F451677

General Info

Members Datasets Scaffolds Average Seq Length
477 216 954 288

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10000306|Ga0075433_1000030618
Length 335
Sequence MTSQVRRLCRVGIPWMTESRAQFRDPAAVFVPVQYSARMKRREFLAGLAASPFAAAATLGPARTAAQQGAVAARTRTKLKQSVMASVWGMGSTTSFEERCKILARIGFKGVDLPTAEQVPILKQYGLAPALMTGAGTTFQDGLIRKELHDKFEAAFHQGIDTCASVGCPTLIAMPGERRGMSREESVDNAAAILSRVKSYAEQKNVTLCMEITNSKVVADQRTDQVFNHLAWGFDVCKKVNSPRVKILYDIYHVQIMDGDVVRNLRDNIDLICHIHTAGVPSRQEIDDTQELNYRFIANAIADLGFTGFVAHEHRPGMGRDPVKSLEQCFQIMDV

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.63
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 15.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10000306 3300006852 Bacteria 29607
2 JGI24746J21847_1003097 3300001977 Archaea 2616
3 Ga0065714_10107229 3300005288 Bacteria 1535
4 Ga0065712_10067782 3300005290 Bacteria 36753
5 Ga0065712_10072622 3300005290 Bacteria 4669
6 Ga0065707_10164661 3300005295 Bacteria 1533
7 Ga0070676_10012040 3300005328 Bacteria 4714
8 Ga0070676_10076532 3300005328 Bacteria 2020
9 Ga0070676_10171970 3300005328 Bacteria 1402
10 Ga0070683_100000060 3300005329 Bacteria 81504
11 Ga0070683_100009831 3300005329 Bacteria 8195
12 Ga0070683_100020482 3300005329 Bacteria 5886
13 Ga0070683_100039412 3300005329 Bacteria 4337
14 Ga0070690_100008453 3300005330 Bacteria 5929
15 Ga0070690_100014999 3300005330 Bacteria 4611
16 Ga0070690_100079628 3300005330 Bacteria 2142
17 Ga0070670_100008316 3300005331 Bacteria 8843
18 Ga0068869_100024472 3300005334 Bacteria 4183
19 Ga0068869_100056851 3300005334 Unclassified 2854
20 Ga0070666_10004085 3300005335 Bacteria 8866
21 Ga0070680_100044496 3300005336 Unclassified 3607
22 Ga0070680_100314372 3300005336 Bacteria 1329
23 Ga0068868_100076259 3300005338 Bacteria 2680
24 Ga0068868_100202906 3300005338 Bacteria 1654
25 Ga0070660_100213697 3300005339 Bacteria 1566
26 Ga0070689_100022344 3300005340 Bacteria 4723
27 Ga0070689_100473510 3300005340 Bacteria 1069
28 Ga0070691_10007723 3300005341 Unclassified 4926
29 Ga0070687_100002054 3300005343 Bacteria 7398
30 Ga0070661_100032448 3300005344 Unclassified 3781
31 Ga0070661_100032667 3300005344 Bacteria 3767
32 Ga0070661_100125755 3300005344 Bacteria 1923
33 Ga0070692_10020865 3300005345 Unclassified 3181
34 Ga0070668_100170453 3300005347 Bacteria 1772
35 Ga0070668_100198441 3300005347 Bacteria 1647
36 Ga0070669_100019394 3300005353 Bacteria 4857
37 Ga0070669_100058386 3300005353 Unclassified 2831
38 Ga0070675_100000292 3300005354 Bacteria 33370
39 Ga0070675_100033191 3300005354 Bacteria 4183
40 Ga0070671_100001918 3300005355 Bacteria 15929
41 Ga0070671_100005106 3300005355 Bacteria 10450
42 Ga0070671_100057605 3300005355 Bacteria 3234
43 Ga0070673_100002083 3300005364 Bacteria 12068
44 Ga0070673_100005896 3300005364 Bacteria 7907
45 Ga0070673_100022532 3300005364 Bacteria 4586
46 Ga0070673_100088237 3300005364 Bacteria 2529
47 Ga0070673_100178245 3300005364 Bacteria 1818
48 Ga0070673_100203943 3300005364 Bacteria 1704
49 Ga0070667_100134345 3300005367 Bacteria 2162
50 Ga0070667_100191598 3300005367 Bacteria 1811
51 Ga0070709_10026805 3300005434 Bacteria 3420
52 Ga0070714_100038678 3300005435 Bacteria 4012
53 Ga0070714_100562818 3300005435 Bacteria 1092
54 Ga0070713_100020307 3300005436 Bacteria 5091
55 Ga0070713_100094324 3300005436 Bacteria 2580
56 Ga0070701_10061793 3300005438 Bacteria 1976
57 Ga0070711_100039922 3300005439 Bacteria 3163
58 Ga0070700_100007738 3300005441 Bacteria 5821
59 Ga0070708_100034116 3300005445 Bacteria 4426
60 Ga0070678_100033147 3300005456 Bacteria 3583
61 Ga0070662_100167800 3300005457 Bacteria 1721
62 Ga0070681_10005354 3300005458 Bacteria 12388
63 Ga0070681_10084577 3300005458 Unclassified 3125
64 Ga0068867_100005378 3300005459 Bacteria 9055
65 Ga0070685_10012940 3300005466 Bacteria 4393
66 Ga0070707_100008768 3300005468 Bacteria 9379
67 Ga0070699_100015032 3300005518 Bacteria 6652
68 Ga0070679_100005241 3300005530 Bacteria 12004
69 Ga0070684_100000047 3300005535 Bacteria 81165
70 Ga0070684_100004329 3300005535 Bacteria 10785
71 Ga0070684_100005938 3300005535 Bacteria 9402
72 Ga0068853_100075300 3300005539 Unclassified 2946
73 Ga0070672_100001653 3300005543 Bacteria 13886
74 Ga0070672_100006373 3300005543 Bacteria 7925
75 Ga0070672_100023614 3300005543 Bacteria 4536
76 Ga0070672_100048747 3300005543 Bacteria 3293
77 Ga0070672_100243576 3300005543 Bacteria 1513
78 Ga0070686_100007942 3300005544 Archaea 5933
79 Ga0070686_100018908 3300005544 Bacteria 4052
80 Ga0070695_100173322 3300005545 Bacteria 1523
