F451634

General Info

Members Datasets Scaffolds Average Seq Length
477 246 477 139

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10186311|Ga0065707_101863112
Length 154
Sequence MERTFCMIKPDGVQRRLVGKILQRFEEKGLRIAGLKLIKVDKATAENLYSVHKGRPFYDTLVAFVTSSPVVAMVLEGNGTIEIVRTLLGATFGFQAAPGTIRGDYGSSKGFNLIHASDSKDSAAREIPIFFKPKELVAWTHADHVWVYEEPERG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 3.98
Rhizosphere 92.03
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10023968 3300002459 Bacteria 1265
2 rootL2_10093759 3300003322 Bacteria 6055
3 rootH1_10187321 3300003323 Bacteria 1681
4 Ga0058862_12379370 3300004803 Bacteria 768
5 Ga0065715_10098529 3300005293 Bacteria 3535
6 Ga0065715_10190822 3300005293 Bacteria 1416
7 Ga0065715_10372249 3300005293 Bacteria 911
8 Ga0065707_10186311 3300005295 Bacteria 1387
9 Ga0065707_10411315 3300005295 Bacteria 841
10 Ga0070676_10011008 3300005328 Bacteria 4914
11 Ga0070676_10251957 3300005328 Bacteria 1179
12 Ga0070683_100012137 3300005329 Bacteria 7477
13 Ga0070670_100173094 3300005331 Bacteria 1873
14 Ga0068869_101101039 3300005334 Unclassified 695
15 Ga0070666_10095575 3300005335 Bacteria 2045
16 Ga0070666_10281076 3300005335 Bacteria 1183
17 Ga0070666_10498294 3300005335 Bacteria 883
18 Ga0070680_100232887 3300005336 Bacteria 1556
19 Ga0068868_100476657 3300005338 Bacteria 1089
20 Ga0068868_100634454 3300005338 Bacteria 950
21 Ga0070689_100275994 3300005340 Bacteria 1393
22 Ga0070689_100461699 3300005340 Bacteria 1082
23 Ga0070691_10056269 3300005341 Bacteria 1885
24 Ga0070687_100506396 3300005343 Bacteria 814
25 Ga0070668_100098442 3300005347 Bacteria 2314
26 Ga0070669_100104564 3300005353 Bacteria 2140
27 Ga0070669_100130587 3300005353 Bacteria 1927
28 Ga0070669_100345394 3300005353 Bacteria 1207
29 Ga0070675_100000055 3300005354 Bacteria 68147
30 Ga0070675_100268899 3300005354 Bacteria 1495
31 Ga0070671_100284468 3300005355 Bacteria 1407
32 Ga0070674_100323363 3300005356 Bacteria 1237
33 Ga0070674_100580226 3300005356 Bacteria 945
34 Ga0070673_100065744 3300005364 Bacteria 2894
35 Ga0070673_100132427 3300005364 Bacteria 2094
36 Ga0070673_100179289 3300005364 Bacteria 1813
37 Ga0070673_100248346 3300005364 Bacteria 1550
38 Ga0070688_100939007 3300005365 Bacteria 684
39 Ga0070667_100375915 3300005367 Bacteria 1290
40 Ga0070703_10040617 3300005406 Bacteria 1447
41 Ga0070714_100053101 3300005435 Bacteria 3458
42 Ga0070701_10030874 3300005438 Bacteria 2654
43 Ga0070711_100855264 3300005439 Bacteria 774
44 Ga0070705_100038938 3300005440 Bacteria 2694
45 Ga0070705_100078211 3300005440 Bacteria 2022
46 Ga0070700_100005782 3300005441 Bacteria 6563
47 Ga0070700_100331311 3300005441 Bacteria 1122
48 Ga0070700_100604546 3300005441 Unclassified 860
49 Ga0070700_100731899 3300005441 Bacteria 790
50 Ga0070700_100800967 3300005441 Bacteria 759
51 Ga0070694_100036188 3300005444 Bacteria 3269
52 Ga0070694_100213730 3300005444 Bacteria 1444
53 Ga0070694_101056538 3300005444 Bacteria 676
54 Ga0070694_101066701 3300005444 Bacteria 673
55 Ga0070708_101535867 3300005445 Bacteria 620
56 Ga0070663_100088734 3300005455 Bacteria 2287
57 Ga0070663_100512314 3300005455 Bacteria 998
58 Ga0070663_101063012 3300005455 Bacteria 706
59 Ga0070678_100128353 3300005456 Bacteria 2010
60 Ga0070662_100211369 3300005457 Bacteria 1544
61 Ga0070662_100396819 3300005457 Bacteria 1138
62 Ga0070681_10042317 3300005458 Bacteria 4565
63 Ga0070681_10136275 3300005458 Bacteria 2386
64 Ga0068867_100012999 3300005459 Bacteria 5891
65 Ga0068867_100570580 3300005459 Bacteria 983
66 Ga0068867_102219996 3300005459 Bacteria 521
67 Ga0070706_100769713 3300005467 Bacteria 892
68 Ga0070706_101637414 3300005467 Bacteria 587
69 Ga0070707_100243323 3300005468 Bacteria 1751
70 Ga0070707_100684735 3300005468 Bacteria 988
71 Ga0070698_100051643 3300005471 Bacteria 4187
72 Ga0070698_100143310 3300005471 Bacteria 2340
73 Ga0070699_100066431 3300005518 Bacteria 3131
74 Ga0070699_100116323 3300005518 Bacteria 2350
75 Ga0070699_100226446 3300005518 Bacteria 1667
76 Ga0070699_100242887 3300005518 Bacteria 1608
77 Ga0070679_100016517 3300005530 Bacteria 7125
78 Ga0070679_100425654 3300005530 Bacteria 1273
79 Ga0070684_100097864 3300005535 Bacteria 2617
80 Ga0070697_100016556 3300005536 Bacteria 5799
81 Ga0070672_100798763 3300005543 Bacteria 830
82 Ga0070686_100077016 3300005544 Bacteria 2197
83 Ga0070686_100719069 3300005544 Bacteria 798
84 Ga0070695_100232150 3300005545 Bacteria 1334
85 Ga0070695_100251150 3300005545 Bacteria 1287
86 Ga0070695_100622095 3300005545 Bacteria 850
87 Ga0070696_100161162 3300005546 Bacteria 1653
88 Ga0070665_100030161 3300005548 Bacteria 5457
89 Ga0070704_100122684 3300005549 Bacteria 1999
90 Ga0070704_100273465 3300005549 Bacteria 1397
91 Ga0070704_100373903 3300005549 Bacteria 1209
92 Ga0070704_100554214 3300005549 Bacteria 1005
93 Ga0070704_100645467 3300005549 Bacteria 934
94 Ga0070704_100810937 3300005549 Bacteria 837
95 Ga0068855_100206959 3300005563 Bacteria 2207
96 Ga0068855_100393535 3300005563 Bacteria 1520
97 Ga0068857_102241808 3300005577 Unclassified 536
98 Ga0068854_100037831 3300005578 Bacteria 3389
99 Ga0068854_100104542 3300005578 Bacteria 2127
100 Ga0070702_100029043 3300005615 Bacteria 3003
101 Ga0070702_100206209 3300005615 Bacteria 1305
102 Ga0070702_100718267 3300005615 Bacteria 764
103 Ga0068859_100012519 3300005617 Bacteria 8532
104 Ga0068859_100104910 3300005617 Bacteria 2886
105 Ga0068859_100302619 3300005617 Bacteria 1692
106 Ga0068864_100257585 3300005618 Bacteria 1622
107 Ga0068864_101099718 3300005618 Bacteria 791
108 Ga0068866_10074412 3300005718 Bacteria 1806
109 Ga0068866_10876226 3300005718 Bacteria 630
110 Ga0068861_100010150 3300005719 Bacteria 6531
111 Ga0068861_100063772 3300005719 Bacteria 2833
112 Ga0068861_100164631 3300005719 Bacteria 1832
113 Ga0068861_100233922 3300005719 Bacteria 1560
114 Ga0068861_100358439 3300005719 Bacteria 1282
115 Ga0068861_100692441 3300005719 Bacteria 946
116 Ga0068861_100886749 3300005719 Bacteria 844
117 Ga0068863_100406122 3300005841 Bacteria 1333
118 Ga0068858_100006437 3300005842 Bacteria 11436
119 Ga0068860_100476900 3300005843 Bacteria 1243
120 Ga0068862_100011943 3300005844 Bacteria 7175
121 Ga0068862_100114836 3300005844 Bacteria 2367
122 Ga0068862_100264105 3300005844 Bacteria 1572
123 Ga0068862_100705613 3300005844 Bacteria 978
124 Ga0081539_10021620 3300005985 Bacteria 4287
125 Ga0070717_10298964 3300006028 Bacteria 1431
126 Ga0075368_10577921 3300006042 Bacteria 507
127 Ga0070715_10332350 3300006163 Bacteria 824
128 Ga0075366_10000073 3300006195 Bacteria 38953
129 Ga0075366_10142162 3300006195 Bacteria 1451
130 Ga0097621_100432165 3300006237 Bacteria 1183
131 Ga0068871_100127124 3300006358 Bacteria 2158
132 Ga0068871_100428978 3300006358 Bacteria 1182
