 | Ga0373927_0060671 | 3300035695 | Bacteria | 2447 |
| 263 | Ga0373927_0122288 | 3300035695 | Bacteria | 1699 |
| 264 | Ga0373927_0296889 | 3300035695 | Bacteria | 1063 |
| 265 | Ga0373933_0004328 | 3300035724 | Bacteria | 7796 |
| 266 | Ga0373947_0004910 | 3300035725 | Bacteria | 7826 |
| 267 | Ga0373947_0015833 | 3300035725 | Bacteria | 4331 |
| 268 | Ga0373937_0000009 | 3300036401 | Bacteria | 169521 |
| 269 | Ga0373937_0343420 | 3300036401 | Bacteria | 1414 |
| 270 | Ga0373925_0000194 | 3300037068 | Bacteria | 66124 |
| 271 | Ga0373925_0013924 | 3300037068 | Bacteria | 5822 |
| 272 | Ga0373925_0090176 | 3300037068 | Bacteria | 2343 |
| 273 | Ga0395901_0471276 | 3300038443 | Bacteria | 1282 |
| 274 | Ga0436365_1088661 | 3300039437 | Bacteria | 2692 |
| 275 | Ga0436363_0991563 | 3300039450 | Bacteria | 7209 |
| 276 | Ga0495617_120876 | 3300046452 | Bacteria | 844 |
| 277 | Ga0495627_086082 | 3300046453 | Bacteria | 907 |
| 278 | Ga0495592_0000422 | 3300046454 | Bacteria | 32126 |
| 279 | Ga0495592_0142588 | 3300046454 | Bacteria | 1665 |
| 280 | Ga0495603_0110159 | 3300046455 | Bacteria | 1606 |
| 281 | Ga0495629_0004190 | 3300046459 | Bacteria | 10826 |
| 282 | Ga0495641_0005591 | 3300046461 | Bacteria | 8416 |
| 283 | Ga0495651_0000300 | 3300046462 | Bacteria | 38562 |
| 284 | Ga0495651_0119948 | 3300046462 | Bacteria | 1934 |
| 285 | Ga0495653_0000032 | 3300046463 | Bacteria | 132763 |
| 286 | Ga0495653_0181475 | 3300046463 | Bacteria | 1444 |
| 287 | Ga0495582_0001274 | 3300046473 | Bacteria | 14160 |
| 288 | Ga0495582_0180537 | 3300046473 | Bacteria | 1202 |
| 289 | Ga0495605_0056685 | 3300046474 | Bacteria | 1889 |
| 290 | Ga0495662_0017803 | 3300046476 | Bacteria | 3440 |
| 291 | Ga0495662_0031285 | 3300046476 | Bacteria | 2570 |
| 292 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 293 | Ga0495664_0166814 | 3300046477 | Bacteria | 1336 |
| 294 | Ga0495584_0003670 | 3300046491 | Bacteria | 8364 |
| 295 | Ga0495585_0140006 | 3300046492 | Bacteria | 1268 |
| 296 | Ga0495594_0006899 | 3300046499 | Bacteria | 5842 |
| 297 | Ga0495596_0040638 | 3300046500 | Bacteria | 1836 |
| 298 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 299 | Ga0495608_0503104 | 3300046511 | Bacteria | 734 |
| 300 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 301 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 302 | Ga0495628_0434755 | 3300046516 | Bacteria | 955 |
| 303 | Ga0495630_0002397 | 3300046517 | Bacteria | 13021 |
| 304 | Ga0495630_0411605 | 3300046517 | Unclassified | 1036 |
| 305 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 306 | Ga0495652_0214199 | 3300046529 | Bacteria | 1452 |
| 307 | Ga0495665_0120431 | 3300046531 | Bacteria | 1375 |
| 308 | Ga0495640_0000094 | 3300046533 | Bacteria | 51238 |
| 309 | Ga0495640_0086556 | 3300046533 | Bacteria | 2074 |
| 310 | Ga0495640_0202528 | 3300046533 | Bacteria | 1257 |
| 311 | Ga0495587_0000086 | 3300046536 | Bacteria | 72022 |
| 312 | Ga0495598_0157460 | 3300046537 | Bacteria | 797 |
| 313 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 314 | Ga0495645_0237115 | 3300046543 | Bacteria | 1219 |
| 315 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 316 | Ga0495656_0047232 | 3300046615 | Bacteria | 1825 |
| 317 | Ga0495634_0000223 | 3300046642 | Bacteria | 53103 |
| 318 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 319 | Ga0495657_0000058 | 3300046675 | Bacteria | 97827 |
| 320 | Ga0495599_0000007 | 3300046678 | Bacteria | 236638 |
| 321 | Ga0495599_0306943 | 3300046678 | Bacteria | 957 |
| 322 | Ga0495623_0000085 | 3300046679 | Bacteria | 55527 |
| 323 | Ga0495646_0000021 | 3300046680 | Bacteria | 115358 |
| 324 | Ga0495658_0024042 | 3300046683 | Bacteria | 3240 |
| 325 | Ga0495658_0135165 | 3300046683 | Bacteria | 1504 |
| 326 | Ga0495669_0092994 | 3300046684 | Bacteria | 1394 |
| 327 | Ga0495613_0020157 | 3300046689 | Bacteria | 4968 |
| 328 | Ga0495613_0103187 | 3300046689 | Bacteria | 2059 |
| 329 | Ga0495624_0008312 | 3300046690 | Bacteria | 7255 |
| 330 | Ga0495671_0102996 | 3300046692 | Bacteria | 1395 |
| 331 | Ga0495600_0000001 | 3300046809 | Bacteria | 214870 |
| 332 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 333 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 334 | Ga0495674_0297944 | 3300047319 | Bacteria | 1318 |
| 335 | Ga0495676_0017745 | 3300047321 | Bacteria | 6286 |
| 336 | Ga0495680_0000245 | 3300047322 | Bacteria | 59987 |
| 337 | Ga0495675_0002083 | 3300047444 | Bacteria | 11942 |
| 338 | Ga0495675_0177297 | 3300047444 | Bacteria | 1306 |
| 339 | Ga0495681_0163997 | 3300047470 | Bacteria | 924 |
| 340 | Ga0495684_0000084 | 3300047471 | Bacteria | 65600 |
| 341 | Ga0495593_0000733 | 3300047673 | Bacteria | 19034 |
| 342 | Ga0495593_0249963 | 3300047673 | Bacteria | 888 |
| 343 | Ga0495602_0000073 | 3300048088 | Bacteria | 98745 |
| 344 | Ga0496100_0002178 | 3300048903 | Bacteria | 9879 |
| 345 | Ga0496100_0094057 | 3300048903 | Bacteria | 2052 |
| 346 | Ga0496100_0104996 | 3300048903 | Bacteria | 1953 |
| 347 | Ga0496100_0111865 | 3300048903 | Bacteria | 1898 |
| 348 | Ga0496101_0003990 | 3300048904 | Bacteria | 9234 |
| 349 | Ga0496101_0095326 | 3300048904 | Bacteria | 2219 |
| 350 | Ga0496102_0000871 | 3300048905 | Bacteria | 28857 |
| 351 | Ga0496102_0010266 | 3300048905 | Bacteria | 8052 |
| 352 | Ga0496103_0003369 | 3300048906 | Bacteria | 9767 |
| 353 | Ga0496103_0003600 | 3300048906 | Bacteria | 9454 |
| 354 | Ga0496103_0313909 | 3300048906 | Bacteria | 1008 |
| 355 | Ga0496103_0447325 | 3300048906 | Bacteria | 829 |
| 356 | Ga0496104_0000445 | 3300048907 | Bacteria | 35921 |
| 357 | Ga0496104_0000880 | 3300048907 | Bacteria | 25856 |
| 358 | Ga0496104_0002378 | 3300048907 | Bacteria | 16215 |
| 359 | Ga0496104_0005871 | 3300048907 | Bacteria | 10756 |
| 360 | Ga0496104_0164149 | 3300048907 | Bacteria | 2130 |
| 361 | Ga0496105_0000514 | 3300048908 | Bacteria | 25562 |
| 362 | Ga0496105_0006690 | 3300048908 | Bacteria | 8873 |
| 363 | Ga0496105_0080877 | 3300048908 | Bacteria | 2684 |
| 364 | Ga0496105_0088570 | 3300048908 | Bacteria | 2557 |
| 365 | Ga0496106_0007908 | 3300048909 | Bacteria | 7858 |
| 366 | Ga0496106_0061247 | 3300048909 | Bacteria | 2854 |
| 367 | Ga0496106_0141897 | 3300048909 | Bacteria | 1890 |