81 Ga0070665_100074318 3300005548 Archaea 3405
82 Ga0070665_100102991 3300005548 Bacteria 2858
83 Ga0068855_100088565 3300005563 Unclassified 3575
84 Ga0068855_100125997 3300005563 Bacteria 2928
85 Ga0068855_100291498 3300005563 Bacteria 1809
86 Ga0070664_100004194 3300005564 Bacteria 11578
87 Ga0068857_100005128 3300005577 Bacteria 11136
88 Ga0068857_100030166 3300005577 Unclassified 4785
89 Ga0068857_100072658 3300005577 Bacteria 3065
90 Ga0068854_100018840 3300005578 Bacteria 4640
91 Ga0068854_100064335 3300005578 Bacteria 2665
92 Ga0068856_100006538 3300005614 Bacteria 11424
93 Ga0068856_100086798 3300005614 Bacteria 3109
94 Ga0068856_100194283 3300005614 Bacteria 2043
95 Ga0068856_100369552 3300005614 Unclassified 1453
96 Ga0068859_100000473 3300005617 Bacteria 39708
97 Ga0068859_100011033 3300005617 Bacteria 9089
98 Ga0068859_100022061 3300005617 Bacteria 6384
99 Ga0068859_100134622 3300005617 Unclassified 2543
100 Ga0068859_100169456 3300005617 Unclassified 2264
101 Ga0068864_100399898 3300005618 Bacteria 1305
102 Ga0068861_100016394 3300005719 Bacteria 5241
103 Ga0068870_10000557 3300005840 Bacteria 14121
104 Ga0068863_100000242 3300005841 Bacteria 58222
105 Ga0068863_100002178 3300005841 Bacteria 19421
106 Ga0068858_100004810 3300005842 Bacteria 13232
107 Ga0068858_100025402 3300005842 Bacteria 5512
108 Ga0068858_100149345 3300005842 Bacteria 2196
109 Ga0068860_100014201 3300005843 Bacteria 7808
110 Ga0068862_100047212 3300005844 Bacteria 3674
111 Ga0068862_100115080 3300005844 Bacteria 2365
112 Ga0070717_10001609 3300006028 Bacteria 15629
113 Ga0070717_10004207 3300006028 Bacteria 10380
114 Ga0097621_100010178 3300006237 Bacteria 6866
115 Ga0097621_100203192 3300006237 Bacteria 1721
116 Ga0097621_100270159 3300006237 Bacteria 1494
117 Ga0068871_100282609 3300006358 Bacteria 1452
118 Ga0075428_100138352 3300006844 Bacteria 2647
119 Ga0075430_100008606 3300006846 Bacteria 8610
120 Ga0075430_100100555 3300006846 Bacteria 2415
121 Ga0075430_100191540 3300006846 Bacteria 1699
122 Ga0075430_100340208 3300006846 Bacteria 1239
123 Ga0075431_100029658 3300006847 Bacteria 5633
124 Ga0075431_100106602 3300006847 Bacteria 2891
125 Ga0075433_10002723 3300006852 Bacteria 13504
126 Ga0075433_10010783 3300006852 Bacteria 7350
127 Ga0075434_100000788 3300006871 Bacteria 25070
128 Ga0075434_100004699 3300006871 Bacteria 12343
129 Ga0075434_100071180 3300006871 Bacteria 3469
130 Ga0075434_100110985 3300006871 Bacteria 2753
131 Ga0075434_100123248 3300006871 Unclassified 2608
132 Ga0075429_100059692 3300006880 Unclassified 3322
133 Ga0075429_100081578 3300006880 Bacteria 2820
134 Ga0075429_100082579 3300006880 Bacteria 2801
135 Ga0075429_100202010 3300006880 Bacteria 1741
136 Ga0068865_100006919 3300006881 Bacteria 6953
137 Ga0068865_100015429 3300006881 Bacteria 4872
138 Ga0068865_100028135 3300006881 Unclassified 3720
139 Ga0097620_100000473 3300006931 Bacteria 39708
140 Ga0097620_100011033 3300006931 Bacteria 9089
141 Ga0097620_100022059 3300006931 Bacteria 6384
142 Ga0097620_100134625 3300006931 Unclassified 2543
143 Ga0097620_100169449 3300006931 Unclassified 2264
144 Ga0075435_100006465 3300007076 Bacteria 8289
145 Ga0075435_100107924 3300007076 Bacteria 2313
146 Ga0105240_10181692 3300009093 Unclassified 2482
147 Ga0111539_10001301 3300009094 Bacteria 33338
148 Ga0111539_10003311 3300009094 Bacteria 21271
149 Ga0111539_10009519 3300009094 Bacteria 12264
150 Ga0111539_10042452 3300009094 Bacteria 5460
151 Ga0111539_10287812 3300009094 Bacteria 1912
152 Ga0105245_10016988 3300009098 Bacteria 6351
153 Ga0105245_10250658 3300009098 Bacteria 1720
154 Ga0114129_10092057 3300009147 Unclassified 4201
155 Ga0114129_10166128 3300009147 Bacteria 3011
156 Ga0114129_10185050 3300009147 Bacteria 2831
157 Ga0114129_10338092 3300009147 Bacteria 1998
158 Ga0114129_10400717 3300009147 Unclassified 1808
159 Ga0114129_10472923 3300009147 Unclassified 1641
160 Ga0114129_10527309 3300009147 Bacteria 1539
161 Ga0105243_10114905 3300009148 Bacteria 2259
162 Ga0105241_10004405 3300009174 Bacteria 10412
163 Ga0105241_10006886 3300009174 Bacteria 8365
164 Ga0105241_10097958 3300009174 Bacteria 2326
165 Ga0105241_10203675 3300009174 Bacteria 1654
166 Ga0105242_10015959 3300009176 Bacteria 5837
167 Ga0105242_10036185 3300009176 Bacteria 3960
168 Ga0105242_10202702 3300009176 Unclassified 1763
169 Ga0105242_10578932 3300009176 Bacteria 1081
170 Ga0105248_10000530 3300009177 Bacteria 43488
171 Ga0105248_10006354 3300009177 Bacteria 12961
172 Ga0105248_10095867 3300009177 Unclassified 3340
173 Ga0105248_10593083 3300009177 Bacteria 1250