133 Ga0075428_100003953 3300006844 Bacteria 16260
134 Ga0075428_100412915 3300006844 Bacteria 1446
135 Ga0075430_100647391 3300006846 Bacteria 871
136 Ga0075430_101475088 3300006846 Bacteria 559
137 Ga0075431_100026134 3300006847 Bacteria 5988
138 Ga0075433_10000238 3300006852 Bacteria 31539
139 Ga0075433_10087165 3300006852 Bacteria 2757
140 Ga0075433_10185875 3300006852 Unclassified 1849
141 Ga0075433_10193776 3300006852 Bacteria 1808
142 Ga0075433_10200329 3300006852 Bacteria 1775
143 Ga0075434_100026749 3300006871 Bacteria 5656
144 Ga0075434_100125622 3300006871 Bacteria 2582
145 Ga0075434_100190056 3300006871 Bacteria 2074
146 Ga0075434_100259767 3300006871 Bacteria 1756
147 Ga0075434_100279545 3300006871 Bacteria 1689
148 Ga0075429_100376226 3300006880 Bacteria 1243
149 Ga0068865_100153658 3300006881 Bacteria 1748
150 Ga0075436_100006766 3300006914 Bacteria 7847
151 Ga0075436_100010266 3300006914 Bacteria 6411
152 Ga0075436_100032710 3300006914 Bacteria 3584
153 Ga0075436_100040108 3300006914 Bacteria 3231
154 Ga0097620_100012519 3300006931 Bacteria 8532
155 Ga0097620_100104908 3300006931 Bacteria 2886
156 Ga0097620_100302608 3300006931 Bacteria 1692
157 Ga0075435_100009659 3300007076 Bacteria 7004
158 Ga0075435_100056415 3300007076 Bacteria 3175
159 Ga0075435_100194449 3300007076 Bacteria 1717
160 Ga0075435_100422936 3300007076 Bacteria 1147
161 Ga0075435_100895807 3300007076 Bacteria 774
162 Ga0105240_10168234 3300009093 Bacteria 2598
163 Ga0105240_11574409 3300009093 Bacteria 688
164 Ga0111539_10014220 3300009094 Bacteria 9938
165 Ga0111539_10022709 3300009094 Bacteria 7706
166 Ga0111539_10032649 3300009094 Bacteria 6321
167 Ga0111539_10034811 3300009094 Bacteria 6102
168 Ga0111539_10209650 3300009094 Bacteria 2270
169 Ga0111539_10308036 3300009094 Bacteria 1843
170 Ga0111539_10366088 3300009094 Bacteria 1678
171 Ga0111539_10609070 3300009094 Unclassified 1272
172 Ga0111539_10749319 3300009094 Bacteria 1137
173 Ga0105245_10031404 3300009098 Bacteria 4700
174 Ga0105245_10423813 3300009098 Unclassified 1334
175 Ga0105245_12184923 3300009098 Bacteria 607
176 Ga0105247_10056455 3300009101 Bacteria 2425
177 Ga0114129_10023013 3300009147 Bacteria 8841
178 Ga0114129_10046542 3300009147 Bacteria 6095
179 Ga0114129_10373242 3300009147 Bacteria 1885
180 Ga0114129_11714050 3300009147 Unclassified 766
181 Ga0105243_10062383 3300009148 Bacteria 2984
182 Ga0105243_10240337 3300009148 Bacteria 1611
183 Ga0105243_10443379 3300009148 Unclassified 1216
184 Ga0105243_10627698 3300009148 Bacteria 1038
185 Ga0105243_10693096 3300009148 Bacteria 992
186 Ga0105243_11373893 3300009148 Bacteria 726
187 Ga0105242_10063292 3300009176 Bacteria 3046
188 Ga0105242_10143754 3300009176 Bacteria 2073
189 Ga0105242_11241834 3300009176 Bacteria 766
190 Ga0105248_10060104 3300009177 Bacteria 4266
191 Ga0105248_10180242 3300009177 Bacteria 2381
192 Ga0105248_10444226 3300009177 Bacteria 1461
193 Ga0105248_10925607 3300009177 Bacteria 984
194 Ga0105248_11222601 3300009177 Bacteria 850
195 Ga0105248_11446103 3300009177 Bacteria 778
196 Ga0105238_10125539 3300009551 Bacteria 2545
197 Ga0105249_10322248 3300009553 Bacteria 1557
198 Ga0105249_11041447 3300009553 Bacteria 888
199 Ga0105249_11392458 3300009553 Unclassified 773
200 Ga0105249_11681234 3300009553 Bacteria 707
201 Ga0105246_10370282 3300011119 Bacteria 1180
202 Ga0157373_10000091 3300013100 Bacteria 75012
203 Ga0157373_10098272 3300013100 Bacteria 2060
204 Ga0157370_10068788 3300013104 Bacteria 3346
205 Ga0157378_10058983 3300013297 Bacteria 3423
206 Ga0163162_11390663 3300013306 Bacteria 798
207 Ga0157372_10007451 3300013307 Bacteria 11640
208 Ga0157375_10898117 3300013308 Bacteria 1030
209 Ga0157375_11413986 3300013308 Bacteria 820
210 Ga0163163_10631318 3300014325 Bacteria 1135
211 Ga0163163_10758528 3300014325 Bacteria 1034
212 Ga0157380_10001762 3300014326 Bacteria 14288
213 Ga0157380_10031428 3300014326 Bacteria 4076
214 Ga0157380_10523741 3300014326 Bacteria 1157
215 Ga0157380_10749311 3300014326 Unclassified 988
216 Ga0157379_10035068 3300014968 Bacteria 4472
217 Ga0157379_11472185 3300014968 Bacteria 662
218 Ga0157376_11161490 3300014969 Bacteria 799
219 Ga0163161_10836667 3300017792 Bacteria 776
220 Ga0163161_11656148 3300017792 Bacteria 566
221 Ga0209026_1000225 3300025250 Bacteria 77234
222 Ga0209026_1002625 3300025250 Bacteria 6562
223 Ga0209148_1039518 3300025254 Bacteria 659
224 Ga0207682_10421225 3300025893 Bacteria 631
225 Ga0207642_10021644 3300025899 Bacteria 2535
226 Ga0207642_10540104 3300025899 Bacteria 718
227 Ga0207680_10498425 3300025903 Bacteria 867
228 Ga0207647_10534121 3300025904 Unclassified 652
229 Ga0207699_10244598 3300025906 Unclassified 1234
230 Ga0207645_10245607 3300025907 Bacteria 1183
231 Ga0207645_10913378 3300025907 Unclassified 596
232 Ga0207707_10011369 3300025912 Bacteria 7750
233 Ga0207707_10519507 3300025912 Bacteria 1014
234 Ga0207663_10603790 3300025916 Bacteria 862
235 Ga0207660_10335914 3300025917 Bacteria 1209
236 Ga0207662_10076442 3300025918 Bacteria 2035
237 Ga0207662_10288007 3300025918 Bacteria 1089
238 Ga0207652_10040793 3300025921 Bacteria 3943
239 Ga0207652_10115697 3300025921 Bacteria 2382
240 Ga0207646_10207773 3300025922 Bacteria 1768
241 Ga0207681_10013808 3300025923 Bacteria 5004
242 Ga0207681_10023489 3300025923 Bacteria 3944
243 Ga0207681_10289607 3300025923 Bacteria 1292
244 Ga0207650_10148954 3300025925 Bacteria 1845
245 Ga0207659_10001583 3300025926 Bacteria 13492
246 Ga0207659_10176899 3300025926 Bacteria 1687
247 Ga0207687_10025897 3300025927 Bacteria 3926
248 Ga0207687_10283293 3300025927 Bacteria 1329
249 Ga0207664_10001974 3300025929 Bacteria 13499
250 Ga0207644_10504033 3300025931 Unclassified 999
251 Ga0207644_10765624 3300025931 Bacteria 807
252 Ga0207706_10144767 3300025933 Bacteria 2091
253 Ga0207706_11166814 3300025933 Bacteria 641
254 Ga0207686_10176597 3300025934 Bacteria 1511
255 Ga0207686_10264878 3300025934 Bacteria 1262
256 Ga0207709_10004342 3300025935 Bacteria 8205
257 Ga0207709_10414799 3300025935 Bacteria 1033
258 Ga0207670_10299379 3300025936 Bacteria 1259
259 Ga0207670_10688261 3300025936 Bacteria 845
260 Ga0207669_10122349 3300025937 Bacteria 1769
261 Ga0207704_10148138 3300025938 Bacteria 1652
262 Ga0207704_11710044 3300025938 Bacteria 541
263 Ga0207665_10249667 3300025939 Bacteria 1311
264 Ga0207691_10291769 3300025940 Bacteria 1402
265 Ga0207711_10277160 3300025941 Bacteria 1544
266 Ga0207711_10401141 3300025941 Bacteria 1274
267 Ga0207711_10477407 3300025941 Bacteria 1161
268 Ga0207711_11943187 3300025941 Bacteria 531
269 Ga0207689_10712524 3300025942 Bacteria 846
270 Ga0207661_10046300 3300025944 Bacteria 3449
271 Ga0207651_10005977 3300025960 Bacteria 6307
272 Ga0207651_10106035 3300025960 Bacteria 2098