| 368 | Ga0496106_0319960 | 3300048909 | Bacteria | 1245 |
| 369 | Ga0496107_0000769 | 3300048910 | Bacteria | 18509 |
| 370 | Ga0496107_0060279 | 3300048910 | Bacteria | 2746 |
| 371 | Ga0496107_0297076 | 3300048910 | Bacteria | 1202 |
| 372 | Ga0496108_0003421 | 3300048911 | Bacteria | 12733 |
| 373 | Ga0496108_0005851 | 3300048911 | Bacteria | 9969 |
| 374 | Ga0496108_0442487 | 3300048911 | Bacteria | 1135 |
| 375 | Ga0496108_0452102 | 3300048911 | Bacteria | 1122 |
| 376 | Ga0496109_0002011 | 3300048912 | Bacteria | 16871 |
| 377 | Ga0496109_0046860 | 3300048912 | Bacteria | 3927 |
| 378 | Ga0496109_0601801 | 3300048912 | Bacteria | 1035 |
| 379 | Ga0496109_0982848 | 3300048912 | Bacteria | 782 |
| 380 | Ga0496110_0002034 | 3300048913 | Bacteria | 15073 |
| 381 | Ga0496110_0012856 | 3300048913 | Bacteria | 6897 |
| 382 | Ga0496110_0175660 | 3300048913 | Bacteria | 1944 |
| 383 | Ga0496110_0550176 | 3300048913 | Bacteria | 1049 |
| 384 | Ga0496111_0000072 | 3300048914 | Bacteria | 41891 |
| 385 | Ga0496111_0000641 | 3300048914 | Bacteria | 18442 |
| 386 | Ga0496112_0000112 | 3300048915 | Bacteria | 50370 |
| 387 | Ga0496112_0009026 | 3300048915 | Bacteria | 8954 |
| 388 | Ga0496113_0000058 | 3300048916 | Bacteria | 47947 |
| 389 | Ga0496113_0001260 | 3300048916 | Bacteria | 13973 |
| 390 | Ga0496113_0032424 | 3300048916 | Bacteria | 3798 |
| 391 | Ga0496113_0242153 | 3300048916 | Bacteria | 1439 |
| 392 | Ga0496113_0646119 | 3300048916 | Bacteria | 846 |
| 393 | Ga0496114_0016624 | 3300048917 | Bacteria | 5931 |
| 394 | Ga0496114_0017394 | 3300048917 | Bacteria | 5802 |
| 395 | Ga0496114_0260038 | 3300048917 | Bacteria | 1528 |
| 396 | Ga0496114_0377686 | 3300048917 | Bacteria | 1254 |
| 397 | Ga0496115_0013126 | 3300048918 | Bacteria | 6256 |
| 398 | Ga0496115_0022047 | 3300048918 | Bacteria | 4927 |
| 399 | Ga0496115_0055864 | 3300048918 | Bacteria | 3172 |
| 400 | Ga0496115_0066392 | 3300048918 | Bacteria | 2915 |
| 401 | Ga0501036_0290382 | 3300049572 | Bacteria | 1368 |
| 402 | Ga0501039_0365910 | 3300049575 | Bacteria | 1133 |
| 403 | Ga0501040_0254894 | 3300049576 | Bacteria | 1252 |
| 404 | Ga0501071_0401230 | 3300049587 | Bacteria | 1047 |
| 405 | Ga0501072_0086528 | 3300049588 | Bacteria | 2487 |
| 406 | Ga0501072_0140284 | 3300049588 | Bacteria | 1927 |
| 407 | Ga0501073_0233707 | 3300049589 | Bacteria | 1270 |
| 408 | Ga0501074_0305981 | 3300049590 | Bacteria | 1129 |
| 409 | Ga0501075_0124913 | 3300049591 | Bacteria | 1959 |
| 410 | Ga0501075_0147293 | 3300049591 | Bacteria | 1794 |
| 411 | Ga0501079_0220169 | 3300049741 | Bacteria | 1483 |
| 412 | Ga0501079_0484858 | 3300049741 | Unclassified | 972 |
| 413 | Ga0501080_0079145 | 3300049742 | Bacteria | 3056 |
| 414 | Ga0501081_0093692 | 3300049743 | Bacteria | 2115 |
| 415 | Ga0501081_0143487 | 3300049743 | Bacteria | 1712 |
| 416 | Ga0501045_0637183 | 3300049824 | Bacteria | 788 |
| 417 | nmdc:mga03683_14426_c1 | 3300050489 | Bacteria | 2924 |
| 418 | nmdc:mga03n38_34639_c1 | 3300050490 | Bacteria | 2158 |
| 419 | nmdc:mga00v17_42897_c1 | 3300050491 | Bacteria | 2722 |
| 420 | nmdc:mga0yw44_271252_c1 | 3300050492 | Bacteria | 1132 |
| 421 | nmdc:mga0yw44_501_c1 | 3300050492 | Bacteria | 13990 |
| 422 | nmdc:mga0yw44_8423_c1 | 3300050492 | Bacteria | 5137 |
| 423 | nmdc:mga0k408_18592_c1 | 3300050493 | Bacteria | 3880 |
| 424 | nmdc:mga0k408_333725_c1 | 3300050493 | Bacteria | 904 |
| 425 | nmdc:mga0k408_357889_c1 | 3300050493 | Bacteria | 870 |
| 426 | nmdc:mga0k408_73512_c1 | 3300050493 | Bacteria | 1997 |
| 427 | nmdc:mga06z11_23381_c1 | 3300050494 | Bacteria | 2903 |
| 428 | nmdc:mga06z11_67316_c1 | 3300050494 | Bacteria | 1885 |
| 429 | nmdc:mga04h51_3760_c1 | 3300050495 | Bacteria | 3720 |
| 430 | nmdc:mga07m45_30674_c1 | 3300050496 | Bacteria | 2979 |
| 431 | nmdc:mga07m45_63074_c1 | 3300050496 | Bacteria | 2101 |
| 432 | nmdc:mga05p37_106824_c1 | 3300050507 | Bacteria | 3444 |
| 433 | nmdc:mga05p37_210744_c1 | 3300050507 | Bacteria | 2349 |
| 434 | nmdc:mga05p37_40386_c1 | 3300050507 | Bacteria | 5730 |
| 435 | nmdc:mga05p37_50472_c1 | 3300050507 | Bacteria | 5117 |
| 436 | nmdc:mga05p37_853690_c1 | 3300050507 | Bacteria | 988 |
| 437 | nmdc:mga09592_21633_c1 | 3300050508 | Bacteria | 5301 |
| 438 | nmdc:mga0qj67_60_c1 | 3300050509 | Bacteria | 80228 |
| 439 | nmdc:mga0qj67_70370_c1 | 3300050509 | Bacteria | 2791 |
| 440 | nmdc:mga06r32_29045_c1 | 3300050510 | Bacteria | 5178 |
| 441 | nmdc:mga06r32_290594_c1 | 3300050510 | Bacteria | 1621 |
| 442 | nmdc:mga06r32_56117_c1 | 3300050510 | Bacteria | 3780 |
| 443 | nmdc:mga08y16_115077_c1 | 3300050511 | Bacteria | 2800 |
| 444 | nmdc:mga08y16_609216_c1 | 3300050511 | Bacteria | 1100 |
| 445 | nmdc:mga08y16_718063_c1 | 3300050511 | Unclassified | 998 |
| 446 | nmdc:mga0n895_120457_c1 | 3300050512 | Bacteria | 2645 |
| 447 | nmdc:mga0n895_16977_c1 | 3300050512 | Bacteria | 6697 |
| 448 | nmdc:mga0n895_26569_c1 | 3300050512 | Bacteria | 5485 |
| 449 | nmdc:mga0n895_29161_c1 | 3300050512 | Bacteria | 5259 |
| 450 | nmdc:mga0n895_78332_c1 | 3300050512 | Bacteria | 2298 |
| 451 | nmdc:mga0rr50_527385_c1 | 3300050513 | Bacteria | 1005 |
| 452 | nmdc:mga08x19_112578_c1 | 3300050514 | Bacteria | 1816 |
| 453 | nmdc:mga08x19_39937_c1 | 3300050514 | Bacteria | 2985 |
| 454 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 455 | nmdc:mga0a205_19052_c1 | 3300050515 | Bacteria | 6465 |
| 456 | nmdc:mga0a205_461170_c1 | 3300050515 | Bacteria | 1130 |
| 457 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 458 | Ga0495601_0064102 | 3300053077 | Bacteria | 2336 |
| 459 | Ga0495601_0117244 | 3300053077 | Bacteria | 1727 |
| 460 | Ga0495601_0199444 | 3300053077 | Bacteria | 1308 |
| 461 | Ga0495612_0000019 | 3300053078 | Bacteria | 137844 |
| 462 | Ga0495612_0020957 | 3300053078 | Bacteria | 2622 |
| 463 | Ga0495595_0000015 | 3300053084 | Bacteria | 144946 |
| 464 | Ga0495595_0030029 | 3300053084 | Bacteria | 2436 |
| 465 | Ga0495595_0109817 | 3300053084 | Bacteria | 1336 |
| 466 | Ga0495595_0356251 | 3300053084 | Bacteria | 739 |
| 467 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 468 | Ga0495619_0008018 | 3300053085 | Bacteria | 6683 |
| 469 | Ga0495619_0037660 | 3300053085 | Bacteria | 3153 |