174 Ga0105237_10006327 3300009545 Bacteria 13161
175 Ga0105237_10006700 3300009545 Bacteria 12730
176 Ga0105237_10301873 3300009545 Unclassified 1604
177 Ga0105238_10005319 3300009551 Bacteria 12720
178 Ga0105238_10008867 3300009551 Bacteria 10064
179 Ga0105238_10029097 3300009551 Bacteria 5628
180 Ga0105238_10039448 3300009551 Unclassified 4789
181 Ga0105238_10043243 3300009551 Unclassified 4558
182 Ga0105238_10172333 3300009551 Bacteria 2140
183 Ga0105249_10026467 3300009553 Bacteria 5226
184 Ga0105249_10029868 3300009553 Unclassified 4925
185 Ga0105239_10011794 3300010375 Bacteria 9752
186 Ga0105239_10038037 3300010375 Bacteria 5272
187 Ga0105239_10049590 3300010375 Bacteria 4603
188 Ga0105246_10170203 3300011119 Bacteria 1668
189 Ga0105246_10320456 3300011119 Bacteria 1259
190 Ga0105246_10393839 3300011119 Bacteria 1148
191 Ga0157373_10252673 3300013100 Bacteria 1247
192 Ga0157370_10013851 3300013104 Bacteria 8282
193 Ga0157369_10096833 3300013105 Unclassified 3147
194 Ga0157369_10244676 3300013105 Bacteria 1873
195 Ga0157369_10268410 3300013105 Unclassified 1779
196 Ga0157374_10077462 3300013296 Bacteria 3147
197 Ga0157374_10271542 3300013296 Bacteria 1672
198 Ga0157378_10148370 3300013297 Unclassified 2183
199 Ga0163162_10070831 3300013306 Bacteria 3538
200 Ga0163162_10461360 3300013306 Bacteria 1402
201 Ga0163162_10661824 3300013306 Bacteria 1167
202 Ga0163162_10668649 3300013306 Bacteria 1162
203 Ga0157372_10002930 3300013307 Bacteria 18424
204 Ga0157372_10052064 3300013307 Bacteria 4557
205 Ga0157372_10227107 3300013307 Bacteria 2164
206 Ga0157372_10271268 3300013307 Unclassified 1971
207 Ga0157375_10000876 3300013308 Bacteria 26145
208 Ga0157375_10004497 3300013308 Bacteria 12121
209 Ga0163163_10004595 3300014325 Bacteria 11790
210 Ga0163163_10010604 3300014325 Bacteria 8299
211 Ga0163163_10011918 3300014325 Bacteria 7909
212 Ga0163163_10211705 3300014325 Bacteria 1987
213 Ga0163163_10291753 3300014325 Bacteria 1683
214 Ga0157380_10001818 3300014326 Bacteria 14084
215 Ga0157380_10008683 3300014326 Bacteria 7262
216 Ga0157380_10018040 3300014326 Bacteria 5234
217 Ga0157380_10056683 3300014326 Bacteria 3118
218 Ga0157380_10083968 3300014326 Bacteria 2610
219 Ga0157380_10139857 3300014326 Unclassified 2078
220 Ga0157380_10179520 3300014326 Bacteria 1859
221 Ga0157380_10216025 3300014326 Unclassified 1712
222 Ga0157377_10038786 3300014745 Unclassified 2632
223 Ga0157379_10000084 3300014968 Bacteria 62328
224 Ga0157379_10008024 3300014968 Archaea 9162
225 Ga0157376_10138170 3300014969 Bacteria 2183
226 Ga0157376_10256821 3300014969 Bacteria 1635
227 Ga0157376_10502191 3300014969 Unclassified 1192
228 Ga0163161_10097170 3300017792 Bacteria 2187
229 Ga0207697_10004113 3300025315 Bacteria 7023
230 Ga0207656_10168748 3300025321 Bacteria 1045
231 Ga0207682_10001937 3300025893 Bacteria 9407
232 Ga0207682_10013731 3300025893 Bacteria 3154
233 Ga0207682_10014295 3300025893 Bacteria 3092
234 Ga0207688_10002175 3300025901 Bacteria 10557
235 Ga0207680_10010788 3300025903 Bacteria 4586
236 Ga0207699_10269457 3300025906 Bacteria 1180
237 Ga0207645_10003180 3300025907 Bacteria 12574
238 Ga0207645_10003899 3300025907 Bacteria 11151
239 Ga0207645_10099958 3300025907 Bacteria 1871
240 Ga0207643_10000522 3300025908 Bacteria 24626
241 Ga0207643_10005086 3300025908 Bacteria 7045
242 Ga0207654_10003519 3300025911 Bacteria 7922
243 Ga0207654_10012683 3300025911 Bacteria 4323
244 Ga0207654_10304305 3300025911 Bacteria 1085
245 Ga0207707_10001392 3300025912 Bacteria 22454
246 Ga0207707_10211876 3300025912 Bacteria 1687
247 Ga0207695_10001946 3300025913 Bacteria 32061
248 Ga0207671_10013984 3300025914 Bacteria 6367
249 Ga0207671_10170673 3300025914 Unclassified 1689
250 Ga0207660_10032427 3300025917 Unclassified 3606
251 Ga0207662_10005740 3300025918 Bacteria 6641
252 Ga0207662_10210701 3300025918 Unclassified 1261
253 Ga0207657_10056200 3300025919 Unclassified 3396
254 Ga0207649_10057349 3300025920 Unclassified 2435
255 Ga0207649_10172799 3300025920 Bacteria 1507
256 Ga0207652_10006372 3300025921 Bacteria 9529
257 Ga0207646_10218576 3300025922 Bacteria 1721
258 Ga0207681_10006278 3300025923 Bacteria 7297
259 Ga0207681_10016626 3300025923 Bacteria 4605
260 Ga0207694_10001140 3300025924 Bacteria 23033
261 Ga0207694_10028471 3300025924 Bacteria 4260
262 Ga0207694_10062795 3300025924 Unclassified 2892
263 Ga0207694_10070845 3300025924 Bacteria 2724
264 Ga0207650_10005645 3300025925 Bacteria 8543
265 Ga0207650_10088826 3300025925 Unclassified 2358