273 Ga0207651_10122496 3300025960 Bacteria 1975
274 Ga0207651_10163087 3300025960 Bacteria 1749
275 Ga0207651_10745595 3300025960 Bacteria 865
276 Ga0207712_10189580 3300025961 Bacteria 1622
277 Ga0207712_10490533 3300025961 Bacteria 1048
278 Ga0207712_10979970 3300025961 Bacteria 750
279 Ga0207712_11990618 3300025961 Bacteria 520
280 Ga0207668_10221933 3300025972 Bacteria 1518
281 Ga0207640_10093769 3300025981 Bacteria 2086
282 Ga0207640_10206198 3300025981 Bacteria 1494
283 Ga0207658_10238640 3300025986 Bacteria 1539
284 Ga0207677_10061132 3300026023 Bacteria 2607
285 Ga0207677_10455597 3300026023 Bacteria 1097
286 Ga0207703_10016106 3300026035 Bacteria 5829
287 Ga0207703_10030107 3300026035 Bacteria 4288
288 Ga0207678_11529697 3300026067 Bacteria 589
289 Ga0207708_10004696 3300026075 Bacteria 10049
290 Ga0207708_10464023 3300026075 Bacteria 1056
291 Ga0207708_10637366 3300026075 Bacteria 906
292 Ga0207708_10797547 3300026075 Bacteria 813
293 Ga0207708_11998194 3300026075 Bacteria 508
294 Ga0207641_10640748 3300026088 Bacteria 1043
295 Ga0207648_10018612 3300026089 Bacteria 6284
296 Ga0207648_10590515 3300026089 Bacteria 1023
297 Ga0207648_10890529 3300026089 Bacteria 831
298 Ga0207676_10355299 3300026095 Bacteria 1356
299 Ga0207676_11106673 3300026095 Bacteria 783
300 Ga0207674_10499114 3300026116 Bacteria 1176
301 Ga0207674_11557876 3300026116 Bacteria 629
302 Ga0207674_11969322 3300026116 Unclassified 550
303 Ga0207675_100069427 3300026118 Bacteria 3293
304 Ga0207675_100304309 3300026118 Bacteria 1553
305 Ga0207675_100312662 3300026118 Bacteria 1532
306 Ga0207675_100762486 3300026118 Bacteria 979
307 Ga0207683_10202428 3300026121 Bacteria 1805
308 Ga0207698_11410228 3300026142 Bacteria 712
309 Ga0207428_10025855 3300027907 Bacteria 4907
310 Ga0207428_10192452 3300027907 Bacteria 1537
311 Ga0207428_10261577 3300027907 Bacteria 1289
312 Ga0268266_10065198 3300028379 Bacteria 3148
313 Ga0268266_10745549 3300028379 Bacteria 945
314 Ga0268265_10007975 3300028380 Bacteria 7148
315 Ga0268265_10540493 3300028380 Bacteria 1104
316 Ga0268265_10925805 3300028380 Bacteria 857
317 Ga0268265_11173149 3300028380 Bacteria 765
318 Ga0268265_12148484 3300028380 Unclassified 565
319 Ga0268264_10139236 3300028381 Bacteria 2162
320 Ga0268264_10218599 3300028381 Bacteria 1753
321 Ga0268264_11740982 3300028381 Bacteria 634
322 Ga0268264_12556916 3300028381 Bacteria 515
323 Ga0265323_10004679 3300028653 Bacteria 5873
324 Ga0265322_10014175 3300028654 Bacteria 2305
325 Ga0307515_10001029 3300028794 Bacteria 63730
326 Ga0307515_10759179 3300028794 Bacteria 589
327 Ga0265330_10180813 3300031235 Unclassified 893
328 Ga0265316_10001859 3300031344 Bacteria 22203
329 Ga0307508_10695392 3300031616 Bacteria 626
330 Ga0316579_10082833 3300031691 Bacteria 1529
331 Ga0316579_10240285 3300031691 Unclassified 876
332 Ga0316579_10591837 3300031691 Bacteria 537
333 Ga0265342_10017863 3300031712 Bacteria 4605
334 Ga0265342_10055083 3300031712 Bacteria 2362
335 Ga0307405_11521302 3300031731 Bacteria 588
336 Ga0316577_10161296 3300031733 Bacteria 1265
337 Ga0307412_10476215 3300031911 Bacteria 1034
338 Ga0307416_100485158 3300032002 Unclassified 1297
339 Ga0307415_101164287 3300032126 Unclassified 725
340 Ga0307507_10001172 3300033179 Bacteria 58234
341 Ga0373926_0037245 3300035083 Bacteria 1730
342 Ga0373942_0083982 3300035207 Bacteria 950
343 Ga0316574_0338805 3300035398 Bacteria 953
344 Ga0316574_0531512 3300035398 Bacteria 731
345 Ga0373935_0502025 3300035692 Bacteria 881
346 Ga0373927_1149234 3300035695 Bacteria 512
347 Ga0373947_0117913 3300035725 Bacteria 1684
348 Ga0373937_2003250 3300036401 Bacteria 525
349 Ga0316582_0040533 3300036647 Bacteria 2907
350 Ga0316582_0455491 3300036647 Unclassified 882
351 Ga0373925_0304106 3300037068 Bacteria 1288
352 Ga0395905_0149340 3300037471 Bacteria 2199
353 Ga0400489_68697 3300039093 Bacteria 2062
354 Ga0436363_1146630 3300039450 Unclassified 630
355 Ga0439453_0021937 3300041408 Bacteria 1154
356 Ga0451839_0161978 3300041496 Bacteria 628
357 Ga0451841_0077381 3300041498 Bacteria 975
358 Ga0439459_0157942 3300042438 Bacteria 597
359 Ga0451577_0440085 3300042876 Bacteria 1184
360 Ga0466963_0346410 3300044694 Bacteria 1046
361 Ga0451576_0191038 3300045051 Bacteria 2139
362 Ga0451576_1803757 3300045051 Bacteria 632
363 Ga0495592_0037981 3300046454 Bacteria 3624
364 Ga0495629_0239557 3300046459 Bacteria 1249
365 Ga0495629_0419739 3300046459 Bacteria 908
366 Ga0495641_0144745 3300046461 Bacteria 1062
367 Ga0495582_0107079 3300046473 Bacteria 1569
368 Ga0495585_0000654 3300046492 Bacteria 31829
369 Ga0495606_0013471 3300046507 Bacteria 6454
370 Ga0495628_0342708 3300046516 Bacteria 1100
371 Ga0495628_0507291 3300046516 Bacteria 870
372 Ga0495648_0027108 3300046524 Bacteria 3842
373 Ga0495587_0634147 3300046536 Bacteria 587
374 Ga0495609_0007432 3300046538 Bacteria 5475
375 Ga0495609_0355791 3300046538 Bacteria 590
376 Ga0495633_0000006 3300046558 Bacteria 326774
377 Ga0495656_0282118 3300046615 Unclassified 847
378 Ga0495668_0000011 3300046616 Bacteria 472186
379 Ga0495634_0054681 3300046642 Bacteria 2671
380 Ga0495625_0000660 3300046660 Bacteria 49270
381 Ga0495625_0002214 3300046660 Bacteria 21483
382 Ga0495625_0009378 3300046660 Bacteria 8193
383 Ga0495599_0254412 3300046678 Bacteria 1068
384 Ga0495658_0004851 3300046683 Bacteria 6599
385 Ga0495600_0216260 3300046809 Bacteria 1227
386 Ga0495660_0002682 3300046810 Bacteria 11256
387 Ga0495679_146026 3300047446 Bacteria 637
388 Ga0495602_0200146 3300048088 Bacteria 1525
389 Ga0495602_0294433 3300048088 Bacteria 1190
390 Ga0496100_0469441 3300048903 Bacteria 967
391 Ga0496104_0807162 3300048907 Bacteria 844
392 Ga0496104_1173150 3300048907 Bacteria 671
393 Ga0496105_0323742 3300048908 Bacteria 1235
394 Ga0496106_0082146 3300048909 Bacteria 2476
395 Ga0496107_0792229 3300048910 Bacteria 694
396 Ga0496108_0516736 3300048911 Bacteria 1043
397 Ga0496108_1394519 3300048911 Bacteria 586
398 Ga0496109_0712277 3300048912 Bacteria 941
399 Ga0496109_1079828 3300048912 Bacteria 740
400 Ga0496110_0724955 3300048913 Bacteria 896
401 Ga0496110_1104689 3300048913 Bacteria 701
402 Ga0496111_0102422 3300048914 Bacteria 2105
403 Ga0496111_0297648 3300048914 Bacteria 1196
404 Ga0496112_0987112 3300048915 Bacteria 762
405 Ga0496112_1465286 3300048915 Bacteria 597
406 Ga0496114_0565105 3300048917 Unclassified 1004
407 Ga0496114_0810386 3300048917 Bacteria 815
408 Ga0496114_1496191 3300048917 Bacteria 563
409 Ga0495682_0007750 3300049460 Bacteria 4254
410 Ga0501031_0587945 3300049568 Bacteria 716
411 Ga0501039_0901941 3300049575 Bacteria 688
412 Ga0501040_0038207 3300049576 Bacteria 3263
413 Ga0501041_0117305 3300049577 Bacteria 1653
414 Ga0501042_0261268 3300049578 Bacteria 1250