| 470 | Ga0500593_002603 | 3300053117 | Bacteria | 6661 |
| 471 | Ga0500642_0211606 | 3300053130 | Bacteria | 900 |
| 472 | Ga0500559_0154682 | 3300053136 | Bacteria | 1077 |
| 473 | Ga0501084_0036290 | 3300054114 | Bacteria | 4118 |
| 474 | Ga0501084_0037753 | 3300054114 | Bacteria | 4037 |
| 475 | Ga0501084_0383110 | 3300054114 | Bacteria | 1188 |
| 476 | Ga0501082_0147036 | 3300060353 | Bacteria | 2046 |
| 477 | Ga0501082_0206020 | 3300060353 | Bacteria | 1711 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0002600 | Ga0373943_0002600_17_748 | 214 |
| 2 | 3300053084 | Ga0495595_0356251 | Ga0495595_0356251_47_724 | 214 |
| 3 | 3300060353 | Ga0501082_0147036 | Ga0501082_0147036_1212_1961 | 216 |
| 4 | 3300014968 | Ga0157379_10312185 | Ga0157379_103121851 | 219 |
| 5 | 3300050507 | nmdc:mga05p37_210744_c1 | nmdc:mga05p37_210744_c1_1529_2245 | 219 |
| 6 | 3300046500 | Ga0495596_0040638 | Ga0495596_0040638_866_1579 | 222 |
| 7 | 3300005983 | Ga0081540_1001034 | Ga0081540_100103414 | 225 |
| 8 | 3300006846 | Ga0075430_100000015 | Ga0075430_10000001530 | 225 |
| 9 | 3300049572 | Ga0501036_0290382 | Ga0501036_0290382_473_1183 | 225 |
| 10 | 3300049591 | Ga0501075_0124913 | Ga0501075_0124913_337_1047 | 225 |
| 11 | 3300049824 | Ga0501045_0637183 | Ga0501045_0637183_40_750 | 225 |
| 12 | 3300050509 | nmdc:mga0qj67_60_c1 | nmdc:mga0qj67_60_c1_13846_14556 | 225 |
| 13 | 3300001977 | JGI24746J21847_1007293 | JGI24746J21847_10072932 | 226 |
| 14 | 3300002076 | JGI24749J21850_1003378 | JGI24749J21850_10033782 | 226 |
| 15 | 3300002077 | JGI24744J21845_10005049 | JGI24744J21845_100050494 | 226 |
| 16 | 3300002239 | JGI24034J26672_10010157 | JGI24034J26672_100101572 | 226 |
| 17 | 3300002244 | JGI24742J22300_10032776 | JGI24742J22300_100327761 | 226 |
| 18 | 3300003322 | rootL2_10107034 | rootL2_101070341 | 226 |
| 19 | 3300005328 | Ga0070676_10028756 | Ga0070676_100287562 | 226 |
| 20 | 3300005329 | Ga0070683_100175249 | Ga0070683_1001752491 | 226 |
| 21 | 3300005330 | Ga0070690_100214828 | Ga0070690_1002148282 | 226 |
| 22 | 3300005331 | Ga0070670_100148073 | Ga0070670_1001480732 | 226 |
| 23 | 3300005334 | Ga0068869_100062305 | Ga0068869_1000623052 | 226 |
| 24 | 3300005335 | Ga0070666_10064432 | Ga0070666_100644323 | 226 |
| 25 | 3300005337 | Ga0070682_100118641 | Ga0070682_1001186412 | 226 |
| 26 | 3300005338 | Ga0068868_100012622 | Ga0068868_1000126222 | 226 |
| 27 | 3300005339 | Ga0070660_100105337 | Ga0070660_1001053372 | 226 |
| 28 | 3300005340 | Ga0070689_100011988 | Ga0070689_1000119886 | 226 |
| 29 | 3300005343 | Ga0070687_100008637 | Ga0070687_1000086371 | 226 |
| 30 | 3300005353 | Ga0070669_100416016 | Ga0070669_1004160161 | 226 |
| 31 | 3300005354 | Ga0070675_100006738 | Ga0070675_10000673810 | 226 |
| 32 | 3300005355 | Ga0070671_100005864 | Ga0070671_1000058642 | 226 |
| 33 | 3300005356 | Ga0070674_100066196 | Ga0070674_1000661963 | 226 |
| 34 | 3300005364 | Ga0070673_100015427 | Ga0070673_1000154275 | 226 |
| 35 | 3300005365 | Ga0070688_100138048 | Ga0070688_1001380482 | 226 |
| 36 | 3300005436 | Ga0070713_100071856 | Ga0070713_1000718563 | 226 |
| 37 | 3300005438 | Ga0070701_10026158 | Ga0070701_100261582 | 226 |
| 38 | 3300005438 | Ga0070701_10197957 | Ga0070701_101979571 | 226 |
| 39 | 3300005441 | Ga0070700_100549779 | Ga0070700_1005497791 | 226 |
| 40 | 3300005444 | Ga0070694_100149245 | Ga0070694_1001492451 | 226 |
| 41 | 3300005455 | Ga0070663_100025158 | Ga0070663_1000251582 | 226 |
| 42 | 3300005458 | Ga0070681_10155735 | Ga0070681_101557352 | 226 |
| 43 | 3300005459 | Ga0068867_100137511 | Ga0068867_1001375111 | 226 |
| 44 | 3300005466 | Ga0070685_10011432 | Ga0070685_100114321 | 226 |
| 45 | 3300005530 | Ga0070679_100082703 | Ga0070679_1000827033 | 226 |
| 46 | 3300005535 | Ga0070684_100023458 | Ga0070684_1000234584 | 226 |
| 47 | 3300005535 | Ga0070684_100034563 | Ga0070684_1000345632 | 226 |
| 48 | 3300005536 | Ga0070697_100030782 | Ga0070697_1000307823 | 226 |
| 49 | 3300005543 | Ga0070672_100055964 | Ga0070672_1000559642 | 226 |
| 50 | 3300005543 | Ga0070672_100108906 | Ga0070672_1001089061 | 226 |
| 51 | 3300005543 | Ga0070672_100521790 | Ga0070672_1005217901 | 226 |
| 52 | 3300005544 | Ga0070686_100007036 | Ga0070686_1000070363 | 226 |
| 53 | 3300005544 | Ga0070686_100054622 | Ga0070686_1000546222 | 226 |
| 54 | 3300005544 | Ga0070686_100511215 | Ga0070686_1005112151 | 226 |
| 55 | 3300005545 | Ga0070695_100015879 | Ga0070695_1000158796 | 226 |
| 56 | 3300005545 | Ga0070695_100202600 | Ga0070695_1002026002 | 226 |
| 57 | 3300005545 | Ga0070695_100374040 | Ga0070695_1003740402 | 226 |
| 58 | 3300005546 | Ga0070696_100014043 | Ga0070696_1000140432 | 226 |
| 59 | 3300005546 | Ga0070696_100326199 | Ga0070696_1003261992 | 226 |
| 60 | 3300005548 | Ga0070665_100494777 | Ga0070665_1004947772 | 226 |
| 61 | 3300005549 | Ga0070704_100013544 | Ga0070704_1000135446 | 226 |
| 62 | 3300005564 | Ga0070664_100009979 | Ga0070664_1000099795 | 226 |
| 63 | 3300005614 | Ga0068856_100081475 | Ga0068856_1000814751 | 226 |
| 64 | 3300005615 | Ga0070702_100001377 | Ga0070702_10000137710 | 226 |
| 65 | 3300005616 | Ga0068852_100168443 | Ga0068852_1001684433 | 226 |
| 66 | 3300005617 | Ga0068859_100104866 | Ga0068859_1001048663 | 226 |
| 67 | 3300005617 | Ga0068859_100346699 | Ga0068859_1003466992 | 226 |
| 68 | 3300005618 | Ga0068864_100014555 | Ga0068864_1000145552 | 226 |
| 69 | 3300005719 | Ga0068861_100130493 | Ga0068861_1001304931 | 226 |
| 70 | 3300005834 | Ga0068851_10060705 | Ga0068851_100607052 | 226 |
| 71 | 3300005840 | Ga0068870_10068366 | Ga0068870_100683663 | 226 |
| 72 | 3300005840 | Ga0068870_10381819 | Ga0068870_103818191 | 226 |
| 73 | 3300005841 | Ga0068863_100111493 | Ga0068863_1001114933 | 226 |
| 74 | 3300005841 | Ga0068863_100729415 | Ga0068863_1007294152 | 226 |
| 75 | 3300005842 | Ga0068858_100019000 | Ga0068858_1000190005 | 226 |
| 76 | 3300005842 | Ga0068858_100301378 | Ga0068858_1003013782 | 226 |
| 77 | 3300005843 | Ga0068860_100010168 | Ga0068860_1000101685 | 226 |
| 78 | 3300005843 | Ga0068860_100272686 | Ga0068860_1002726861 | 226 |
| 79 | 3300005937 | Ga0081455_10011443 | Ga0081455_100114439 | 226 |
| 80 | 3300005937 | Ga0081455_10052942 | Ga0081455_100529422 | 226 |
| 81 | 3300005937 | Ga0081455_10063357 | Ga0081455_100633572 | 226 |