266 Ga0207650_10342912 3300025925 Bacteria 1227
267 Ga0207659_10002075 3300025926 Bacteria 11875
268 Ga0207659_10006924 3300025926 Bacteria 6967
269 Ga0207659_10095943 3300025926 Bacteria 2225
270 Ga0207659_10132596 3300025926 Bacteria 1925
271 Ga0207659_10560928 3300025926 Bacteria 971
272 Ga0207687_10001747 3300025927 Bacteria 14939
273 Ga0207687_10013255 3300025927 Bacteria 5382
274 Ga0207700_10006091 3300025928 Bacteria 7267
275 Ga0207664_10357515 3300025929 Bacteria 1293
276 Ga0207644_10034106 3300025931 Bacteria 3561
277 Ga0207644_10218941 3300025931 Bacteria 1508
278 Ga0207706_10071792 3300025933 Bacteria 3045
279 Ga0207706_10113679 3300025933 Bacteria 2381
280 Ga0207706_10260651 3300025933 Bacteria 1513
281 Ga0207686_10006336 3300025934 Bacteria 6366
282 Ga0207686_10042011 3300025934 Bacteria 2792
283 Ga0207709_10020972 3300025935 Bacteria 3693
284 Ga0207709_10074010 3300025935 Unclassified 2172
285 Ga0207670_10070580 3300025936 Bacteria 2413
286 Ga0207670_10138384 3300025936 Bacteria 1793
287 Ga0207669_10208687 3300025937 Bacteria 1424
288 Ga0207704_10037578 3300025938 Bacteria 2798
289 Ga0207704_10300582 3300025938 Bacteria 1229
290 Ga0207691_10000174 3300025940 Bacteria 60256
291 Ga0207691_10004719 3300025940 Bacteria 13186
292 Ga0207691_10009818 3300025940 Bacteria 9190
293 Ga0207691_10042113 3300025940 Bacteria 4210
294 Ga0207691_10070504 3300025940 Bacteria 3155
295 Ga0207691_10072862 3300025940 Bacteria 3098
296 Ga0207691_10301586 3300025940 Bacteria 1376
297 Ga0207711_10004087 3300025941 Bacteria 12514
298 Ga0207711_10030762 3300025941 Unclassified 4528
299 Ga0207711_10631807 3300025941 Bacteria 999
300 Ga0207689_10009037 3300025942 Bacteria 8628
301 Ga0207689_10012960 3300025942 Bacteria 7119
302 Ga0207661_10000045 3300025944 Bacteria 108110
303 Ga0207661_10016060 3300025944 Bacteria 5518
304 Ga0207661_10033186 3300025944 Unclassified 4005
305 Ga0207661_10214152 3300025944 Bacteria 1699
306 Ga0207661_10636005 3300025944 Unclassified 980
307 Ga0207667_10014754 3300025949 Bacteria 8893
308 Ga0207667_10073275 3300025949 Bacteria 3558
309 Ga0207651_10000736 3300025960 Bacteria 14023
310 Ga0207651_10056930 3300025960 Bacteria 2693
311 Ga0207651_10196913 3300025960 Bacteria 1611
312 Ga0207651_10443684 3300025960 Unclassified 1112
313 Ga0207712_10022607 3300025961 Unclassified 4142
314 Ga0207712_10040029 3300025961 Bacteria 3214
315 Ga0207668_10216283 3300025972 Bacteria 1536
316 Ga0207640_10008821 3300025981 Bacteria 5613
317 Ga0207658_10046454 3300025986 Bacteria 3171
318 Ga0207703_10008000 3300026035 Bacteria 8354
319 Ga0207703_10008414 3300026035 Bacteria 8154
320 Ga0207703_10099359 3300026035 Bacteria 2463
321 Ga0207708_10023500 3300026075 Bacteria 4660
322 Ga0207708_10203653 3300026075 Bacteria 1579
323 Ga0207702_10005235 3300026078 Bacteria 11387
324 Ga0207702_10089498 3300026078 Bacteria 2692
325 Ga0207702_10136964 3300026078 Bacteria 2210
326 Ga0207641_10001228 3300026088 Bacteria 25690
327 Ga0207641_10049698 3300026088 Bacteria 3545
328 Ga0207641_10208723 3300026088 Bacteria 1805
329 Ga0207641_10460665 3300026088 Bacteria 1230
330 Ga0207648_10002614 3300026089 Bacteria 19294
331 Ga0207648_10029633 3300026089 Bacteria 4853
332 Ga0207676_10024703 3300026095 Unclassified 4451
333 Ga0207676_10039378 3300026095 Bacteria 3615
334 Ga0207676_10122841 3300026095 Bacteria 2193
335 Ga0207676_10133626 3300026095 Bacteria 2114
336 Ga0207674_10000300 3300026116 Bacteria 62723
337 Ga0207674_10020981 3300026116 Bacteria 7046
338 Ga0207674_10067650 3300026116 Bacteria 3596
339 Ga0207674_10090667 3300026116 Bacteria 3048
340 Ga0207674_10241996 3300026116 Bacteria 1751
341 Ga0207674_10468003 3300026116 Bacteria 1218
342 Ga0207675_100008035 3300026118 Bacteria 9940
343 Ga0207675_100241644 3300026118 Unclassified 1745
344 Ga0207675_100610906 3300026118 Bacteria 1094
345 Ga0207683_10003599 3300026121 Bacteria 13505
346 Ga0207683_10027801 3300026121 Bacteria 4888
347 Ga0207683_10042960 3300026121 Bacteria 3948
348 Ga0207683_10191968 3300026121 Bacteria 1855
349 Ga0207428_10001505 3300027907 Bacteria 24372
350 Ga0207428_10001899 3300027907 Bacteria 21183
351 Ga0207428_10012831 3300027907 Bacteria 7347
352 Ga0207428_10134532 3300027907 Bacteria 1890
353 Ga0207428_10141607 3300027907 Unclassified 1835
354 Ga0268266_10027907 3300028379 Bacteria 4801
355 Ga0268266_10120779 3300028379 Bacteria 2332
356 Ga0268265_10010668 3300028380 Bacteria 6205
357 Ga0268265_10073173 3300028380 Unclassified 2676
358 Ga0268265_10273083 3300028380 Bacteria 1509
359 Ga0268264_10023942 3300028381 Bacteria 4981