415 Ga0501042_0459725 3300049578 Bacteria 923
416 Ga0501048_0504914 3300049582 Bacteria 867
417 Ga0501048_1389666 3300049582 Bacteria 505
418 Ga0501068_0705603 3300049584 Unclassified 660
419 Ga0501075_0039710 3300049591 Bacteria 3522
420 Ga0501075_0316225 3300049591 Bacteria 1190
421 Ga0501075_0647279 3300049591 Bacteria 806
422 Ga0501076_0019279 3300049592 Bacteria 5212
423 Ga0501076_0909092 3300049592 Bacteria 726
424 Ga0501077_0842698 3300049593 Bacteria 590
425 Ga0501079_0038754 3300049741 Bacteria 3675
426 Ga0501079_0273791 3300049741 Bacteria 1320
427 Ga0501080_0993760 3300049742 Bacteria 728
428 Ga0501081_0133871 3300049743 Unclassified 1773
429 Ga0501081_0383965 3300049743 Bacteria 1038
430 Ga0501081_0463837 3300049743 Bacteria 942
431 Ga0501081_0562902 3300049743 Unclassified 852
432 Ga0501045_0216017 3300049824 Bacteria 1428
433 nmdc:mga0k408_106_c1 3300050493 Bacteria 40767
434 nmdc:mga0k408_166796_c1 3300050493 Bacteria 1312
435 nmdc:mga05p37_1047736_c1 3300050507 Bacteria 861
436 nmdc:mga05p37_16647_c1 3300050507 Bacteria 8857
437 nmdc:mga05p37_193286_c1 3300050507 Bacteria 2469
438 nmdc:mga05p37_197631_c1 3300050507 Bacteria 2438
439 nmdc:mga09592_331970_c1 3300050508 Bacteria 1316
440 nmdc:mga0qj67_568107_c1 3300050509 Bacteria 909
441 nmdc:mga0qj67_926924_c1 3300050509 Bacteria 685
442 nmdc:mga08y16_13913_c1 3300050511 Bacteria 8468
443 nmdc:mga08y16_200303_c1 3300050511 Bacteria 2069
444 nmdc:mga08y16_24560_c1 3300050511 Bacteria 6360
445 nmdc:mga08y16_249069_c1 3300050511 Bacteria 1836
446 nmdc:mga08y16_29270_c1 3300050511 Bacteria 5803
447 nmdc:mga08y16_5934_c1 3300050511 Bacteria 12801
448 nmdc:mga08y16_598027_c1 3300050511 Unclassified 1112
449 nmdc:mga0n895_1125254_c1 3300050512 Bacteria 762
450 nmdc:mga0n895_28663_c1 3300050512 Bacteria 5300
451 nmdc:mga0n895_344115_c1 3300050512 Bacteria 1510
452 nmdc:mga0n895_441670_c1 3300050512 Bacteria 1314
453 nmdc:mga0n895_59104_c1 3300050512 Bacteria 3783
454 nmdc:mga0n895_631931_c1 3300050512 Bacteria 1071
455 nmdc:mga0rr50_470115_c1 3300050513 Bacteria 1067
456 nmdc:mga0rr50_58317_c1 3300050513 Bacteria 2893
457 nmdc:mga0rr50_627586_c1 3300050513 Bacteria 917
458 nmdc:mga0rr50_691294_c1 3300050513 Bacteria 871
459 nmdc:mga0rr50_878910_c1 3300050513 Bacteria 764
460 nmdc:mga08x19_137679_c1 3300050514 Bacteria 1647
461 nmdc:mga08x19_143753_c1 3300050514 Bacteria 1612
462 nmdc:mga08x19_26867_c1 3300050514 Bacteria 3596
463 nmdc:mga08x19_37315_c1 3300050514 Bacteria 3084
464 nmdc:mga08x19_49681_c1 3300050514 Bacteria 2691
465 nmdc:mga08x19_899038_c1 3300050514 Bacteria 629
466 nmdc:mga0a205_25_c1 3300050515 Bacteria 87587
467 nmdc:mga0a205_472477_c1 3300050515 Bacteria 1113
468 nmdc:mga0a205_474679_c1 3300050515 Bacteria 1109
469 nmdc:mga0a205_62314_c1 3300050515 Bacteria 3603
470 nmdc:mga0a205_81371_c1 3300050515 Bacteria 3129
471 Ga0495619_0260684 3300053085 Bacteria 1201
472 Ga0500646_0359789 3300053090 Bacteria 532
473 Ga0501084_0037225 3300054114 Bacteria 4065
474 Ga0501084_0441005 3300054114 Bacteria 1101
475 Ga0501082_0156810 3300060353 Bacteria 1978
476 Ga0501082_0427261 3300060353 Bacteria 1157
477 Ga0530510_0307597 3300061734 Bacteria 1187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10076442 Ga0207662_100764423 125
2 3300025934 Ga0207686_10264878 Ga0207686_102648782 125
3 3300031712 Ga0265342_10055083 Ga0265342_100550832 125
4 3300003323 rootH1_10187321 rootH1_101873212 131
5 3300005329 Ga0070683_100012137 Ga0070683_1000121375 131
6 3300005535 Ga0070684_100097864 Ga0070684_1000978642 131
7 3300005563 Ga0068855_100393535 Ga0068855_1003935352 131
8 3300006195 Ga0075366_10142162 Ga0075366_101421622 131
9 3300006852 Ga0075433_10000238 Ga0075433_100002389 131
10 3300025250 Ga0209026_1000225 Ga0209026_100022569 131
11 3300025250 Ga0209026_1002625 Ga0209026_10026259 131
12 3300025254 Ga0209148_1039518 Ga0209148_10395181 131
13 3300025944 Ga0207661_10046300 Ga0207661_100463003 131
14 3300041498 Ga0451841_0077381 Ga0451841_0077381_64_459 131
15 3300046459 Ga0495629_0239557 Ga0495629_0239557_809_1204 131
16 3300046461 Ga0495641_0144745 Ga0495641_0144745_226_621 131
17 3300046492 Ga0495585_0000654 Ga0495585_0000654_11271_11666 131
18 3300046516 Ga0495628_0507291 Ga0495628_0507291_446_841 131
19 3300046524 Ga0495648_0027108 Ga0495648_0027108_1326_1721 131
20 3300046538 Ga0495609_0007432 Ga0495609_0007432_3629_4024 131
21 3300046538 Ga0495609_0355791 Ga0495609_0355791_167_562 131
22 3300046558 Ga0495633_0000006 Ga0495633_0000006_294955_295350 131
23 3300046616 Ga0495668_0000011 Ga0495668_0000011_282770_283165 131
24 3300046660 Ga0495625_0000660 Ga0495625_0000660_28954_29349 131
25 3300046660 Ga0495625_0009378 Ga0495625_0009378_2830_3225 131
26 3300046683 Ga0495658_0004851 Ga0495658_0004851_4022_4417 131
27 3300046809 Ga0495600_0216260 Ga0495600_0216260_592_987 131
28 3300047446 Ga0495679_146026 Ga0495679_146026_182_577 131
29 3300049460 Ga0495682_0007750 Ga0495682_0007750_1250_1645 131
30 3300050515 nmdc:mga0a205_25_c1 nmdc:mga0a205_25_c1_66773_67219 131
31 3300053090 Ga0500646_0359789 Ga0500646_0359789_116_511 131
32 3300005439 Ga0070711_100855264 Ga0070711_1008552642 133
33 3300005985 Ga0081539_10021620 Ga0081539_100216205 133
34 3300009094 Ga0111539_10308036 Ga0111539_103080363 133
35 3300050511 nmdc:mga08y16_249069_c1 nmdc:mga08y16_249069_c1_751_1152 133
36 3300005338 Ga0068868_100476657 Ga0068868_1004766572 134
37 3300013308 Ga0157375_11413986 Ga0157375_114139862 134
38 3300014325 Ga0163163_10631318 Ga0163163_106313182 134
39 3300026023 Ga0207677_10455597 Ga0207677_104555972 134
40 3300048907 Ga0496104_1173150 Ga0496104_1173150_211_621 134
41 3300048913 Ga0496110_1104689 Ga0496110_1104689_60_470 134
42 3300048914 Ga0496111_0102422 Ga0496111_0102422_116_526 134
43 3300048914 Ga0496111_0297648 Ga0496111_0297648_301_711 134
44 3300048917 Ga0496114_0810386 Ga0496114_0810386_175_585 134
45 3300005467 Ga0070706_100769713 Ga0070706_1007697132 135
46 3300002459 JGI24751J29686_10023968 JGI24751J29686_100239682 137
47 3300003322 rootL2_10093759 rootL2_100937596 137
48 3300004803 Ga0058862_12379370 Ga0058862_123793702 137
49 3300005293 Ga0065715_10098529 Ga0065715_100985294 137
50 3300005293 Ga0065715_10190822 Ga0065715_101908223 137
51 3300005293 Ga0065715_10372249 Ga0065715_103722491 137
52 3300005295 Ga0065707_10186311 Ga0065707_101863112 137
53 3300005295 Ga0065707_10411315 Ga0065707_104113151 137
54 3300005328 Ga0070676_10011008 Ga0070676_100110083 137
55 3300005328 Ga0070676_10251957 Ga0070676_102519571 137
56 3300005331 Ga0070670_100173094 Ga0070670_1001730943 137
57 3300005334 Ga0068869_101101039 Ga0068869_1011010392 137
58 3300005335 Ga0070666_10095575 Ga0070666_100955752 137
59 3300005335 Ga0070666_10281076 Ga0070666_102810762 137