| 82 | 3300005937 | Ga0081455_10202816 | Ga0081455_102028162 | 226 |
| 83 | 3300005981 | Ga0081538_10034597 | Ga0081538_100345973 | 226 |
| 84 | 3300005983 | Ga0081540_1002311 | Ga0081540_100231116 | 226 |
| 85 | 3300005983 | Ga0081540_1016614 | Ga0081540_10166142 | 226 |
| 86 | 3300006028 | Ga0070717_10583148 | Ga0070717_105831482 | 226 |
| 87 | 3300006038 | Ga0075365_10020587 | Ga0075365_100205873 | 226 |
| 88 | 3300006051 | Ga0075364_10018750 | Ga0075364_100187505 | 226 |
| 89 | 3300006051 | Ga0075364_10075285 | Ga0075364_100752852 | 226 |
| 90 | 3300006163 | Ga0070715_10005422 | Ga0070715_100054222 | 226 |
| 91 | 3300006173 | Ga0070716_100021024 | Ga0070716_1000210242 | 226 |
| 92 | 3300006175 | Ga0070712_100463352 | Ga0070712_1004633521 | 226 |
| 93 | 3300006177 | Ga0075362_10016281 | Ga0075362_100162813 | 226 |
| 94 | 3300006178 | Ga0075367_10076487 | Ga0075367_100764872 | 226 |
| 95 | 3300006186 | Ga0075369_10009394 | Ga0075369_100093944 | 226 |
| 96 | 3300006195 | Ga0075366_10048536 | Ga0075366_100485361 | 226 |
| 97 | 3300006195 | Ga0075366_10072707 | Ga0075366_100727072 | 226 |
| 98 | 3300006237 | Ga0097621_100106537 | Ga0097621_1001065373 | 226 |
| 99 | 3300006237 | Ga0097621_100123408 | Ga0097621_1001234083 | 226 |
| 100 | 3300006353 | Ga0075370_10065307 | Ga0075370_100653072 | 226 |
| 101 | 3300006358 | Ga0068871_100199337 | Ga0068871_1001993372 | 226 |
| 102 | 3300006844 | Ga0075428_100444680 | Ga0075428_1004446802 | 226 |
| 103 | 3300006846 | Ga0075430_100002472 | Ga0075430_10000247214 | 226 |
| 104 | 3300006847 | Ga0075431_100084357 | Ga0075431_1000843572 | 226 |
| 105 | 3300006847 | Ga0075431_100106374 | Ga0075431_1001063743 | 226 |
| 106 | 3300006852 | Ga0075433_10006324 | Ga0075433_100063247 | 226 |
| 107 | 3300006852 | Ga0075433_10484008 | Ga0075433_104840082 | 226 |
| 108 | 3300006871 | Ga0075434_100036001 | Ga0075434_1000360012 | 226 |
| 109 | 3300006871 | Ga0075434_100115118 | Ga0075434_1001151183 | 226 |
| 110 | 3300006880 | Ga0075429_100033803 | Ga0075429_1000338033 | 226 |
| 111 | 3300006880 | Ga0075429_100049619 | Ga0075429_1000496192 | 226 |
| 112 | 3300006881 | Ga0068865_100007886 | Ga0068865_1000078868 | 226 |
| 113 | 3300006914 | Ga0075436_100001731 | Ga0075436_1000017314 | 226 |
| 114 | 3300006931 | Ga0097620_100104869 | Ga0097620_1001048693 | 226 |
| 115 | 3300006931 | Ga0097620_100346690 | Ga0097620_1003466902 | 226 |
| 116 | 3300007076 | Ga0075435_100175665 | Ga0075435_1001756652 | 226 |
| 117 | 3300009036 | Ga0105244_10075130 | Ga0105244_100751301 | 226 |
| 118 | 3300009094 | Ga0111539_10127047 | Ga0111539_101270473 | 226 |
| 119 | 3300009094 | Ga0111539_10600554 | Ga0111539_106005542 | 226 |
| 120 | 3300009098 | Ga0105245_10027869 | Ga0105245_100278692 | 226 |
| 121 | 3300009098 | Ga0105245_10747403 | Ga0105245_107474032 | 226 |
| 122 | 3300009101 | Ga0105247_10046830 | Ga0105247_100468303 | 226 |
| 123 | 3300009147 | Ga0114129_10027820 | Ga0114129_100278205 | 226 |
| 124 | 3300009147 | Ga0114129_10178275 | Ga0114129_101782752 | 226 |
| 125 | 3300009147 | Ga0114129_11033519 | Ga0114129_110335191 | 226 |
| 126 | 3300009147 | Ga0114129_11220788 | Ga0114129_112207881 | 226 |
| 127 | 3300009148 | Ga0105243_10038873 | Ga0105243_100388734 | 226 |
| 128 | 3300009174 | Ga0105241_10813483 | Ga0105241_108134832 | 226 |
| 129 | 3300009174 | Ga0105241_10825622 | Ga0105241_108256221 | 226 |
| 130 | 3300009176 | Ga0105242_10240019 | Ga0105242_102400192 | 226 |
| 131 | 3300009176 | Ga0105242_10359383 | Ga0105242_103593831 | 226 |
| 132 | 3300009177 | Ga0105248_10382853 | Ga0105248_103828532 | 226 |
| 133 | 3300009545 | Ga0105237_10025992 | Ga0105237_100259926 | 226 |
| 134 | 3300009553 | Ga0105249_10000711 | Ga0105249_1000071130 | 226 |
| 135 | 3300009553 | Ga0105249_10008451 | Ga0105249_100084515 | 226 |
| 136 | 3300009553 | Ga0105249_10857926 | Ga0105249_108579262 | 226 |
| 137 | 3300011119 | Ga0105246_10216592 | Ga0105246_102165921 | 226 |
| 138 | 3300013306 | Ga0163162_10059098 | Ga0163162_100590984 | 226 |
| 139 | 3300013306 | Ga0163162_10092036 | Ga0163162_100920363 | 226 |
| 140 | 3300013306 | Ga0163162_10307088 | Ga0163162_103070881 | 226 |
| 141 | 3300014325 | Ga0163163_10046009 | Ga0163163_100460096 | 226 |
| 142 | 3300014325 | Ga0163163_10168348 | Ga0163163_101683483 | 226 |
| 143 | 3300014326 | Ga0157380_10062422 | Ga0157380_100624224 | 226 |
| 144 | 3300014326 | Ga0157380_10352890 | Ga0157380_103528902 | 226 |
| 145 | 3300014326 | Ga0157380_10817166 | Ga0157380_108171661 | 226 |
| 146 | 3300014745 | Ga0157377_10019360 | Ga0157377_100193604 | 226 |
| 147 | 3300014969 | Ga0157376_10016909 | Ga0157376_100169095 | 226 |
| 148 | 3300014969 | Ga0157376_10089850 | Ga0157376_100898502 | 226 |
| 149 | 3300014969 | Ga0157376_10425761 | Ga0157376_104257612 | 226 |
| 150 | 3300015262 | Ga0182007_10032901 | Ga0182007_100329012 | 226 |
| 151 | 3300021384 | Ga0213876_10050293 | Ga0213876_100502932 | 226 |
| 152 | 3300025297 | Ga0209758_1000925 | Ga0209758_100092512 | 226 |
| 153 | 3300025898 | Ga0207692_10030366 | Ga0207692_100303663 | 226 |
| 154 | 3300025900 | Ga0207710_10013235 | Ga0207710_100132354 | 226 |
| 155 | 3300025900 | Ga0207710_10127230 | Ga0207710_101272301 | 226 |
| 156 | 3300025901 | Ga0207688_10000344 | Ga0207688_1000034412 | 226 |
| 157 | 3300025903 | Ga0207680_10025638 | Ga0207680_100256382 | 226 |
| 158 | 3300025904 | Ga0207647_10022214 | Ga0207647_100222142 | 226 |
| 159 | 3300025905 | Ga0207685_10180437 | Ga0207685_101804372 | 226 |
| 160 | 3300025907 | Ga0207645_10013416 | Ga0207645_100134165 | 226 |
| 161 | 3300025907 | Ga0207645_10064763 | Ga0207645_100647632 | 226 |
| 162 | 3300025908 | Ga0207643_10163716 | Ga0207643_101637161 | 226 |
| 163 | 3300025911 | Ga0207654_10386203 | Ga0207654_103862031 | 226 |
| 164 | 3300025912 | Ga0207707_10239070 | Ga0207707_102390702 | 226 |
| 165 | 3300025914 | Ga0207671_10482324 | Ga0207671_104823241 | 226 |
| 166 | 3300025915 | Ga0207693_10033192 | Ga0207693_100331924 | 226 |
| 167 | 3300025916 | Ga0207663_10217334 | Ga0207663_102173342 | 226 |
| 168 | 3300025918 | Ga0207662_10026057 | Ga0207662_100260574 | 226 |
| 169 | 3300025919 | Ga0207657_10022265 | Ga0207657_100222654 | 226 |
| 170 | 3300025919 | Ga0207657_10024392 | Ga0207657_100243923 | 226 |