360 Ga0268264_10079865 3300028381 Bacteria 2792
361 Ga0268264_10369681 3300028381 Bacteria 1370
362 Ga0265313_10002232 3300031595 Bacteria 17042
363 Ga0307410_10264496 3300031852 Bacteria 1343
364 Ga0373934_0002027 3300035086 Bacteria 7440
365 Ga0373936_0109535 3300035113 Bacteria 1172
366 Ga0373954_0007171 3300035118 Bacteria 4867
367 Ga0373954_0073766 3300035118 Unclassified 1624
368 Ga0373954_0079150 3300035118 Bacteria 1569
369 Ga0373955_0018085 3300035172 Bacteria 3499
370 Ga0373955_0168913 3300035172 Unclassified 1294
371 Ga0373942_0012606 3300035207 Bacteria 2023
372 Ga0373935_0007965 3300035692 Bacteria 6353
373 Ga0373927_0167863 3300035695 Bacteria 1438
374 Ga0373933_0031994 3300035724 Unclassified 3055
375 Ga0373947_0050538 3300035725 Bacteria 2500
376 Ga0373937_0001947 3300036401 Bacteria 17287
377 Ga0373937_0086917 3300036401 Bacteria 2893
378 Ga0373937_0107179 3300036401 Unclassified 2598
379 Ga0373925_0149958 3300037068 Bacteria 1830
380 Ga0373925_0340678 3300037068 Bacteria 1216
381 Ga0436364_0004424 3300037853 Bacteria 7777
382 Ga0436364_0425709 3300037853 Unclassified 1336
383 Ga0451793_0719902 3300041452 Bacteria 1185
384 Ga0451576_0248233 3300045051 Unclassified 1860
385 Ga0495592_0011640 3300046454 Bacteria 6661
386 Ga0495651_0001689 3300046462 Bacteria 17064
387 Ga0495651_0134284 3300046462 Bacteria 1803
388 Ga0495580_0046820 3300046472 Unclassified 3068
389 Ga0495580_0180822 3300046472 Bacteria 1456
390 Ga0495582_0013032 3300046473 Unclassified 4579
391 Ga0495662_0000630 3300046476 Bacteria 16413
392 Ga0495664_0000501 3300046477 Bacteria 19511
393 Ga0495664_0393708 3300046477 Bacteria 832
394 Ga0495628_0002217 3300046516 Bacteria 17575
395 Ga0495630_0334252 3300046517 Bacteria 1159
396 Ga0495652_0062924 3300046529 Bacteria 3126
397 Ga0495652_0185719 3300046529 Bacteria 1591
398 Ga0495586_0026289 3300046535 Unclassified 3114
399 Ga0495587_0000867 3300046536 Bacteria 19997
400 Ga0495587_0028091 3300046536 Bacteria 3424
401 Ga0495598_0048459 3300046537 Unclassified 1270
402 Ga0495645_0004796 3300046543 Bacteria 9240
403 Ga0495645_0086859 3300046543 Unclassified 2238
404 Ga0495645_0131033 3300046543 Bacteria 1757
405 Ga0495645_0210335 3300046543 Bacteria 1314
406 Ga0495667_0028554 3300046559 Bacteria 3757
407 Ga0495667_0410821 3300046559 Bacteria 852
408 Ga0495635_0012683 3300046663 Bacteria 5911
409 Ga0495635_0203246 3300046663 Bacteria 1343
410 Ga0495657_0114831 3300046675 Bacteria 1702
411 Ga0495657_0182503 3300046675 Bacteria 1287
412 Ga0495599_0176051 3300046678 Bacteria 1319
413 Ga0495623_0034057 3300046679 Bacteria 3267
414 Ga0495646_0061331 3300046680 Bacteria 2240
415 Ga0495658_0042323 3300046683 Bacteria 2543
416 Ga0495613_0073244 3300046689 Bacteria 2496
417 Ga0495600_0042085 3300046809 Bacteria 2978
418 Ga0495600_0119925 3300046809 Bacteria 1711
419 Ga0495604_0015633 3300047317 Bacteria 6059
420 Ga0495674_0003025 3300047319 Bacteria 16367
421 Ga0495680_0010492 3300047322 Bacteria 8267
422 Ga0495675_0004731 3300047444 Bacteria 8265
423 Ga0495675_0141417 3300047444 Bacteria 1491
424 Ga0495675_0222398 3300047444 Bacteria 1142
425 Ga0495675_0274305 3300047444 Bacteria 1007
426 Ga0495684_0009093 3300047471 Bacteria 7673
427 Ga0495684_0044075 3300047471 Bacteria 3415
428 Ga0495684_0117285 3300047471 Bacteria 2006
429 Ga0495602_0004278 3300048088 Bacteria 14867
430 Ga0495602_0055553 3300048088 Bacteria 3487
431 Ga0496111_0346229 3300048914 Bacteria 1100
432 Ga0496112_0143256 3300048915 Bacteria 2359
433 Ga0501040_0065571 3300049576 Bacteria 2501
434 Ga0501041_0252406 3300049577 Bacteria 1109
435 Ga0501071_0054347 3300049587 Bacteria 2890
436 Ga0501075_0010727 3300049591 Bacteria 6451
437 Ga0501076_0098641 3300049592 Bacteria 2353
438 Ga0501080_0105786 3300049742 Bacteria 2609
439 Ga0501081_0063282 3300049743 Unclassified 2567
440 nmdc:mga05p37_166768_c1 3300050507 Bacteria 2687
441 nmdc:mga05p37_40432_c1 3300050507 Bacteria 5727
442 nmdc:mga05p37_411916_c1 3300050507 Unclassified 1575
443 nmdc:mga05p37_52595_c1 3300050507 Bacteria 5007
444 nmdc:mga05p37_569128_c1 3300050507 Bacteria 1286
445 nmdc:mga05p37_99937_c1 3300050507 Bacteria 3573
446 nmdc:mga09592_115634_c1 3300050508 Bacteria 2302
447 nmdc:mga09592_157028_c1 3300050508 Bacteria 1964
448 nmdc:mga09592_350431_c1 3300050508 Unclassified 1278
449 nmdc:mga09592_48518_c1 3300050508 Bacteria 3579
450 nmdc:mga09592_99519_c1 3300050508 Bacteria 2489
451 nmdc:mga0qj67_110600_c1 3300050509 Bacteria 2218
452 nmdc:mga0qj67_136731_c1 3300050509 Bacteria 1986
453 nmdc:mga06r32_132165_c1 3300050510 Bacteria 2469