60 3300005335 Ga0070666_10498294 Ga0070666_104982941 137
61 3300005336 Ga0070680_100232887 Ga0070680_1002328872 137
62 3300005338 Ga0068868_100634454 Ga0068868_1006344541 137
63 3300005340 Ga0070689_100275994 Ga0070689_1002759942 137
64 3300005340 Ga0070689_100461699 Ga0070689_1004616992 137
65 3300005341 Ga0070691_10056269 Ga0070691_100562693 137
66 3300005343 Ga0070687_100506396 Ga0070687_1005063962 137
67 3300005347 Ga0070668_100098442 Ga0070668_1000984424 137
68 3300005353 Ga0070669_100104564 Ga0070669_1001045643 137
69 3300005353 Ga0070669_100130587 Ga0070669_1001305872 137
70 3300005353 Ga0070669_100345394 Ga0070669_1003453942 137
71 3300005354 Ga0070675_100000055 Ga0070675_10000005517 137
72 3300005354 Ga0070675_100268899 Ga0070675_1002688993 137
73 3300005355 Ga0070671_100284468 Ga0070671_1002844681 137
74 3300005356 Ga0070674_100323363 Ga0070674_1003233631 137
75 3300005356 Ga0070674_100580226 Ga0070674_1005802262 137
76 3300005364 Ga0070673_100065744 Ga0070673_1000657444 137
77 3300005364 Ga0070673_100132427 Ga0070673_1001324273 137
78 3300005364 Ga0070673_100179289 Ga0070673_1001792893 137
79 3300005364 Ga0070673_100248346 Ga0070673_1002483462 137
80 3300005365 Ga0070688_100939007 Ga0070688_1009390071 137
81 3300005367 Ga0070667_100375915 Ga0070667_1003759152 137
82 3300005406 Ga0070703_10040617 Ga0070703_100406172 137
83 3300005435 Ga0070714_100053101 Ga0070714_1000531015 137
84 3300005438 Ga0070701_10030874 Ga0070701_100308744 137
85 3300005440 Ga0070705_100038938 Ga0070705_1000389383 137
86 3300005440 Ga0070705_100078211 Ga0070705_1000782111 137
87 3300005441 Ga0070700_100005782 Ga0070700_1000057823 137
88 3300005441 Ga0070700_100331311 Ga0070700_1003313111 137
89 3300005441 Ga0070700_100604546 Ga0070700_1006045461 137
90 3300005441 Ga0070700_100731899 Ga0070700_1007318992 137
91 3300005441 Ga0070700_100800967 Ga0070700_1008009672 137
92 3300005444 Ga0070694_100036188 Ga0070694_1000361883 137
93 3300005444 Ga0070694_100213730 Ga0070694_1002137303 137
94 3300005444 Ga0070694_101056538 Ga0070694_1010565382 137
95 3300005444 Ga0070694_101066701 Ga0070694_1010667011 137
96 3300005445 Ga0070708_101535867 Ga0070708_1015358672 137
97 3300005455 Ga0070663_100088734 Ga0070663_1000887343 137
98 3300005455 Ga0070663_100512314 Ga0070663_1005123141 137
99 3300005455 Ga0070663_101063012 Ga0070663_1010630122 137
100 3300005456 Ga0070678_100128353 Ga0070678_1001283532 137
101 3300005457 Ga0070662_100211369 Ga0070662_1002113692 137
102 3300005457 Ga0070662_100396819 Ga0070662_1003968192 137
103 3300005458 Ga0070681_10042317 Ga0070681_100423175 137
104 3300005458 Ga0070681_10136275 Ga0070681_101362752 137
105 3300005459 Ga0068867_100012999 Ga0068867_1000129995 137
106 3300005459 Ga0068867_100570580 Ga0068867_1005705802 137
107 3300005459 Ga0068867_102219996 Ga0068867_1022199961 137
108 3300005467 Ga0070706_101637414 Ga0070706_1016374142 137
109 3300005468 Ga0070707_100243323 Ga0070707_1002433232 137
110 3300005468 Ga0070707_100684735 Ga0070707_1006847351 137
111 3300005471 Ga0070698_100051643 Ga0070698_1000516433 137
112 3300005471 Ga0070698_100143310 Ga0070698_1001433102 137
113 3300005518 Ga0070699_100066431 Ga0070699_1000664314 137
114 3300005518 Ga0070699_100116323 Ga0070699_1001163234 137
115 3300005518 Ga0070699_100226446 Ga0070699_1002264463 137
116 3300005518 Ga0070699_100242887 Ga0070699_1002428874 137
117 3300005530 Ga0070679_100016517 Ga0070679_1000165177 137
118 3300005530 Ga0070679_100425654 Ga0070679_1004256542 137
119 3300005536 Ga0070697_100016556 Ga0070697_1000165565 137
120 3300005543 Ga0070672_100798763 Ga0070672_1007987632 137
121 3300005544 Ga0070686_100077016 Ga0070686_1000770163 137
122 3300005544 Ga0070686_100719069 Ga0070686_1007190691 137
123 3300005545 Ga0070695_100232150 Ga0070695_1002321502 137
124 3300005545 Ga0070695_100251150 Ga0070695_1002511503 137
125 3300005545 Ga0070695_100622095 Ga0070695_1006220951 137
126 3300005546 Ga0070696_100161162 Ga0070696_1001611623 137
127 3300005548 Ga0070665_100030161 Ga0070665_1000301615 137
128 3300005549 Ga0070704_100122684 Ga0070704_1001226842 137
129 3300005549 Ga0070704_100273465 Ga0070704_1002734652 137
130 3300005549 Ga0070704_100373903 Ga0070704_1003739032 137
131 3300005549 Ga0070704_100554214 Ga0070704_1005542143 137
132 3300005549 Ga0070704_100645467 Ga0070704_1006454671 137
133 3300005549 Ga0070704_100810937 Ga0070704_1008109371 137
134 3300005563 Ga0068855_100206959 Ga0068855_1002069591 137
135 3300005577 Ga0068857_102241808 Ga0068857_1022418081 137
136 3300005578 Ga0068854_100037831 Ga0068854_1000378314 137
137 3300005578 Ga0068854_100104542 Ga0068854_1001045424 137
138 3300005615 Ga0070702_100029043 Ga0070702_1000290432 137
139 3300005615 Ga0070702_100206209 Ga0070702_1002062093 137
140 3300005615 Ga0070702_100718267 Ga0070702_1007182672 137
141 3300005617 Ga0068859_100012519 Ga0068859_1000125192 137
142 3300005617 Ga0068859_100104910 Ga0068859_1001049104 137
143 3300005617 Ga0068859_100302619 Ga0068859_1003026194 137
144 3300005618 Ga0068864_100257585 Ga0068864_1002575853 137
145 3300005618 Ga0068864_101099718 Ga0068864_1010997182 137
146 3300005718 Ga0068866_10074412 Ga0068866_100744121 137
147 3300005718 Ga0068866_10876226 Ga0068866_108762262 137
148 3300005719 Ga0068861_100010150 Ga0068861_1000101503 137
149 3300005719 Ga0068861_100063772 Ga0068861_1000637723 137
150 3300005719 Ga0068861_100164631 Ga0068861_1001646313 137
151 3300005719 Ga0068861_100233922 Ga0068861_1002339222 137
152 3300005719 Ga0068861_100358439 Ga0068861_1003584393 137
153 3300005719 Ga0068861_100692441 Ga0068861_1006924412 137
154 3300005719 Ga0068861_100886749 Ga0068861_1008867491 137
155 3300005841 Ga0068863_100406122 Ga0068863_1004061222 137
156 3300005842 Ga0068858_100006437 Ga0068858_1000064376 137
157 3300005843 Ga0068860_100476900 Ga0068860_1004769002 137
158 3300005844 Ga0068862_100011943 Ga0068862_1000119437 137
159 3300005844 Ga0068862_100114836 Ga0068862_1001148362 137
160 3300005844 Ga0068862_100264105 Ga0068862_1002641052 137
161 3300005844 Ga0068862_100705613 Ga0068862_1007056132 137
162 3300006028 Ga0070717_10298964 Ga0070717_102989643 137
163 3300006042 Ga0075368_10577921 Ga0075368_105779211 137
164 3300006163 Ga0070715_10332350 Ga0070715_103323503 137
165 3300006195 Ga0075366_10000073 Ga0075366_1000007312 137
166 3300006237 Ga0097621_100432165 Ga0097621_1004321652 137
167 3300006358 Ga0068871_100127124 Ga0068871_1001271243 137
168 3300006358 Ga0068871_100428978 Ga0068871_1004289782 137
169 3300006844 Ga0075428_100003953 Ga0075428_1000039539 137
170 3300006844 Ga0075428_100412915 Ga0075428_1004129151 137
171 3300006846 Ga0075430_100647391 Ga0075430_1006473912 137
172 3300006846 Ga0075430_101475088 Ga0075430_1014750881 137
173 3300006847 Ga0075431_100026134 Ga0075431_1000261342 137