| 171 | 3300025921 | Ga0207652_10060020 | Ga0207652_100600202 | 226 |
| 172 | 3300025924 | Ga0207694_10722226 | Ga0207694_107222261 | 226 |
| 173 | 3300025925 | Ga0207650_10001141 | Ga0207650_100011414 | 226 |
| 174 | 3300025926 | Ga0207659_10063346 | Ga0207659_100633463 | 226 |
| 175 | 3300025926 | Ga0207659_10485015 | Ga0207659_104850152 | 226 |
| 176 | 3300025927 | Ga0207687_10024211 | Ga0207687_100242113 | 226 |
| 177 | 3300025928 | Ga0207700_10011687 | Ga0207700_100116876 | 226 |
| 178 | 3300025928 | Ga0207700_10106776 | Ga0207700_101067763 | 226 |
| 179 | 3300025929 | Ga0207664_10082568 | Ga0207664_100825682 | 226 |
| 180 | 3300025929 | Ga0207664_10094416 | Ga0207664_100944161 | 226 |
| 181 | 3300025931 | Ga0207644_10014875 | Ga0207644_100148754 | 226 |
| 182 | 3300025931 | Ga0207644_10034959 | Ga0207644_100349592 | 226 |
| 183 | 3300025933 | Ga0207706_10004119 | Ga0207706_1000411914 | 226 |
| 184 | 3300025934 | Ga0207686_10023561 | Ga0207686_100235612 | 226 |
| 185 | 3300025934 | Ga0207686_10115683 | Ga0207686_101156832 | 226 |
| 186 | 3300025935 | Ga0207709_10021135 | Ga0207709_100211355 | 226 |
| 187 | 3300025935 | Ga0207709_10221616 | Ga0207709_102216162 | 226 |
| 188 | 3300025936 | Ga0207670_10010975 | Ga0207670_100109752 | 226 |
| 189 | 3300025936 | Ga0207670_10062814 | Ga0207670_100628142 | 226 |
| 190 | 3300025936 | Ga0207670_10193602 | Ga0207670_101936022 | 226 |
| 191 | 3300025937 | Ga0207669_10040350 | Ga0207669_100403502 | 226 |
| 192 | 3300025937 | Ga0207669_10050237 | Ga0207669_100502372 | 226 |
| 193 | 3300025938 | Ga0207704_10061505 | Ga0207704_100615051 | 226 |
| 194 | 3300025939 | Ga0207665_10035161 | Ga0207665_100351612 | 226 |
| 195 | 3300025940 | Ga0207691_10016132 | Ga0207691_100161328 | 226 |
| 196 | 3300025940 | Ga0207691_10080795 | Ga0207691_100807951 | 226 |
| 197 | 3300025940 | Ga0207691_10428055 | Ga0207691_104280552 | 226 |
| 198 | 3300025941 | Ga0207711_10010900 | Ga0207711_100109005 | 226 |
| 199 | 3300025941 | Ga0207711_10046016 | Ga0207711_100460163 | 226 |
| 200 | 3300025942 | Ga0207689_10010387 | Ga0207689_100103875 | 226 |
| 201 | 3300025945 | Ga0207679_10279270 | Ga0207679_102792702 | 226 |
| 202 | 3300025960 | Ga0207651_10141408 | Ga0207651_101414081 | 226 |
| 203 | 3300025961 | Ga0207712_10011604 | Ga0207712_100116044 | 226 |
| 204 | 3300025972 | Ga0207668_10316628 | Ga0207668_103166282 | 226 |
| 205 | 3300025972 | Ga0207668_10648045 | Ga0207668_106480451 | 226 |
| 206 | 3300025986 | Ga0207658_10009317 | Ga0207658_100093173 | 226 |
| 207 | 3300025986 | Ga0207658_10130232 | Ga0207658_101302322 | 226 |
| 208 | 3300026023 | Ga0207677_10001708 | Ga0207677_100017084 | 226 |
| 209 | 3300026023 | Ga0207677_10188079 | Ga0207677_101880792 | 226 |
| 210 | 3300026035 | Ga0207703_10007814 | Ga0207703_100078147 | 226 |
| 211 | 3300026041 | Ga0207639_10055275 | Ga0207639_100552754 | 226 |
| 212 | 3300026067 | Ga0207678_10008970 | Ga0207678_100089703 | 226 |
| 213 | 3300026075 | Ga0207708_10002952 | Ga0207708_1000295212 | 226 |
| 214 | 3300026075 | Ga0207708_10190699 | Ga0207708_101906991 | 226 |
| 215 | 3300026078 | Ga0207702_10087780 | Ga0207702_100877801 | 226 |
| 216 | 3300026088 | Ga0207641_10030974 | Ga0207641_100309742 | 226 |
| 217 | 3300026088 | Ga0207641_10493696 | Ga0207641_104936962 | 226 |
| 218 | 3300026089 | Ga0207648_10006335 | Ga0207648_1000633510 | 226 |
| 219 | 3300026089 | Ga0207648_10127201 | Ga0207648_101272011 | 226 |
| 220 | 3300026095 | Ga0207676_10001967 | Ga0207676_100019672 | 226 |
| 221 | 3300026095 | Ga0207676_10065350 | Ga0207676_100653503 | 226 |
| 222 | 3300026095 | Ga0207676_10384735 | Ga0207676_103847352 | 226 |
| 223 | 3300026116 | Ga0207674_10063071 | Ga0207674_100630714 | 226 |
| 224 | 3300026118 | Ga0207675_100014775 | Ga0207675_1000147755 | 226 |
| 225 | 3300026118 | Ga0207675_100216869 | Ga0207675_1002168692 | 226 |
| 226 | 3300026121 | Ga0207683_10368135 | Ga0207683_103681352 | 226 |
| 227 | 3300026142 | Ga0207698_10039460 | Ga0207698_100394603 | 226 |
| 228 | 3300027907 | Ga0207428_10038474 | Ga0207428_100384742 | 226 |
| 229 | 3300028381 | Ga0268264_10007811 | Ga0268264_100078115 | 226 |
| 230 | 3300031242 | Ga0265329_10056018 | Ga0265329_100560181 | 226 |
| 231 | 3300031247 | Ga0265340_10000573 | Ga0265340_1000057317 | 226 |
| 232 | 3300031249 | Ga0265339_10001994 | Ga0265339_100019946 | 226 |
| 233 | 3300031250 | Ga0265331_10015506 | Ga0265331_100155062 | 226 |
| 234 | 3300031344 | Ga0265316_10080682 | Ga0265316_100806822 | 226 |
| 235 | 3300031665 | Ga0316575_10023815 | Ga0316575_100238152 | 226 |
| 236 | 3300031691 | Ga0316579_10247164 | Ga0316579_102471641 | 226 |
| 237 | 3300031711 | Ga0265314_10084309 | Ga0265314_100843092 | 226 |
| 238 | 3300031712 | Ga0265342_10000175 | Ga0265342_1000017524 | 226 |
| 239 | 3300034820 | Ga0373959_0032958 | Ga0373959_0032958_248_961 | 226 |
| 240 | 3300035084 | Ga0373928_0027783 | Ga0373928_0027783_507_1220 | 226 |
| 241 | 3300035086 | Ga0373934_0054274 | Ga0373934_0054274_637_1407 | 226 |
| 242 | 3300035111 | Ga0373923_0000038 | Ga0373923_0000038_7201_7968 | 226 |
| 243 | 3300035113 | Ga0373936_0004827 | Ga0373936_0004827_2850_3617 | 226 |
| 244 | 3300035113 | Ga0373936_0031400 | Ga0373936_0031400_1295_2056 | 226 |
| 245 | 3300035115 | Ga0373941_0184340 | Ga0373941_0184340_62_775 | 226 |
| 246 | 3300035116 | Ga0373945_0005100 | Ga0373945_0005100_1012_1725 | 226 |
| 247 | 3300035116 | Ga0373945_0047677 | Ga0373945_0047677_492_1259 | 226 |
| 248 | 3300035117 | Ga0373953_0007624 | Ga0373953_0007624_170_937 | 226 |
| 249 | 3300035118 | Ga0373954_0001191 | Ga0373954_0001191_1783_2550 | 226 |
| 250 | 3300035119 | Ga0373956_0056181 | Ga0373956_0056181_835_1602 | 226 |
| 251 | 3300035120 | Ga0373957_0014910 | Ga0373957_0014910_183_950 | 226 |
| 252 | 3300035121 | Ga0373960_0032277 | Ga0373960_0032277_88_801 | 226 |
| 253 | 3300035170 | Ga0373943_0003464 | Ga0373943_0003464_3670_4383 | 226 |
| 254 | 3300035171 | Ga0373946_0001741 | Ga0373946_0001741_2177_2890 | 226 |
| 255 | 3300035171 | Ga0373946_0007686 | Ga0373946_0007686_2103_2870 | 226 |
| 256 | 3300035172 | Ga0373955_0000211 | Ga0373955_0000211_2205_2972 | 226 |
| 257 | 3300035207 | Ga0373942_0029202 | Ga0373942_0029202_455_1168 | 226 |
| 258 | 3300035241 | Ga0373961_0045001 | Ga0373961_0045001_545_1258 | 226 |