454 nmdc:mga06r32_133108_c1 3300050510 Unclassified 2460
455 nmdc:mga06r32_17247_c1 3300050510 Bacteria 6591
456 nmdc:mga08y16_152_c1 3300050511 Bacteria 59962
457 nmdc:mga08y16_213218_c1 3300050511 Bacteria 2000
458 nmdc:mga08y16_352421_c1 3300050511 Bacteria 1512
459 nmdc:mga08y16_379022_c1 3300050511 Bacteria 1450
460 nmdc:mga08y16_396760_c1 3300050511 Bacteria 1413
461 nmdc:mga08y16_41028_c1 3300050511 Bacteria 4849
462 nmdc:mga0n895_145392_c1 3300050512 Bacteria 2400
463 nmdc:mga0n895_268968_c1 3300050512 Unclassified 1729
464 nmdc:mga0n895_282412_c1 3300050512 Unclassified 1683
465 nmdc:mga0n895_325599_c1 3300050512 Bacteria 1557
466 nmdc:mga0n895_4002_c1 3300050512 Bacteria 11984
467 nmdc:mga0n895_42668_c1 3300050512 Unclassified 4414
468 nmdc:mga0n895_48402_c1 3300050512 Bacteria 4161
469 nmdc:mga0rr50_21487_c1 3300050513 Unclassified 4406
470 nmdc:mga0rr50_6750_c1 3300050513 Bacteria 7027
471 nmdc:mga0a205_165687_c1 3300050515 Unclassified 2105
472 nmdc:mga0a205_410_c2 3300050515 Bacteria 27270
473 nmdc:mga0a205_6872_c1 3300050515 Bacteria 10294
474 nmdc:mga0a205_92304_c1 3300050515 Bacteria 2925
475 Ga0501084_0144255 3300054114 Unclassified 2005
476 Ga0501082_0005658 3300060353 Bacteria 10845
477 Ga0530510_0050289 3300061734 Bacteria 3011
478 Ga0075433_10000306
479 JGI24746J21847_1003097
480 Ga0065714_10107229
481 Ga0065712_10067782
482 Ga0065712_10072622
483 Ga0065707_10164661
484 Ga0070676_10012040
485 Ga0070676_10076532
486 Ga0070676_10171970
487 Ga0070683_100000060
488 Ga0070683_100009831
489 Ga0070683_100020482
490 Ga0070683_100039412
491 Ga0070690_100008453
492 Ga0070690_100014999
493 Ga0070690_100079628
494 Ga0070670_100008316
495 Ga0068869_100024472
496 Ga0068869_100056851
497 Ga0070666_10004085
498 Ga0070680_100044496
499 Ga0070680_100314372
500 Ga0068868_100076259
501 Ga0068868_100202906
502 Ga0070660_100213697
503 Ga0070689_100022344
504 Ga0070689_100473510
505 Ga0070691_10007723
506 Ga0070687_100002054
507 Ga0070661_100032448
508 Ga0070661_100032667
509 Ga0070661_100125755
510 Ga0070692_10020865
511 Ga0070668_100170453
512 Ga0070668_100198441
513 Ga0070669_100019394
514 Ga0070669_100058386
515 Ga0070675_100000292
516 Ga0070675_100033191
517 Ga0070671_100001918
518 Ga0070671_100005106
519 Ga0070671_100057605
520 Ga0070673_100002083
521 Ga0070673_100005896
522 Ga0070673_100022532
523 Ga0070673_100088237
524 Ga0070673_100178245
525 Ga0070673_100203943
526 Ga0070667_100134345
527 Ga0070667_100191598
528 Ga0070709_10026805
529 Ga0070714_100038678
530 Ga0070714_100562818
531 Ga0070713_100020307
532 Ga0070713_100094324
533 Ga0070701_10061793
534 Ga0070711_100039922
535 Ga0070700_100007738
536 Ga0070708_100034116
537 Ga0070678_100033147
538 Ga0070662_100167800
539 Ga0070681_10005354
540 Ga0070681_10084577
541 Ga0068867_100005378
542 Ga0070685_10012940
543 Ga0070707_100008768
544 Ga0070699_100015032
545 Ga0070679_100005241
546 Ga0070684_100000047
547 Ga0070684_100004329
548 Ga0070684_100005938
549 Ga0068853_100075300
550 Ga0070672_100001653
551 Ga0070672_100006373
552 Ga0070672_100023614
553 Ga0070672_100048747
554 Ga0070672_100243576
555 Ga0070686_100007942
556 Ga0070686_100018908
557 Ga0070695_100173322
558 Ga0070665_100074318
559 Ga0070665_100102991
560 Ga0068855_100088565
561 Ga0068855_100125997
562 Ga0068855_100291498
563 Ga0070664_100004194
564 Ga0068857_100005128
565 Ga0068857_100030166
566 Ga0068857_100072658
567 Ga0068854_100018840
568 Ga0068854_100064335
569 Ga0068856_100006538
570 Ga0068856_100086798
571 Ga0068856_100194283
572 Ga0068856_100369552
573 Ga0068859_100000473
574 Ga0068859_100011033
575 Ga0068859_100022061
576 Ga0068859_100134622
577 Ga0068859_100169456
578 Ga0068864_100399898
579 Ga0068861_100016394
580 Ga0068870_10000557
581 Ga0068863_100000242
582 Ga0068863_100002178
583 Ga0068858_100004810
584 Ga0068858_100025402
585 Ga0068858_100149345
586 Ga0068860_100014201
587 Ga0068862_100047212
588 Ga0068862_100115080
589 Ga0070717_10001609
590 Ga0070717_10004207
591 Ga0097621_100010178
592 Ga0097621_100203192
593 Ga0097621_100270159
594 Ga0068871_100282609
595 Ga0075428_100138352
596 Ga0075430_100008606
597 Ga0075430_100100555
598 Ga0075430_100191540
599 Ga0075430_100340208
600 Ga0075431_100029658
601 Ga0075431_100106602
602 Ga0075433_10002723
603 Ga0075433_10010783
604 Ga0075434_100000788
605 Ga0075434_100004699
606 Ga0075434_100071180
607 Ga0075434_100110985
608 Ga0075434_100123248
609 Ga0075429_100059692
610 Ga0075429_100081578
611 Ga0075429_100082579
612 Ga0075429_100202010
613 Ga0068865_100006919
614 Ga0068865_100015429