174 3300006852 Ga0075433_10087165 Ga0075433_100871654 137
175 3300006852 Ga0075433_10185875 Ga0075433_101858752 137
176 3300006852 Ga0075433_10193776 Ga0075433_101937763 137
177 3300006852 Ga0075433_10200329 Ga0075433_102003294 137
178 3300006871 Ga0075434_100026749 Ga0075434_1000267494 137
179 3300006871 Ga0075434_100125622 Ga0075434_1001256223 137
180 3300006871 Ga0075434_100190056 Ga0075434_1001900563 137
181 3300006871 Ga0075434_100259767 Ga0075434_1002597672 137
182 3300006871 Ga0075434_100279545 Ga0075434_1002795453 137
183 3300006880 Ga0075429_100376226 Ga0075429_1003762261 137
184 3300006881 Ga0068865_100153658 Ga0068865_1001536582 137
185 3300006914 Ga0075436_100006766 Ga0075436_1000067665 137
186 3300006914 Ga0075436_100010266 Ga0075436_1000102666 137
187 3300006914 Ga0075436_100032710 Ga0075436_1000327103 137
188 3300006914 Ga0075436_100040108 Ga0075436_1000401085 137
189 3300006931 Ga0097620_100012519 Ga0097620_1000125192 137
190 3300006931 Ga0097620_100104908 Ga0097620_1001049084 137
191 3300006931 Ga0097620_100302608 Ga0097620_1003026082 137
192 3300007076 Ga0075435_100009659 Ga0075435_1000096593 137
193 3300007076 Ga0075435_100056415 Ga0075435_1000564152 137
194 3300007076 Ga0075435_100194449 Ga0075435_1001944493 137
195 3300007076 Ga0075435_100422936 Ga0075435_1004229363 137
196 3300007076 Ga0075435_100895807 Ga0075435_1008958072 137
197 3300009093 Ga0105240_10168234 Ga0105240_101682343 137
198 3300009093 Ga0105240_11574409 Ga0105240_115744092 137
199 3300009094 Ga0111539_10014220 Ga0111539_100142207 137
200 3300009094 Ga0111539_10022709 Ga0111539_100227098 137
201 3300009094 Ga0111539_10032649 Ga0111539_100326496 137
202 3300009094 Ga0111539_10034811 Ga0111539_100348116 137
203 3300009094 Ga0111539_10209650 Ga0111539_102096503 137
204 3300009094 Ga0111539_10366088 Ga0111539_103660882 137
205 3300009094 Ga0111539_10609070 Ga0111539_106090701 137
206 3300009094 Ga0111539_10749319 Ga0111539_107493192 137
207 3300009098 Ga0105245_10031404 Ga0105245_100314044 137
208 3300009098 Ga0105245_10423813 Ga0105245_104238133 137
209 3300009098 Ga0105245_12184923 Ga0105245_121849231 137
210 3300009101 Ga0105247_10056455 Ga0105247_100564551 137
211 3300009147 Ga0114129_10023013 Ga0114129_100230134 137
212 3300009147 Ga0114129_10046542 Ga0114129_100465426 137
213 3300009147 Ga0114129_10373242 Ga0114129_103732423 137
214 3300009147 Ga0114129_11714050 Ga0114129_117140502 137
215 3300009148 Ga0105243_10062383 Ga0105243_100623833 137
216 3300009148 Ga0105243_10240337 Ga0105243_102403373 137
217 3300009148 Ga0105243_10443379 Ga0105243_104433792 137
218 3300009148 Ga0105243_10627698 Ga0105243_106276983 137
219 3300009148 Ga0105243_10693096 Ga0105243_106930962 137
220 3300009148 Ga0105243_11373893 Ga0105243_113738932 137
221 3300009176 Ga0105242_10063292 Ga0105242_100632921 137
222 3300009176 Ga0105242_10143754 Ga0105242_101437543 137
223 3300009176 Ga0105242_11241834 Ga0105242_112418341 137
224 3300009177 Ga0105248_10060104 Ga0105248_100601046 137
225 3300009177 Ga0105248_10180242 Ga0105248_101802423 137
226 3300009177 Ga0105248_10444226 Ga0105248_104442262 137
227 3300009177 Ga0105248_10925607 Ga0105248_109256073 137
228 3300009177 Ga0105248_11222601 Ga0105248_112226012 137
229 3300009177 Ga0105248_11446103 Ga0105248_114461031 137
230 3300009551 Ga0105238_10125539 Ga0105238_101255393 137
231 3300009553 Ga0105249_10322248 Ga0105249_103222483 137
232 3300009553 Ga0105249_11041447 Ga0105249_110414471 137
233 3300009553 Ga0105249_11392458 Ga0105249_113924581 137
234 3300009553 Ga0105249_11681234 Ga0105249_116812341 137
235 3300011119 Ga0105246_10370282 Ga0105246_103702822 137
236 3300013100 Ga0157373_10000091 Ga0157373_1000009148 137
237 3300013100 Ga0157373_10098272 Ga0157373_100982722 137
238 3300013104 Ga0157370_10068788 Ga0157370_100687882 137
239 3300013297 Ga0157378_10058983 Ga0157378_100589834 137
240 3300013306 Ga0163162_11390663 Ga0163162_113906632 137
241 3300013307 Ga0157372_10007451 Ga0157372_1000745112 137
242 3300013308 Ga0157375_10898117 Ga0157375_108981172 137
243 3300014325 Ga0163163_10758528 Ga0163163_107585282 137
244 3300014326 Ga0157380_10001762 Ga0157380_100017628 137
245 3300014326 Ga0157380_10031428 Ga0157380_100314283 137
246 3300014326 Ga0157380_10523741 Ga0157380_105237412 137
247 3300014326 Ga0157380_10749311 Ga0157380_107493112 137
248 3300014968 Ga0157379_10035068 Ga0157379_100350686 137
249 3300014968 Ga0157379_11472185 Ga0157379_114721851 137
250 3300014969 Ga0157376_11161490 Ga0157376_111614902 137
251 3300017792 Ga0163161_10836667 Ga0163161_108366671 137
252 3300017792 Ga0163161_11656148 Ga0163161_116561482 137
253 3300025893 Ga0207682_10421225 Ga0207682_104212252 137
254 3300025899 Ga0207642_10021644 Ga0207642_100216444 137
255 3300025899 Ga0207642_10540104 Ga0207642_105401041 137
256 3300025903 Ga0207680_10498425 Ga0207680_104984252 137
257 3300025904 Ga0207647_10534121 Ga0207647_105341211 137
258 3300025906 Ga0207699_10244598 Ga0207699_102445982 137
259 3300025907 Ga0207645_10245607 Ga0207645_102456071 137
260 3300025907 Ga0207645_10913378 Ga0207645_109133781 137
261 3300025912 Ga0207707_10011369 Ga0207707_100113697 137
262 3300025912 Ga0207707_10519507 Ga0207707_105195071 137
263 3300025916 Ga0207663_10603790 Ga0207663_106037902 137
264 3300025917 Ga0207660_10335914 Ga0207660_103359143 137
265 3300025918 Ga0207662_10288007 Ga0207662_102880071 137
266 3300025921 Ga0207652_10040793 Ga0207652_100407932 137
267 3300025921 Ga0207652_10115697 Ga0207652_101156972 137
268 3300025922 Ga0207646_10207773 Ga0207646_102077733 137
269 3300025923 Ga0207681_10013808 Ga0207681_100138083 137
270 3300025923 Ga0207681_10023489 Ga0207681_100234895 137
271 3300025923 Ga0207681_10289607 Ga0207681_102896073 137
272 3300025925 Ga0207650_10148954 Ga0207650_101489543 137
273 3300025926 Ga0207659_10001583 Ga0207659_100015839 137
274 3300025926 Ga0207659_10176899 Ga0207659_101768993 137
275 3300025927 Ga0207687_10025897 Ga0207687_100258974 137
276 3300025927 Ga0207687_10283293 Ga0207687_102832932 137
277 3300025929 Ga0207664_10001974 Ga0207664_100019747 137
278 3300025931 Ga0207644_10504033 Ga0207644_105040333 137
279 3300025931 Ga0207644_10765624 Ga0207644_107656241 137
280 3300025933 Ga0207706_10144767 Ga0207706_101447671 137
281 3300025933 Ga0207706_11166814 Ga0207706_111668141 137
282 3300025934 Ga0207686_10176597 Ga0207686_101765971 137
283 3300025935 Ga0207709_10004342 Ga0207709_100043426 137
284 3300025935 Ga0207709_10414799 Ga0207709_104147992 137
285 3300025936 Ga0207670_10299379 Ga0207670_102993792 137
286 3300025936 Ga0207670_10688261 Ga0207670_106882612 137
287 3300025937 Ga0207669_10122349 Ga0207669_101223493 137
288 3300025938 Ga0207704_10148138 Ga0207704_101481382 137
289 3300025938 Ga0207704_11710044 Ga0207704_117100441 137