| 259 | 3300035242 | Ga0373962_0093001 | Ga0373962_0093001_84_797 | 226 |
| 260 | 3300035410 | Ga0373924_0005832 | Ga0373924_0005832_2134_2901 | 226 |
| 261 | 3300035691 | Ga0373931_0008781 | Ga0373931_0008781_3611_4357 | 226 |
| 262 | 3300035691 | Ga0373931_0113690 | Ga0373931_0113690_426_1139 | 226 |
| 263 | 3300035692 | Ga0373935_0000189 | Ga0373935_0000189_20_787 | 226 |
| 264 | 3300035692 | Ga0373935_0016441 | Ga0373935_0016441_1067_1780 | 226 |
| 265 | 3300035692 | Ga0373935_0033071 | Ga0373935_0033071_1936_2652 | 226 |
| 266 | 3300035692 | Ga0373935_0089708 | Ga0373935_0089708_1261_1974 | 226 |
| 267 | 3300035692 | Ga0373935_0281329 | Ga0373935_0281329_219_932 | 226 |
| 268 | 3300035695 | Ga0373927_0009208 | Ga0373927_0009208_5589_6302 | 226 |
| 269 | 3300035695 | Ga0373927_0011842 | Ga0373927_0011842_2164_2931 | 226 |
| 270 | 3300035695 | Ga0373927_0060671 | Ga0373927_0060671_405_1118 | 226 |
| 271 | 3300035695 | Ga0373927_0122288 | Ga0373927_0122288_268_981 | 226 |
| 272 | 3300035695 | Ga0373927_0296889 | Ga0373927_0296889_127_840 | 226 |
| 273 | 3300035724 | Ga0373933_0004328 | Ga0373933_0004328_5173_5940 | 226 |
| 274 | 3300035725 | Ga0373947_0004910 | Ga0373947_0004910_4514_5227 | 226 |
| 275 | 3300035725 | Ga0373947_0015833 | Ga0373947_0015833_531_1298 | 226 |
| 276 | 3300036401 | Ga0373937_0000009 | Ga0373937_0000009_47634_48401 | 226 |
| 277 | 3300036401 | Ga0373937_0343420 | Ga0373937_0343420_590_1366 | 226 |
| 278 | 3300037068 | Ga0373925_0000194 | Ga0373925_0000194_63797_64564 | 226 |
| 279 | 3300037068 | Ga0373925_0013924 | Ga0373925_0013924_4021_4734 | 226 |
| 280 | 3300037068 | Ga0373925_0090176 | Ga0373925_0090176_1349_2062 | 226 |
| 281 | 3300038443 | Ga0395901_0471276 | Ga0395901_0471276_64_777 | 226 |
| 282 | 3300039437 | Ga0436365_1088661 | Ga0436365_1088661_982_1695 | 226 |
| 283 | 3300039450 | Ga0436363_0991563 | Ga0436363_0991563_4068_4781 | 226 |
| 284 | 3300046452 | Ga0495617_120876 | Ga0495617_120876_19_732 | 226 |
| 285 | 3300046453 | Ga0495627_086082 | Ga0495627_086082_74_787 | 226 |
| 286 | 3300046454 | Ga0495592_0000422 | Ga0495592_0000422_14653_15420 | 226 |
| 287 | 3300046454 | Ga0495592_0142588 | Ga0495592_0142588_388_1101 | 226 |
| 288 | 3300046455 | Ga0495603_0110159 | Ga0495603_0110159_418_1131 | 226 |
| 289 | 3300046459 | Ga0495629_0004190 | Ga0495629_0004190_22_789 | 226 |
| 290 | 3300046461 | Ga0495641_0005591 | Ga0495641_0005591_4327_5040 | 226 |
| 291 | 3300046462 | Ga0495651_0000300 | Ga0495651_0000300_23790_24557 | 226 |
| 292 | 3300046462 | Ga0495651_0119948 | Ga0495651_0119948_432_1145 | 226 |
| 293 | 3300046463 | Ga0495653_0000032 | Ga0495653_0000032_16835_17602 | 226 |
| 294 | 3300046463 | Ga0495653_0181475 | Ga0495653_0181475_117_830 | 226 |
| 295 | 3300046473 | Ga0495582_0001274 | Ga0495582_0001274_6760_7473 | 226 |
| 296 | 3300046473 | Ga0495582_0180537 | Ga0495582_0180537_285_1052 | 226 |
| 297 | 3300046474 | Ga0495605_0056685 | Ga0495605_0056685_840_1559 | 226 |
| 298 | 3300046476 | Ga0495662_0017803 | Ga0495662_0017803_1184_1900 | 226 |
| 299 | 3300046476 | Ga0495662_0031285 | Ga0495662_0031285_1580_2347 | 226 |
| 300 | 3300046477 | Ga0495664_0000010 | Ga0495664_0000010_220110_220877 | 226 |
| 301 | 3300046477 | Ga0495664_0166814 | Ga0495664_0166814_425_1138 | 226 |
| 302 | 3300046491 | Ga0495584_0003670 | Ga0495584_0003670_5460_6173 | 226 |
| 303 | 3300046492 | Ga0495585_0140006 | Ga0495585_0140006_415_1128 | 226 |
| 304 | 3300046499 | Ga0495594_0006899 | Ga0495594_0006899_4536_5249 | 226 |
| 305 | 3300046511 | Ga0495608_0000008 | Ga0495608_0000008_47772_48539 | 226 |
| 306 | 3300046511 | Ga0495608_0503104 | Ga0495608_0503104_11_724 | 226 |
| 307 | 3300046514 | Ga0495618_0000002 | Ga0495618_0000002_222383_223150 | 226 |
| 308 | 3300046516 | Ga0495628_0000009 | Ga0495628_0000009_220138_220905 | 226 |
| 309 | 3300046516 | Ga0495628_0434755 | Ga0495628_0434755_222_935 | 226 |
| 310 | 3300046517 | Ga0495630_0002397 | Ga0495630_0002397_8136_8903 | 226 |
| 311 | 3300046517 | Ga0495630_0411605 | Ga0495630_0411605_241_960 | 226 |
| 312 | 3300046529 | Ga0495652_0000011 | Ga0495652_0000011_47462_48229 | 226 |
| 313 | 3300046529 | Ga0495652_0214199 | Ga0495652_0214199_670_1383 | 226 |
| 314 | 3300046531 | Ga0495665_0120431 | Ga0495665_0120431_594_1307 | 226 |
| 315 | 3300046533 | Ga0495640_0000094 | Ga0495640_0000094_47462_48229 | 226 |
| 316 | 3300046533 | Ga0495640_0086556 | Ga0495640_0086556_1204_1920 | 226 |
| 317 | 3300046533 | Ga0495640_0202528 | Ga0495640_0202528_401_1114 | 226 |
| 318 | 3300046536 | Ga0495587_0000086 | Ga0495587_0000086_23801_24568 | 226 |
| 319 | 3300046537 | Ga0495598_0157460 | Ga0495598_0157460_50_763 | 226 |
| 320 | 3300046543 | Ga0495645_0000010 | Ga0495645_0000010_16835_17602 | 226 |
| 321 | 3300046543 | Ga0495645_0237115 | Ga0495645_0237115_300_1013 | 226 |
| 322 | 3300046559 | Ga0495667_0000005 | Ga0495667_0000005_220138_220905 | 226 |
| 323 | 3300046615 | Ga0495656_0047232 | Ga0495656_0047232_223_936 | 226 |
| 324 | 3300046642 | Ga0495634_0000223 | Ga0495634_0000223_3104_3871 | 226 |
| 325 | 3300046663 | Ga0495635_0000008 | Ga0495635_0000008_47445_48212 | 226 |
| 326 | 3300046675 | Ga0495657_0000058 | Ga0495657_0000058_2198_2965 | 226 |
| 327 | 3300046678 | Ga0495599_0000007 | Ga0495599_0000007_47462_48229 | 226 |
| 328 | 3300046678 | Ga0495599_0306943 | Ga0495599_0306943_195_908 | 226 |
| 329 | 3300046679 | Ga0495623_0000085 | Ga0495623_0000085_41210_41977 | 226 |
| 330 | 3300046680 | Ga0495646_0000021 | Ga0495646_0000021_47417_48184 | 226 |
| 331 | 3300046683 | Ga0495658_0024042 | Ga0495658_0024042_1028_1741 | 226 |
| 332 | 3300046683 | Ga0495658_0135165 | Ga0495658_0135165_105_872 | 226 |
| 333 | 3300046684 | Ga0495669_0092994 | Ga0495669_0092994_454_1167 | 226 |
| 334 | 3300046689 | Ga0495613_0020157 | Ga0495613_0020157_3045_3812 | 226 |
| 335 | 3300046689 | Ga0495613_0103187 | Ga0495613_0103187_356_1069 | 226 |
| 336 | 3300046690 | Ga0495624_0008312 | Ga0495624_0008312_3122_3835 | 226 |
| 337 | 3300046692 | Ga0495671_0102996 | Ga0495671_0102996_74_787 | 226 |
| 338 | 3300046809 | Ga0495600_0000001 | Ga0495600_0000001_47462_48229 | 226 |
| 339 | 3300047317 | Ga0495604_0000012 | Ga0495604_0000012_220125_220892 | 226 |