615 Ga0068865_100028135
616 Ga0097620_100000473
617 Ga0097620_100011033
618 Ga0097620_100022059
619 Ga0097620_100134625
620 Ga0097620_100169449
621 Ga0075435_100006465
622 Ga0075435_100107924
623 Ga0105240_10181692
624 Ga0111539_10001301
625 Ga0111539_10003311
626 Ga0111539_10009519
627 Ga0111539_10042452
628 Ga0111539_10287812
629 Ga0105245_10016988
630 Ga0105245_10250658
631 Ga0114129_10092057
632 Ga0114129_10166128
633 Ga0114129_10185050
634 Ga0114129_10338092
635 Ga0114129_10400717
636 Ga0114129_10472923
637 Ga0114129_10527309
638 Ga0105243_10114905
639 Ga0105241_10004405
640 Ga0105241_10006886
641 Ga0105241_10097958
642 Ga0105241_10203675
643 Ga0105242_10015959
644 Ga0105242_10036185
645 Ga0105242_10202702
646 Ga0105242_10578932
647 Ga0105248_10000530
648 Ga0105248_10006354
649 Ga0105248_10095867
650 Ga0105248_10593083
651 Ga0105237_10006327
652 Ga0105237_10006700
653 Ga0105237_10301873
654 Ga0105238_10005319
655 Ga0105238_10008867
656 Ga0105238_10029097
657 Ga0105238_10039448
658 Ga0105238_10043243
659 Ga0105238_10172333
660 Ga0105249_10026467
661 Ga0105249_10029868
662 Ga0105239_10011794
663 Ga0105239_10038037
664 Ga0105239_10049590
665 Ga0105246_10170203
666 Ga0105246_10320456
667 Ga0105246_10393839
668 Ga0157373_10252673
669 Ga0157370_10013851
670 Ga0157369_10096833
671 Ga0157369_10244676
672 Ga0157369_10268410
673 Ga0157374_10077462
674 Ga0157374_10271542
675 Ga0157378_10148370
676 Ga0163162_10070831
677 Ga0163162_10461360
678 Ga0163162_10661824
679 Ga0163162_10668649
680 Ga0157372_10002930
681 Ga0157372_10052064
682 Ga0157372_10227107
683 Ga0157372_10271268
684 Ga0157375_10000876
685 Ga0157375_10004497
686 Ga0163163_10004595
687 Ga0163163_10010604
688 Ga0163163_10011918
689 Ga0163163_10211705
690 Ga0163163_10291753
691 Ga0157380_10001818
692 Ga0157380_10008683
693 Ga0157380_10018040
694 Ga0157380_10056683
695 Ga0157380_10083968
696 Ga0157380_10139857
697 Ga0157380_10179520
698 Ga0157380_10216025
699 Ga0157377_10038786
700 Ga0157379_10000084
701 Ga0157379_10008024
702 Ga0157376_10138170
703 Ga0157376_10256821
704 Ga0157376_10502191
705 Ga0163161_10097170
706 Ga0207697_10004113
707 Ga0207656_10168748
708 Ga0207682_10001937
709 Ga0207682_10013731
710 Ga0207682_10014295
711 Ga0207688_10002175
712 Ga0207680_10010788
713 Ga0207699_10269457
714 Ga0207645_10003180
715 Ga0207645_10003899
716 Ga0207645_10099958
717 Ga0207643_10000522
718 Ga0207643_10005086
719 Ga0207654_10003519
720 Ga0207654_10012683
721 Ga0207654_10304305
722 Ga0207707_10001392
723 Ga0207707_10211876
724 Ga0207695_10001946
725 Ga0207671_10013984
726 Ga0207671_10170673
727 Ga0207660_10032427
728 Ga0207662_10005740
729 Ga0207662_10210701
730 Ga0207657_10056200
731 Ga0207649_10057349
732 Ga0207649_10172799
733 Ga0207652_10006372
734 Ga0207646_10218576
735 Ga0207681_10006278
736 Ga0207681_10016626
737 Ga0207694_10001140
738 Ga0207694_10028471
739 Ga0207694_10062795
740 Ga0207694_10070845
741 Ga0207650_10005645
742 Ga0207650_10088826
743 Ga0207650_10342912
744 Ga0207659_10002075
745 Ga0207659_10006924
746 Ga0207659_10095943
747 Ga0207659_10132596
748 Ga0207659_10560928
749 Ga0207687_10001747
750 Ga0207687_10013255
751 Ga0207700_10006091
752 Ga0207664_10357515
753 Ga0207644_10034106
754 Ga0207644_10218941
755 Ga0207706_10071792
756 Ga0207706_10113679
757 Ga0207706_10260651
758 Ga0207686_10006336
759 Ga0207686_10042011
760 Ga0207709_10020972
761 Ga0207709_10074010
762 Ga0207670_10070580
763 Ga0207670_10138384
764 Ga0207669_10208687
765 Ga0207704_10037578
766 Ga0207704_10300582
767 Ga0207691_10000174
768 Ga0207691_10004719
769 Ga0207691_10009818
770 Ga0207691_10042113
771 Ga0207691_10070504
772 Ga0207691_10072862
773 Ga0207691_10301586
774 Ga0207711_10004087
775 Ga0207711_10030762
776 Ga0207711_10631807
777 Ga0207689_10009037
778 Ga0207689_10012960
779 Ga0207661_10000045
780 Ga0207661_10016060
781 Ga0207661_10033186
782 Ga0207661_10214152
783 Ga0207661_10636005
784 Ga0207667_10014754
785 Ga0207667_10073275
786 Ga0207651_10000736
787 Ga0207651_10056930
788 Ga0207651_10196913
789 Ga0207651_10443684
790 Ga0207712_10022607
791 Ga0207712_10040029
792 Ga0207668_10216283
793 Ga0207640_10008821
794 Ga0207658_10046454
795 Ga0207703_10008000
796 Ga0207703_10008414
797 Ga0207703_10099359
798 Ga0207708_10023500
799 Ga0207708_10203653
800 Ga0207702_10005235
801 Ga0207702_10089498
802 Ga0207702_10136964
803 Ga0207641_10001228
804 Ga0207641_10049698
805 Ga0207641_10208723
806 Ga0207641_10460665
807 Ga0207648_10002614
808 Ga0207648_10029633
809 Ga0207676_10024703
810 Ga0207676_10039378
811 Ga0207676_10122841
812 Ga0207676_10133626