290 3300025939 Ga0207665_10249667 Ga0207665_102496673 137
291 3300025940 Ga0207691_10291769 Ga0207691_102917693 137
292 3300025941 Ga0207711_10277160 Ga0207711_102771602 137
293 3300025941 Ga0207711_10401141 Ga0207711_104011412 137
294 3300025941 Ga0207711_10477407 Ga0207711_104774072 137
295 3300025941 Ga0207711_11943187 Ga0207711_119431871 137
296 3300025942 Ga0207689_10712524 Ga0207689_107125242 137
297 3300025960 Ga0207651_10005977 Ga0207651_100059777 137
298 3300025960 Ga0207651_10106035 Ga0207651_101060353 137
299 3300025960 Ga0207651_10122496 Ga0207651_101224961 137
300 3300025960 Ga0207651_10163087 Ga0207651_101630873 137
301 3300025960 Ga0207651_10745595 Ga0207651_107455952 137
302 3300025961 Ga0207712_10189580 Ga0207712_101895804 137
303 3300025961 Ga0207712_10490533 Ga0207712_104905332 137
304 3300025961 Ga0207712_10979970 Ga0207712_109799701 137
305 3300025961 Ga0207712_11990618 Ga0207712_119906181 137
306 3300025972 Ga0207668_10221933 Ga0207668_102219333 137
307 3300025981 Ga0207640_10093769 Ga0207640_100937694 137
308 3300025981 Ga0207640_10206198 Ga0207640_102061983 137
309 3300025986 Ga0207658_10238640 Ga0207658_102386402 137
310 3300026023 Ga0207677_10061132 Ga0207677_100611324 137
311 3300026035 Ga0207703_10016106 Ga0207703_100161064 137
312 3300026035 Ga0207703_10030107 Ga0207703_100301073 137
313 3300026067 Ga0207678_11529697 Ga0207678_115296971 137
314 3300026075 Ga0207708_10004696 Ga0207708_100046966 137
315 3300026075 Ga0207708_10464023 Ga0207708_104640232 137
316 3300026075 Ga0207708_10637366 Ga0207708_106373662 137
317 3300026075 Ga0207708_10797547 Ga0207708_107975472 137
318 3300026075 Ga0207708_11998194 Ga0207708_119981941 137
319 3300026088 Ga0207641_10640748 Ga0207641_106407482 137
320 3300026089 Ga0207648_10018612 Ga0207648_100186126 137
321 3300026089 Ga0207648_10590515 Ga0207648_105905152 137
322 3300026089 Ga0207648_10890529 Ga0207648_108905292 137
323 3300026095 Ga0207676_10355299 Ga0207676_103552992 137
324 3300026095 Ga0207676_11106673 Ga0207676_111066731 137
325 3300026116 Ga0207674_10499114 Ga0207674_104991141 137
326 3300026116 Ga0207674_11557876 Ga0207674_115578761 137
327 3300026116 Ga0207674_11969322 Ga0207674_119693221 137
328 3300026118 Ga0207675_100069427 Ga0207675_1000694275 137
329 3300026118 Ga0207675_100304309 Ga0207675_1003043092 137
330 3300026118 Ga0207675_100312662 Ga0207675_1003126622 137
331 3300026118 Ga0207675_100762486 Ga0207675_1007624862 137
332 3300026121 Ga0207683_10202428 Ga0207683_102024283 137
333 3300026142 Ga0207698_11410228 Ga0207698_114102282 137
334 3300027907 Ga0207428_10025855 Ga0207428_100258553 137
335 3300027907 Ga0207428_10192452 Ga0207428_101924522 137
336 3300027907 Ga0207428_10261577 Ga0207428_102615773 137
337 3300028379 Ga0268266_10065198 Ga0268266_100651983 137
338 3300028379 Ga0268266_10745549 Ga0268266_107455492 137
339 3300028380 Ga0268265_10007975 Ga0268265_100079754 137
340 3300028380 Ga0268265_10540493 Ga0268265_105404933 137
341 3300028380 Ga0268265_10925805 Ga0268265_109258051 137
342 3300028380 Ga0268265_11173149 Ga0268265_111731491 137
343 3300028380 Ga0268265_12148484 Ga0268265_121484841 137
344 3300028381 Ga0268264_10139236 Ga0268264_101392363 137
345 3300028381 Ga0268264_10218599 Ga0268264_102185993 137
346 3300028381 Ga0268264_11740982 Ga0268264_117409821 137
347 3300028381 Ga0268264_12556916 Ga0268264_125569161 137
348 3300028653 Ga0265323_10004679 Ga0265323_100046795 137
349 3300028654 Ga0265322_10014175 Ga0265322_100141753 137
350 3300028794 Ga0307515_10001029 Ga0307515_1000102935 137
351 3300028794 Ga0307515_10759179 Ga0307515_107591791 137
352 3300031235 Ga0265330_10180813 Ga0265330_101808132 137
353 3300031344 Ga0265316_10001859 Ga0265316_1000185912 137
354 3300031616 Ga0307508_10695392 Ga0307508_106953922 137
355 3300031691 Ga0316579_10082833 Ga0316579_100828332 137
356 3300031691 Ga0316579_10240285 Ga0316579_102402852 137
357 3300031691 Ga0316579_10591837 Ga0316579_105918371 137
358 3300031712 Ga0265342_10017863 Ga0265342_100178636 137
359 3300031731 Ga0307405_11521302 Ga0307405_115213021 137
360 3300031733 Ga0316577_10161296 Ga0316577_101612962 137
361 3300031911 Ga0307412_10476215 Ga0307412_104762152 137
362 3300032002 Ga0307416_100485158 Ga0307416_1004851583 137
363 3300032126 Ga0307415_101164287 Ga0307415_1011642872 137
364 3300033179 Ga0307507_10001172 Ga0307507_1000117237 137
365 3300035083 Ga0373926_0037245 Ga0373926_0037245_541_954 137
366 3300035207 Ga0373942_0083982 Ga0373942_0083982_432_848 137
367 3300035398 Ga0316574_0338805 Ga0316574_0338805_526_942 137
368 3300035398 Ga0316574_0531512 Ga0316574_0531512_144_560 137
369 3300035692 Ga0373935_0502025 Ga0373935_0502025_216_629 137
370 3300035695 Ga0373927_1149234 Ga0373927_1149234_65_478 137
371 3300035725 Ga0373947_0117913 Ga0373947_0117913_1094_1507 137
372 3300036401 Ga0373937_2003250 Ga0373937_2003250_32_445 137
373 3300036647 Ga0316582_0040533 Ga0316582_0040533_1999_2445 137
374 3300036647 Ga0316582_0455491 Ga0316582_0455491_196_642 137
375 3300037068 Ga0373925_0304106 Ga0373925_0304106_331_744 137
376 3300037471 Ga0395905_0149340 Ga0395905_0149340_1541_1960 137
377 3300039093 Ga0400489_68697 Ga0400489_68697_1119_1535 137
378 3300039450 Ga0436363_1146630 Ga0436363_1146630_132_551 137
379 3300041408 Ga0439453_0021937 Ga0439453_0021937_17_430 137
380 3300041496 Ga0451839_0161978 Ga0451839_0161978_108_560 137
381 3300042438 Ga0439459_0157942 Ga0439459_0157942_120_539 137
382 3300042876 Ga0451577_0440085 Ga0451577_0440085_565_978 137
383 3300044694 Ga0466963_0346410 Ga0466963_0346410_141_662 137
384 3300045051 Ga0451576_0191038 Ga0451576_0191038_137_553 137
385 3300045051 Ga0451576_1803757 Ga0451576_1803757_148_564 137
386 3300046454 Ga0495592_0037981 Ga0495592_0037981_2635_3051 137
387 3300046459 Ga0495629_0419739 Ga0495629_0419739_51_464 137
388 3300046473 Ga0495582_0107079 Ga0495582_0107079_1032_1445 137
389 3300046507 Ga0495606_0013471 Ga0495606_0013471_2993_3412 137
390 3300046516 Ga0495628_0342708 Ga0495628_0342708_393_806 137
391 3300046536 Ga0495587_0634147 Ga0495587_0634147_126_539 137
392 3300046615 Ga0495656_0282118 Ga0495656_0282118_308_724 137
393 3300046642 Ga0495634_0054681 Ga0495634_0054681_1603_2028 137
394 3300046660 Ga0495625_0002214 Ga0495625_0002214_10341_10760 137
395 3300046678 Ga0495599_0254412 Ga0495599_0254412_180_596 137
396 3300046810 Ga0495660_0002682 Ga0495660_0002682_4506_4925 137
397 3300048088 Ga0495602_0200146 Ga0495602_0200146_532_948 137
398 3300048088 Ga0495602_0294433 Ga0495602_0294433_402_815 137
399 3300048903 Ga0496100_0469441 Ga0496100_0469441_222_638 137
400 3300048907 Ga0496104_0807162 Ga0496104_0807162_251_667 137
401 3300048908 Ga0496105_0323742 Ga0496105_0323742_32_448 137