| 340 | 3300047319 | Ga0495674_0000011 | Ga0495674_0000011_222411_223178 | 226 |
| 341 | 3300047319 | Ga0495674_0297944 | Ga0495674_0297944_363_1076 | 226 |
| 342 | 3300047321 | Ga0495676_0017745 | Ga0495676_0017745_4002_4715 | 226 |
| 343 | 3300047322 | Ga0495680_0000245 | Ga0495680_0000245_23829_24596 | 226 |
| 344 | 3300047444 | Ga0495675_0002083 | Ga0495675_0002083_4130_4897 | 226 |
| 345 | 3300047444 | Ga0495675_0177297 | Ga0495675_0177297_470_1183 | 226 |
| 346 | 3300047470 | Ga0495681_0163997 | Ga0495681_0163997_34_747 | 226 |
| 347 | 3300047471 | Ga0495684_0000084 | Ga0495684_0000084_47999_48766 | 226 |
| 348 | 3300047673 | Ga0495593_0000733 | Ga0495593_0000733_3060_3827 | 226 |
| 349 | 3300047673 | Ga0495593_0249963 | Ga0495593_0249963_12_788 | 226 |
| 350 | 3300048088 | Ga0495602_0000073 | Ga0495602_0000073_47445_48212 | 226 |
| 351 | 3300048903 | Ga0496100_0002178 | Ga0496100_0002178_3881_4594 | 226 |
| 352 | 3300048903 | Ga0496100_0094057 | Ga0496100_0094057_803_1516 | 226 |
| 353 | 3300048903 | Ga0496100_0104996 | Ga0496100_0104996_527_1240 | 226 |
| 354 | 3300048903 | Ga0496100_0111865 | Ga0496100_0111865_1060_1773 | 226 |
| 355 | 3300048904 | Ga0496101_0003990 | Ga0496101_0003990_5171_5884 | 226 |
| 356 | 3300048904 | Ga0496101_0095326 | Ga0496101_0095326_1331_2044 | 226 |
| 357 | 3300048905 | Ga0496102_0000871 | Ga0496102_0000871_12562_13275 | 226 |
| 358 | 3300048905 | Ga0496102_0010266 | Ga0496102_0010266_4561_5274 | 226 |
| 359 | 3300048906 | Ga0496103_0003369 | Ga0496103_0003369_549_1262 | 226 |
| 360 | 3300048906 | Ga0496103_0003600 | Ga0496103_0003600_1601_2314 | 226 |
| 361 | 3300048906 | Ga0496103_0313909 | Ga0496103_0313909_188_901 | 226 |
| 362 | 3300048906 | Ga0496103_0447325 | Ga0496103_0447325_13_726 | 226 |
| 363 | 3300048907 | Ga0496104_0000445 | Ga0496104_0000445_4592_5305 | 226 |
| 364 | 3300048907 | Ga0496104_0000880 | Ga0496104_0000880_5354_6067 | 226 |
| 365 | 3300048907 | Ga0496104_0002378 | Ga0496104_0002378_14328_15041 | 226 |
| 366 | 3300048907 | Ga0496104_0005871 | Ga0496104_0005871_5569_6282 | 226 |
| 367 | 3300048907 | Ga0496104_0164149 | Ga0496104_0164149_544_1290 | 226 |
| 368 | 3300048908 | Ga0496105_0000514 | Ga0496105_0000514_21117_21830 | 226 |
| 369 | 3300048908 | Ga0496105_0006690 | Ga0496105_0006690_4126_4839 | 226 |
| 370 | 3300048908 | Ga0496105_0080877 | Ga0496105_0080877_362_1075 | 226 |
| 371 | 3300048908 | Ga0496105_0088570 | Ga0496105_0088570_1270_1983 | 226 |
| 372 | 3300048909 | Ga0496106_0007908 | Ga0496106_0007908_2538_3251 | 226 |
| 373 | 3300048909 | Ga0496106_0061247 | Ga0496106_0061247_93_806 | 226 |
| 374 | 3300048909 | Ga0496106_0141897 | Ga0496106_0141897_123_836 | 226 |
| 375 | 3300048909 | Ga0496106_0319960 | Ga0496106_0319960_88_801 | 226 |
| 376 | 3300048910 | Ga0496107_0000769 | Ga0496107_0000769_5981_6694 | 226 |
| 377 | 3300048910 | Ga0496107_0060279 | Ga0496107_0060279_268_981 | 226 |
| 378 | 3300048910 | Ga0496107_0297076 | Ga0496107_0297076_423_1169 | 226 |
| 379 | 3300048911 | Ga0496108_0003421 | Ga0496108_0003421_282_995 | 226 |
| 380 | 3300048911 | Ga0496108_0005851 | Ga0496108_0005851_3743_4456 | 226 |
| 381 | 3300048911 | Ga0496108_0442487 | Ga0496108_0442487_131_844 | 226 |
| 382 | 3300048911 | Ga0496108_0452102 | Ga0496108_0452102_359_1072 | 226 |
| 383 | 3300048912 | Ga0496109_0002011 | Ga0496109_0002011_8906_9619 | 226 |
| 384 | 3300048912 | Ga0496109_0046860 | Ga0496109_0046860_3137_3850 | 226 |
| 385 | 3300048912 | Ga0496109_0601801 | Ga0496109_0601801_297_1010 | 226 |
| 386 | 3300048912 | Ga0496109_0982848 | Ga0496109_0982848_55_768 | 226 |
| 387 | 3300048913 | Ga0496110_0002034 | Ga0496110_0002034_5853_6566 | 226 |
| 388 | 3300048913 | Ga0496110_0012856 | Ga0496110_0012856_2292_3005 | 226 |
| 389 | 3300048913 | Ga0496110_0175660 | Ga0496110_0175660_151_864 | 226 |
| 390 | 3300048913 | Ga0496110_0550176 | Ga0496110_0550176_80_793 | 226 |
| 391 | 3300048914 | Ga0496111_0000072 | Ga0496111_0000072_14586_15299 | 226 |
| 392 | 3300048914 | Ga0496111_0000641 | Ga0496111_0000641_6274_6987 | 226 |
| 393 | 3300048915 | Ga0496112_0000112 | Ga0496112_0000112_12083_12796 | 226 |
| 394 | 3300048915 | Ga0496112_0009026 | Ga0496112_0009026_7737_8450 | 226 |
| 395 | 3300048916 | Ga0496113_0000058 | Ga0496113_0000058_29100_29813 | 226 |
| 396 | 3300048916 | Ga0496113_0001260 | Ga0496113_0001260_4638_5351 | 226 |
| 397 | 3300048916 | Ga0496113_0032424 | Ga0496113_0032424_1917_2630 | 226 |
| 398 | 3300048916 | Ga0496113_0242153 | Ga0496113_0242153_149_862 | 226 |
| 399 | 3300048916 | Ga0496113_0646119 | Ga0496113_0646119_10_723 | 226 |
| 400 | 3300048917 | Ga0496114_0016624 | Ga0496114_0016624_624_1337 | 226 |
| 401 | 3300048917 | Ga0496114_0017394 | Ga0496114_0017394_1259_1972 | 226 |
| 402 | 3300048917 | Ga0496114_0260038 | Ga0496114_0260038_341_1054 | 226 |
| 403 | 3300048917 | Ga0496114_0377686 | Ga0496114_0377686_329_1042 | 226 |
| 404 | 3300048918 | Ga0496115_0013126 | Ga0496115_0013126_3101_3814 | 226 |
| 405 | 3300048918 | Ga0496115_0022047 | Ga0496115_0022047_2951_3664 | 226 |
| 406 | 3300048918 | Ga0496115_0055864 | Ga0496115_0055864_1707_2420 | 226 |
| 407 | 3300048918 | Ga0496115_0066392 | Ga0496115_0066392_255_968 | 226 |
| 408 | 3300049575 | Ga0501039_0365910 | Ga0501039_0365910_116_832 | 226 |
| 409 | 3300049576 | Ga0501040_0254894 | Ga0501040_0254894_342_1055 | 226 |
| 410 | 3300049587 | Ga0501071_0401230 | Ga0501071_0401230_52_765 | 226 |
| 411 | 3300049588 | Ga0501072_0086528 | Ga0501072_0086528_799_1512 | 226 |
| 412 | 3300049588 | Ga0501072_0140284 | Ga0501072_0140284_1105_1821 | 226 |
| 413 | 3300049589 | Ga0501073_0233707 | Ga0501073_0233707_62_778 | 226 |
| 414 | 3300049590 | Ga0501074_0305981 | Ga0501074_0305981_13_726 | 226 |
| 415 | 3300049591 | Ga0501075_0147293 | Ga0501075_0147293_32_745 | 226 |
| 416 | 3300049741 | Ga0501079_0220169 | Ga0501079_0220169_719_1432 | 226 |
| 417 | 3300049741 | Ga0501079_0484858 | Ga0501079_0484858_147_860 | 226 |
| 418 | 3300049742 | Ga0501080_0079145 | Ga0501080_0079145_70_786 | 226 |
| 419 | 3300049743 | Ga0501081_0093692 | Ga0501081_0093692_1355_2068 | 226 |
| 420 | 3300049743 | Ga0501081_0143487 | Ga0501081_0143487_517_1230 | 226 |
| 421 | 3300050489 | nmdc:mga03683_14426_c1 | nmdc:mga03683_14426_c1_2104_2817 | 226 |