813 Ga0207674_10000300
814 Ga0207674_10020981
815 Ga0207674_10067650
816 Ga0207674_10090667
817 Ga0207674_10241996
818 Ga0207674_10468003
819 Ga0207675_100008035
820 Ga0207675_100241644
821 Ga0207675_100610906
822 Ga0207683_10003599
823 Ga0207683_10027801
824 Ga0207683_10042960
825 Ga0207683_10191968
826 Ga0207428_10001505
827 Ga0207428_10001899
828 Ga0207428_10012831
829 Ga0207428_10134532
830 Ga0207428_10141607
831 Ga0268266_10027907
832 Ga0268266_10120779
833 Ga0268265_10010668
834 Ga0268265_10073173
835 Ga0268265_10273083
836 Ga0268264_10023942
837 Ga0268264_10079865
838 Ga0268264_10369681
839 Ga0265313_10002232
840 Ga0307410_10264496
841 Ga0373934_0002027
842 Ga0373936_0109535
843 Ga0373954_0007171
844 Ga0373954_0073766
845 Ga0373954_0079150
846 Ga0373955_0018085
847 Ga0373955_0168913
848 Ga0373942_0012606
849 Ga0373935_0007965
850 Ga0373927_0167863
851 Ga0373933_0031994
852 Ga0373947_0050538
853 Ga0373937_0001947
854 Ga0373937_0086917
855 Ga0373937_0107179
856 Ga0373925_0149958
857 Ga0373925_0340678
858 Ga0436364_0004424
859 Ga0436364_0425709
860 Ga0451793_0719902
861 Ga0451576_0248233
862 Ga0495592_0011640
863 Ga0495651_0001689
864 Ga0495651_0134284
865 Ga0495580_0046820
866 Ga0495580_0180822
867 Ga0495582_0013032
868 Ga0495662_0000630
869 Ga0495664_0000501
870 Ga0495664_0393708
871 Ga0495628_0002217
872 Ga0495630_0334252
873 Ga0495652_0062924
874 Ga0495652_0185719
875 Ga0495586_0026289
876 Ga0495587_0000867
877 Ga0495587_0028091
878 Ga0495598_0048459
879 Ga0495645_0004796
880 Ga0495645_0086859
881 Ga0495645_0131033
882 Ga0495645_0210335
883 Ga0495667_0028554
884 Ga0495667_0410821
885 Ga0495635_0012683
886 Ga0495635_0203246
887 Ga0495657_0114831
888 Ga0495657_0182503
889 Ga0495599_0176051
890 Ga0495623_0034057
891 Ga0495646_0061331
892 Ga0495658_0042323
893 Ga0495613_0073244
894 Ga0495600_0042085
895 Ga0495600_0119925
896 Ga0495604_0015633
897 Ga0495674_0003025
898 Ga0495680_0010492
899 Ga0495675_0004731
900 Ga0495675_0141417
901 Ga0495675_0222398
902 Ga0495675_0274305
903 Ga0495684_0009093
904 Ga0495684_0044075
905 Ga0495684_0117285
906 Ga0495602_0004278
907 Ga0495602_0055553
908 Ga0496111_0346229
909 Ga0496112_0143256
910 Ga0501040_0065571
911 Ga0501041_0252406
912 Ga0501071_0054347
913 Ga0501075_0010727
914 Ga0501076_0098641
915 Ga0501080_0105786
916 Ga0501081_0063282
917 nmdc:mga05p37_166768_c1
918 nmdc:mga05p37_40432_c1
919 nmdc:mga05p37_411916_c1
920 nmdc:mga05p37_52595_c1
921 nmdc:mga05p37_569128_c1
922 nmdc:mga05p37_99937_c1
923 nmdc:mga09592_115634_c1
924 nmdc:mga09592_157028_c1
925 nmdc:mga09592_350431_c1
926 nmdc:mga09592_48518_c1
927 nmdc:mga09592_99519_c1
928 nmdc:mga0qj67_110600_c1
929 nmdc:mga0qj67_136731_c1
930 nmdc:mga06r32_132165_c1
931 nmdc:mga06r32_133108_c1
932 nmdc:mga06r32_17247_c1
933 nmdc:mga08y16_152_c1
934 nmdc:mga08y16_213218_c1
935 nmdc:mga08y16_352421_c1
936 nmdc:mga08y16_379022_c1
937 nmdc:mga08y16_396760_c1
938 nmdc:mga08y16_41028_c1
939 nmdc:mga0n895_145392_c1
940 nmdc:mga0n895_268968_c1
941 nmdc:mga0n895_282412_c1
942 nmdc:mga0n895_325599_c1
943 nmdc:mga0n895_4002_c1
944 nmdc:mga0n895_42668_c1
945 nmdc:mga0n895_48402_c1
946 nmdc:mga0rr50_21487_c1
947 nmdc:mga0rr50_6750_c1
948 nmdc:mga0a205_165687_c1
949 nmdc:mga0a205_410_c2
950 nmdc:mga0a205_6872_c1
951 nmdc:mga0a205_92304_c1
952 Ga0501084_0144255
953 Ga0501082_0005658
954 Ga0530510_0050289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

100

329

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.85 22 280
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8469 22 280
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8202 22 276
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8178 24 277
3vyl-assembly2.cif.gz_H structure of l-ribulose 3-epimerase 0.8124 24 278
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8486 24 276 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8452 22 276 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8332 22 276 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8248 22 277 3.20.20.150
af_Q11185_2_259_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8224 22 269 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A3M1YUC3-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9761 48 219 GO:0016853
AF-A0A3N5MH09-F1-model_v4 Hydroxypyruvate isomerase 0.9706 81 280 GO:0016853
AF-X0WMQ7-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9701 126 280 GO:0016853
AF-A0A2V8N8X7-F1-model_v4 Hydroxypyruvate isomerase 0.9693 36 280 GO:0016853
AF-A0A258WQI7-F1-model_v4 Hydroxypyruvate isomerase 0.9686 24 280 GO:0016853

Map