402 3300048909 Ga0496106_0082146 Ga0496106_0082146_1522_1938 137
403 3300048910 Ga0496107_0792229 Ga0496107_0792229_14_427 137
404 3300048911 Ga0496108_0516736 Ga0496108_0516736_237_650 137
405 3300048911 Ga0496108_1394519 Ga0496108_1394519_90_506 137
406 3300048912 Ga0496109_0712277 Ga0496109_0712277_409_825 137
407 3300048912 Ga0496109_1079828 Ga0496109_1079828_226_639 137
408 3300048913 Ga0496110_0724955 Ga0496110_0724955_154_567 137
409 3300048915 Ga0496112_0987112 Ga0496112_0987112_241_657 137
410 3300048915 Ga0496112_1465286 Ga0496112_1465286_64_477 137
411 3300048917 Ga0496114_0565105 Ga0496114_0565105_314_730 137
412 3300048917 Ga0496114_1496191 Ga0496114_1496191_96_512 137
413 3300049568 Ga0501031_0587945 Ga0501031_0587945_265_681 137
414 3300049575 Ga0501039_0901941 Ga0501039_0901941_63_479 137
415 3300049576 Ga0501040_0038207 Ga0501040_0038207_86_502 137
416 3300049577 Ga0501041_0117305 Ga0501041_0117305_1056_1472 137
417 3300049578 Ga0501042_0261268 Ga0501042_0261268_370_786 137
418 3300049578 Ga0501042_0459725 Ga0501042_0459725_117_533 137
419 3300049582 Ga0501048_0504914 Ga0501048_0504914_402_818 137
420 3300049582 Ga0501048_1389666 Ga0501048_1389666_70_483 137
421 3300049584 Ga0501068_0705603 Ga0501068_0705603_89_529 137
422 3300049591 Ga0501075_0039710 Ga0501075_0039710_2895_3311 137
423 3300049591 Ga0501075_0316225 Ga0501075_0316225_223_642 137
424 3300049591 Ga0501075_0647279 Ga0501075_0647279_189_605 137
425 3300049592 Ga0501076_0019279 Ga0501076_0019279_349_765 137
426 3300049592 Ga0501076_0909092 Ga0501076_0909092_196_612 137
427 3300049593 Ga0501077_0842698 Ga0501077_0842698_117_539 137
428 3300049741 Ga0501079_0038754 Ga0501079_0038754_2294_2710 137
429 3300049741 Ga0501079_0273791 Ga0501079_0273791_275_691 137
430 3300049742 Ga0501080_0993760 Ga0501080_0993760_108_524 137
431 3300049743 Ga0501081_0133871 Ga0501081_0133871_1316_1735 137
432 3300049743 Ga0501081_0383965 Ga0501081_0383965_193_609 137
433 3300049743 Ga0501081_0463837 Ga0501081_0463837_262_678 137
434 3300049743 Ga0501081_0562902 Ga0501081_0562902_84_500 137
435 3300049824 Ga0501045_0216017 Ga0501045_0216017_702_1124 137
436 3300050493 nmdc:mga0k408_106_c1 nmdc:mga0k408_106_c1_23189_23608 137
437 3300050493 nmdc:mga0k408_166796_c1 nmdc:mga0k408_166796_c1_202_627 137
438 3300050507 nmdc:mga05p37_1047736_c1 nmdc:mga05p37_1047736_c1_162_611 137
439 3300050507 nmdc:mga05p37_16647_c1 nmdc:mga05p37_16647_c1_6829_7245 137
440 3300050507 nmdc:mga05p37_193286_c1 nmdc:mga05p37_193286_c1_1639_2055 137
441 3300050507 nmdc:mga05p37_197631_c1 nmdc:mga05p37_197631_c1_1495_1911 137
442 3300050508 nmdc:mga09592_331970_c1 nmdc:mga09592_331970_c1_169_633 137
443 3300050509 nmdc:mga0qj67_568107_c1 nmdc:mga0qj67_568107_c1_149_613 137
444 3300050509 nmdc:mga0qj67_926924_c1 nmdc:mga0qj67_926924_c1_162_578 137
445 3300050511 nmdc:mga08y16_13913_c1 nmdc:mga08y16_13913_c1_4274_4690 137
446 3300050511 nmdc:mga08y16_200303_c1 nmdc:mga08y16_200303_c1_919_1335 137
447 3300050511 nmdc:mga08y16_24560_c1 nmdc:mga08y16_24560_c1_5620_6036 137
448 3300050511 nmdc:mga08y16_29270_c1 nmdc:mga08y16_29270_c1_4860_5276 137
449 3300050511 nmdc:mga08y16_5934_c1 nmdc:mga08y16_5934_c1_7069_7485 137
450 3300050511 nmdc:mga08y16_598027_c1 nmdc:mga08y16_598027_c1_613_1029 137
451 3300050512 nmdc:mga0n895_1125254_c1 nmdc:mga0n895_1125254_c1_231_659 137
452 3300050512 nmdc:mga0n895_28663_c1 nmdc:mga0n895_28663_c1_3513_3929 137
453 3300050512 nmdc:mga0n895_344115_c1 nmdc:mga0n895_344115_c1_328_747 137
454 3300050512 nmdc:mga0n895_441670_c1 nmdc:mga0n895_441670_c1_505_918 137
455 3300050512 nmdc:mga0n895_59104_c1 nmdc:mga0n895_59104_c1_2222_2638 137
456 3300050512 nmdc:mga0n895_631931_c1 nmdc:mga0n895_631931_c1_636_1052 137
457 3300050513 nmdc:mga0rr50_470115_c1 nmdc:mga0rr50_470115_c1_550_966 137
458 3300050513 nmdc:mga0rr50_58317_c1 nmdc:mga0rr50_58317_c1_459_875 137
459 3300050513 nmdc:mga0rr50_627586_c1 nmdc:mga0rr50_627586_c1_447_863 137
460 3300050513 nmdc:mga0rr50_691294_c1 nmdc:mga0rr50_691294_c1_151_579 137
461 3300050513 nmdc:mga0rr50_878910_c1 nmdc:mga0rr50_878910_c1_205_621 137
462 3300050514 nmdc:mga08x19_137679_c1 nmdc:mga08x19_137679_c1_18_467 137
463 3300050514 nmdc:mga08x19_143753_c1 nmdc:mga08x19_143753_c1_450_866 137
464 3300050514 nmdc:mga08x19_26867_c1 nmdc:mga08x19_26867_c1_1158_1574 137
465 3300050514 nmdc:mga08x19_37315_c1 nmdc:mga08x19_37315_c1_2481_2897 137
466 3300050514 nmdc:mga08x19_49681_c1 nmdc:mga08x19_49681_c1_660_1076 137
467 3300050514 nmdc:mga08x19_899038_c1 nmdc:mga08x19_899038_c1_41_469 137
468 3300050515 nmdc:mga0a205_472477_c1 nmdc:mga0a205_472477_c1_31_447 137
469 3300050515 nmdc:mga0a205_474679_c1 nmdc:mga0a205_474679_c1_511_930 137
470 3300050515 nmdc:mga0a205_62314_c1 nmdc:mga0a205_62314_c1_193_609 137
471 3300050515 nmdc:mga0a205_81371_c1 nmdc:mga0a205_81371_c1_345_761 137
472 3300053085 Ga0495619_0260684 Ga0495619_0260684_152_565 137
473 3300054114 Ga0501084_0037225 Ga0501084_0037225_1374_1790 137
474 3300054114 Ga0501084_0441005 Ga0501084_0441005_334_753 137
475 3300060353 Ga0501082_0156810 Ga0501082_0156810_983_1399 137
476 3300060353 Ga0501082_0427261 Ga0501082_0427261_273_689 137
477 3300061734 Ga0530510_0307597 Ga0530510_0307597_567_992 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

2

136

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9948 2 136
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9944 2 136
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9928 1 136
4ek2-assembly1.cif.gz_A the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate 0.9923 2 136
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9917 2 136
ID Description Score Start End Superfamily
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9896 2 131 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.986 2 136 3.30.70.141
af_I1KHD6_3_118_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9832 31 131 3.30.70.141
af_F1R4T6_18_163_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9817 2 131 3.30.70.141
af_O88425_6_161_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.981 2 131 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A3M2CU60-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 1 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A388PZN9-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A524K0C0-F1-model_v4 Nucleoside-diphosphate kinase (EC 2.7.4.6) 1.001 1 131 GO:0004550
GO:0006183
GO:0006228
GO:0006241
AF-A0A2D7MEP1-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1 3 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-V6DH04-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1 2 132 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Feature Viewer

pLDDT pTM Quality
97.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map