| 422 | 3300050490 | nmdc:mga03n38_34639_c1 | nmdc:mga03n38_34639_c1_607_1329 | 226 |
| 423 | 3300050491 | nmdc:mga00v17_42897_c1 | nmdc:mga00v17_42897_c1_1646_2359 | 226 |
| 424 | 3300050492 | nmdc:mga0yw44_271252_c1 | nmdc:mga0yw44_271252_c1_148_861 | 226 |
| 425 | 3300050492 | nmdc:mga0yw44_501_c1 | nmdc:mga0yw44_501_c1_575_1288 | 226 |
| 426 | 3300050492 | nmdc:mga0yw44_8423_c1 | nmdc:mga0yw44_8423_c1_4312_5025 | 226 |
| 427 | 3300050493 | nmdc:mga0k408_18592_c1 | nmdc:mga0k408_18592_c1_1401_2114 | 226 |
| 428 | 3300050493 | nmdc:mga0k408_333725_c1 | nmdc:mga0k408_333725_c1_20_742 | 226 |
| 429 | 3300050493 | nmdc:mga0k408_357889_c1 | nmdc:mga0k408_357889_c1_43_756 | 226 |
| 430 | 3300050493 | nmdc:mga0k408_73512_c1 | nmdc:mga0k408_73512_c1_832_1545 | 226 |
| 431 | 3300050494 | nmdc:mga06z11_23381_c1 | nmdc:mga06z11_23381_c1_423_1145 | 226 |
| 432 | 3300050494 | nmdc:mga06z11_67316_c1 | nmdc:mga06z11_67316_c1_260_982 | 226 |
| 433 | 3300050495 | nmdc:mga04h51_3760_c1 | nmdc:mga04h51_3760_c1_1213_1935 | 226 |
| 434 | 3300050496 | nmdc:mga07m45_30674_c1 | nmdc:mga07m45_30674_c1_981_1703 | 226 |
| 435 | 3300050496 | nmdc:mga07m45_63074_c1 | nmdc:mga07m45_63074_c1_1124_1837 | 226 |
| 436 | 3300050507 | nmdc:mga05p37_106824_c1 | nmdc:mga05p37_106824_c1_1241_1990 | 226 |
| 437 | 3300050507 | nmdc:mga05p37_40386_c1 | nmdc:mga05p37_40386_c1_3012_3725 | 226 |
| 438 | 3300050507 | nmdc:mga05p37_50472_c1 | nmdc:mga05p37_50472_c1_3464_4177 | 226 |
| 439 | 3300050507 | nmdc:mga05p37_853690_c1 | nmdc:mga05p37_853690_c1_28_741 | 226 |
| 440 | 3300050508 | nmdc:mga09592_21633_c1 | nmdc:mga09592_21633_c1_3592_4341 | 226 |
| 441 | 3300050509 | nmdc:mga0qj67_70370_c1 | nmdc:mga0qj67_70370_c1_889_1638 | 226 |
| 442 | 3300050510 | nmdc:mga06r32_29045_c1 | nmdc:mga06r32_29045_c1_936_1649 | 226 |
| 443 | 3300050510 | nmdc:mga06r32_290594_c1 | nmdc:mga06r32_290594_c1_609_1322 | 226 |
| 444 | 3300050510 | nmdc:mga06r32_56117_c1 | nmdc:mga06r32_56117_c1_2987_3736 | 226 |
| 445 | 3300050511 | nmdc:mga08y16_115077_c1 | nmdc:mga08y16_115077_c1_957_1670 | 226 |
| 446 | 3300050511 | nmdc:mga08y16_609216_c1 | nmdc:mga08y16_609216_c1_41_754 | 226 |
| 447 | 3300050511 | nmdc:mga08y16_718063_c1 | nmdc:mga08y16_718063_c1_178_891 | 226 |
| 448 | 3300050512 | nmdc:mga0n895_120457_c1 | nmdc:mga0n895_120457_c1_477_1253 | 226 |
| 449 | 3300050512 | nmdc:mga0n895_16977_c1 | nmdc:mga0n895_16977_c1_4461_5219 | 226 |
| 450 | 3300050512 | nmdc:mga0n895_26569_c1 | nmdc:mga0n895_26569_c1_3614_4435 | 226 |
| 451 | 3300050512 | nmdc:mga0n895_29161_c1 | nmdc:mga0n895_29161_c1_1650_2363 | 226 |
| 452 | 3300050512 | nmdc:mga0n895_78332_c1 | nmdc:mga0n895_78332_c1_906_1619 | 226 |
| 453 | 3300050513 | nmdc:mga0rr50_527385_c1 | nmdc:mga0rr50_527385_c1_205_981 | 226 |
| 454 | 3300050514 | nmdc:mga08x19_112578_c1 | nmdc:mga08x19_112578_c1_1014_1790 | 226 |
| 455 | 3300050514 | nmdc:mga08x19_39937_c1 | nmdc:mga08x19_39937_c1_431_1201 | 226 |
| 456 | 3300050514 | nmdc:mga08x19_6_c1 | nmdc:mga08x19_6_c1_324645_325358 | 226 |
| 457 | 3300050515 | nmdc:mga0a205_19052_c1 | nmdc:mga0a205_19052_c1_5175_5996 | 226 |
| 458 | 3300050515 | nmdc:mga0a205_461170_c1 | nmdc:mga0a205_461170_c1_234_947 | 226 |
| 459 | 3300053077 | Ga0495601_0000009 | Ga0495601_0000009_47445_48212 | 226 |
| 460 | 3300053077 | Ga0495601_0064102 | Ga0495601_0064102_849_1562 | 226 |
| 461 | 3300053077 | Ga0495601_0117244 | Ga0495601_0117244_617_1330 | 226 |
| 462 | 3300053077 | Ga0495601_0199444 | Ga0495601_0199444_202_915 | 226 |
| 463 | 3300053078 | Ga0495612_0000019 | Ga0495612_0000019_89616_90383 | 226 |
| 464 | 3300053078 | Ga0495612_0020957 | Ga0495612_0020957_1411_2124 | 226 |
| 465 | 3300053084 | Ga0495595_0000015 | Ga0495595_0000015_28700_29467 | 226 |
| 466 | 3300053084 | Ga0495595_0030029 | Ga0495595_0030029_889_1602 | 226 |
| 467 | 3300053084 | Ga0495595_0109817 | Ga0495595_0109817_510_1223 | 226 |
| 468 | 3300053085 | Ga0495619_0000012 | Ga0495619_0000012_47445_48212 | 226 |
| 469 | 3300053085 | Ga0495619_0008018 | Ga0495619_0008018_4548_5261 | 226 |
| 470 | 3300053085 | Ga0495619_0037660 | Ga0495619_0037660_1840_2553 | 226 |
| 471 | 3300053117 | Ga0500593_002603 | Ga0500593_002603_1074_1787 | 226 |
| 472 | 3300053130 | Ga0500642_0211606 | Ga0500642_0211606_72_785 | 226 |
| 473 | 3300053136 | Ga0500559_0154682 | Ga0500559_0154682_263_1024 | 226 |
| 474 | 3300054114 | Ga0501084_0036290 | Ga0501084_0036290_2574_3287 | 226 |
| 475 | 3300054114 | Ga0501084_0037753 | Ga0501084_0037753_378_1094 | 226 |
| 476 | 3300054114 | Ga0501084_0383110 | Ga0501084_0383110_155_868 | 226 |
| 477 | 3300060353 | Ga0501082_0206020 | Ga0501082_0206020_312_1028 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dap-assembly1.cif.gz_A | the structure of escherichia coli sfsa | 0.893 | 1 | 226 |
| 4dap-assembly1.cif.gz_A | the structure of escherichia coli sfsa | 0.8893 | 1 | 226 |
| 4da2-assembly1.cif.gz_A | the structure of pyrococcus furiosus sfsa in complex with ca2+ | 0.857 | 1 | 226 |
| 4da2-assembly1.cif.gz_A | the structure of pyrococcus furiosus sfsa in complex with ca2+ | 0.8534 | 1 | 226 |
| 2wg5-assembly1.cif.gz_A | proteasome-activating nucleotidase (pan) n-domain (57-134) from archaeoglobus fulgidus fused to gcn4 | 0.7885 | 5 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dapA02 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.9599 | 94 | 226 | 3.40.1350.60 |
| 4davA02 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.9184 | 100 | 226 | 3.40.1350.60 |
| 4dapA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.9181 | 1 | 83 | 2.40.50.580 |
| 4dapA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.9074 | 1 | 83 | 2.40.50.580 |
| 4dapA02 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.8254 | 94 | 226 | 3.40.1350.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7JZE6-F1-model_v4 | DNA/RNA nuclease SfsA | 0.9857 | 123 | 226 |
GO:0003677
|
| AF-A0A7C7FX38-F1-model_v4 | DNA/RNA nuclease SfsA | 0.9846 | 102 | 226 |
GO:0003677
|
| AF-A0A3S4EF02-F1-model_v4 | deleted | 0.9845 | 137 | 225 |
|
| AF-A0A7V0WM14-F1-model_v4 | DNA/RNA nuclease SfsA | 0.9843 | 94 | 226 |
GO:0003677
|
| AF-A0A258ZPU7-F1-model_v4 | Sugar fermentation stimulation protein SfsA | 0.9843 | 100 | 226 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar