F451634
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 477 | 246 | 477 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10186311|Ga0065707_101863112 |
| Length | 154 |
| Sequence | MERTFCMIKPDGVQRRLVGKILQRFEEKGLRIAGLKLIKVDKATAENLYSVHKGRPFYDTLVAFVTSSPVVAMVLEGNGTIEIVRTLLGATFGFQAAPGTIRGDYGSSKGFNLIHASDSKDSAAREIPIFFKPKELVAWTHADHVWVYEEPERG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 159 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 160 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 180 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 181 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 182 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 244 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.47 |
| Nodule | 0 |
| Rhizoplane | 3.98 |
| Rhizosphere | 92.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10023968 | 3300002459 | Bacteria | 1265 |
| 2 | rootL2_10093759 | 3300003322 | Bacteria | 6055 |
| 3 | rootH1_10187321 | 3300003323 | Bacteria | 1681 |
| 4 | Ga0058862_12379370 | 3300004803 | Bacteria | 768 |
| 5 | Ga0065715_10098529 | 3300005293 | Bacteria | 3535 |
| 6 | Ga0065715_10190822 | 3300005293 | Bacteria | 1416 |
| 7 | Ga0065715_10372249 | 3300005293 | Bacteria | 911 |
| 8 | Ga0065707_10186311 | 3300005295 | Bacteria | 1387 |
| 9 | Ga0065707_10411315 | 3300005295 | Bacteria | 841 |
| 10 | Ga0070676_10011008 | 3300005328 | Bacteria | 4914 |
| 11 | Ga0070676_10251957 | 3300005328 | Bacteria | 1179 |
| 12 | Ga0070683_100012137 | 3300005329 | Bacteria | 7477 |
| 13 | Ga0070670_100173094 | 3300005331 | Bacteria | 1873 |
| 14 | Ga0068869_101101039 | 3300005334 | Unclassified | 695 |
| 15 | Ga0070666_10095575 | 3300005335 | Bacteria | 2045 |
| 16 | Ga0070666_10281076 | 3300005335 | Bacteria | 1183 |
| 17 | Ga0070666_10498294 | 3300005335 | Bacteria | 883 |
| 18 | Ga0070680_100232887 | 3300005336 | Bacteria | 1556 |
| 19 | Ga0068868_100476657 | 3300005338 | Bacteria | 1089 |
| 20 | Ga0068868_100634454 | 3300005338 | Bacteria | 950 |
| 21 | Ga0070689_100275994 | 3300005340 | Bacteria | 1393 |
| 22 | Ga0070689_100461699 | 3300005340 | Bacteria | 1082 |
| 23 | Ga0070691_10056269 | 3300005341 | Bacteria | 1885 |
| 24 | Ga0070687_100506396 | 3300005343 | Bacteria | 814 |
| 25 | Ga0070668_100098442 | 3300005347 | Bacteria | 2314 |
| 26 | Ga0070669_100104564 | 3300005353 | Bacteria | 2140 |
| 27 | Ga0070669_100130587 | 3300005353 | Bacteria | 1927 |
| 28 | Ga0070669_100345394 | 3300005353 | Bacteria | 1207 |
| 29 | Ga0070675_100000055 | 3300005354 | Bacteria | 68147 |
| 30 | Ga0070675_100268899 | 3300005354 | Bacteria | 1495 |
| 31 | Ga0070671_100284468 | 3300005355 | Bacteria | 1407 |
| 32 | Ga0070674_100323363 | 3300005356 | Bacteria | 1237 |
| 33 | Ga0070674_100580226 | 3300005356 | Bacteria | 945 |
| 34 | Ga0070673_100065744 | 3300005364 | Bacteria | 2894 |
| 35 | Ga0070673_100132427 | 3300005364 | Bacteria | 2094 |
| 36 | Ga0070673_100179289 | 3300005364 | Bacteria | 1813 |
| 37 | Ga0070673_100248346 | 3300005364 | Bacteria | 1550 |
| 38 | Ga0070688_100939007 | 3300005365 | Bacteria | 684 |
| 39 | Ga0070667_100375915 | 3300005367 | Bacteria | 1290 |
| 40 | Ga0070703_10040617 | 3300005406 | Bacteria | 1447 |
| 41 | Ga0070714_100053101 | 3300005435 | Bacteria | 3458 |
| 42 | Ga0070701_10030874 | 3300005438 | Bacteria | 2654 |
| 43 | Ga0070711_100855264 | 3300005439 | Bacteria | 774 |
| 44 | Ga0070705_100038938 | 3300005440 | Bacteria | 2694 |
| 45 | Ga0070705_100078211 | 3300005440 | Bacteria | 2022 |
| 46 | Ga0070700_100005782 | 3300005441 | Bacteria | 6563 |
| 47 | Ga0070700_100331311 | 3300005441 | Bacteria | 1122 |
| 48 | Ga0070700_100604546 | 3300005441 | Unclassified | 860 |
| 49 | Ga0070700_100731899 | 3300005441 | Bacteria | 790 |
| 50 | Ga0070700_100800967 | 3300005441 | Bacteria | 759 |
| 51 | Ga0070694_100036188 | 3300005444 | Bacteria | 3269 |
| 52 | Ga0070694_100213730 | 3300005444 | Bacteria | 1444 |
| 53 | Ga0070694_101056538 | 3300005444 | Bacteria | 676 |
| 54 | Ga0070694_101066701 | 3300005444 | Bacteria | 673 |
| 55 | Ga0070708_101535867 | 3300005445 | Bacteria | 620 |
| 56 | Ga0070663_100088734 | 3300005455 | Bacteria | 2287 |
| 57 | Ga0070663_100512314 | 3300005455 | Bacteria | 998 |
| 58 | Ga0070663_101063012 | 3300005455 | Bacteria | 706 |
| 59 | Ga0070678_100128353 | 3300005456 | Bacteria | 2010 |
| 60 | Ga0070662_100211369 | 3300005457 | Bacteria | 1544 |
| 61 | Ga0070662_100396819 | 3300005457 | Bacteria | 1138 |
| 62 | Ga0070681_10042317 | 3300005458 | Bacteria | 4565 |
| 63 | Ga0070681_10136275 | 3300005458 | Bacteria | 2386 |
| 64 | Ga0068867_100012999 | 3300005459 | Bacteria | 5891 |
| 65 | Ga0068867_100570580 | 3300005459 | Bacteria | 983 |
| 66 | Ga0068867_102219996 | 3300005459 | Bacteria | 521 |
| 67 | Ga0070706_100769713 | 3300005467 | Bacteria | 892 |
| 68 | Ga0070706_101637414 | 3300005467 | Bacteria | 587 |
| 69 | Ga0070707_100243323 | 3300005468 | Bacteria | 1751 |
| 70 | Ga0070707_100684735 | 3300005468 | Bacteria | 988 |
| 71 | Ga0070698_100051643 | 3300005471 | Bacteria | 4187 |
| 72 | Ga0070698_100143310 | 3300005471 | Bacteria | 2340 |
| 73 | Ga0070699_100066431 | 3300005518 | Bacteria | 3131 |
| 74 | Ga0070699_100116323 | 3300005518 | Bacteria | 2350 |
| 75 | Ga0070699_100226446 | 3300005518 | Bacteria | 1667 |
| 76 | Ga0070699_100242887 | 3300005518 | Bacteria | 1608 |
| 77 | Ga0070679_100016517 | 3300005530 | Bacteria | 7125 |
| 78 | Ga0070679_100425654 | 3300005530 | Bacteria | 1273 |
| 79 | Ga0070684_100097864 | 3300005535 | Bacteria | 2617 |
| 80 | Ga0070697_100016556 | 3300005536 | Bacteria | 5799 |
| 81 | Ga0070672_100798763 | 3300005543 | Bacteria | 830 |
| 82 | Ga0070686_100077016 | 3300005544 | Bacteria | 2197 |
| 83 | Ga0070686_100719069 | 3300005544 | Bacteria | 798 |
| 84 | Ga0070695_100232150 | 3300005545 | Bacteria | 1334 |
| 85 | Ga0070695_100251150 | 3300005545 | Bacteria | 1287 |
| 86 | Ga0070695_100622095 | 3300005545 | Bacteria | 850 |
| 87 | Ga0070696_100161162 | 3300005546 | Bacteria | 1653 |
| 88 | Ga0070665_100030161 | 3300005548 | Bacteria | 5457 |
| 89 | Ga0070704_100122684 | 3300005549 | Bacteria | 1999 |
| 90 | Ga0070704_100273465 | 3300005549 | Bacteria | 1397 |
| 91 | Ga0070704_100373903 | 3300005549 | Bacteria | 1209 |
| 92 | Ga0070704_100554214 | 3300005549 | Bacteria | 1005 |
| 93 | Ga0070704_100645467 | 3300005549 | Bacteria | 934 |
| 94 | Ga0070704_100810937 | 3300005549 | Bacteria | 837 |
| 95 | Ga0068855_100206959 | 3300005563 | Bacteria | 2207 |
| 96 | Ga0068855_100393535 | 3300005563 | Bacteria | 1520 |
| 97 | Ga0068857_102241808 | 3300005577 | Unclassified | 536 |
| 98 | Ga0068854_100037831 | 3300005578 | Bacteria | 3389 |
| 99 | Ga0068854_100104542 | 3300005578 | Bacteria | 2127 |
| 100 | Ga0070702_100029043 | 3300005615 | Bacteria | 3003 |
| 101 | Ga0070702_100206209 | 3300005615 | Bacteria | 1305 |
| 102 | Ga0070702_100718267 | 3300005615 | Bacteria | 764 |
| 103 | Ga0068859_100012519 | 3300005617 | Bacteria | 8532 |
| 104 | Ga0068859_100104910 | 3300005617 | Bacteria | 2886 |
| 105 | Ga0068859_100302619 | 3300005617 | Bacteria | 1692 |
| 106 | Ga0068864_100257585 | 3300005618 | Bacteria | 1622 |
| 107 | Ga0068864_101099718 | 3300005618 | Bacteria | 791 |
| 108 | Ga0068866_10074412 | 3300005718 | Bacteria | 1806 |
| 109 | Ga0068866_10876226 | 3300005718 | Bacteria | 630 |
| 110 | Ga0068861_100010150 | 3300005719 | Bacteria | 6531 |
| 111 | Ga0068861_100063772 | 3300005719 | Bacteria | 2833 |
| 112 | Ga0068861_100164631 | 3300005719 | Bacteria | 1832 |
| 113 | Ga0068861_100233922 | 3300005719 | Bacteria | 1560 |
| 114 | Ga0068861_100358439 | 3300005719 | Bacteria | 1282 |
| 115 | Ga0068861_100692441 | 3300005719 | Bacteria | 946 |
| 116 | Ga0068861_100886749 | 3300005719 | Bacteria | 844 |
| 117 | Ga0068863_100406122 | 3300005841 | Bacteria | 1333 |
| 118 | Ga0068858_100006437 | 3300005842 | Bacteria | 11436 |
| 119 | Ga0068860_100476900 | 3300005843 | Bacteria | 1243 |
| 120 | Ga0068862_100011943 | 3300005844 | Bacteria | 7175 |
| 121 | Ga0068862_100114836 | 3300005844 | Bacteria | 2367 |
| 122 | Ga0068862_100264105 | 3300005844 | Bacteria | 1572 |
| 123 | Ga0068862_100705613 | 3300005844 | Bacteria | 978 |
| 124 | Ga0081539_10021620 | 3300005985 | Bacteria | 4287 |
| 125 | Ga0070717_10298964 | 3300006028 | Bacteria | 1431 |
| 126 | Ga0075368_10577921 | 3300006042 | Bacteria | 507 |
| 127 | Ga0070715_10332350 | 3300006163 | Bacteria | 824 |
| 128 | Ga0075366_10000073 | 3300006195 | Bacteria | 38953 |
| 129 | Ga0075366_10142162 | 3300006195 | Bacteria | 1451 |
| 130 | Ga0097621_100432165 | 3300006237 | Bacteria | 1183 |
| 131 | Ga0068871_100127124 | 3300006358 | Bacteria | 2158 |
| 132 | Ga0068871_100428978 | 3300006358 | Bacteria | 1182 |
| 133 | Ga0075428_100003953 | 3300006844 | Bacteria | 16260 |
| 134 | Ga0075428_100412915 | 3300006844 | Bacteria | 1446 |
| 135 | Ga0075430_100647391 | 3300006846 | Bacteria | 871 |
| 136 | Ga0075430_101475088 | 3300006846 | Bacteria | 559 |
| 137 | Ga0075431_100026134 | 3300006847 | Bacteria | 5988 |
| 138 | Ga0075433_10000238 | 3300006852 | Bacteria | 31539 |
| 139 | Ga0075433_10087165 | 3300006852 | Bacteria | 2757 |
| 140 | Ga0075433_10185875 | 3300006852 | Unclassified | 1849 |
| 141 | Ga0075433_10193776 | 3300006852 | Bacteria | 1808 |
| 142 | Ga0075433_10200329 | 3300006852 | Bacteria | 1775 |
| 143 | Ga0075434_100026749 | 3300006871 | Bacteria | 5656 |
| 144 | Ga0075434_100125622 | 3300006871 | Bacteria | 2582 |
| 145 | Ga0075434_100190056 | 3300006871 | Bacteria | 2074 |
| 146 | Ga0075434_100259767 | 3300006871 | Bacteria | 1756 |
| 147 | Ga0075434_100279545 | 3300006871 | Bacteria | 1689 |
| 148 | Ga0075429_100376226 | 3300006880 | Bacteria | 1243 |
| 149 | Ga0068865_100153658 | 3300006881 | Bacteria | 1748 |
| 150 | Ga0075436_100006766 | 3300006914 | Bacteria | 7847 |
| 151 | Ga0075436_100010266 | 3300006914 | Bacteria | 6411 |
| 152 | Ga0075436_100032710 | 3300006914 | Bacteria | 3584 |
| 153 | Ga0075436_100040108 | 3300006914 | Bacteria | 3231 |
| 154 | Ga0097620_100012519 | 3300006931 | Bacteria | 8532 |
| 155 | Ga0097620_100104908 | 3300006931 | Bacteria | 2886 |
| 156 | Ga0097620_100302608 | 3300006931 | Bacteria | 1692 |
| 157 | Ga0075435_100009659 | 3300007076 | Bacteria | 7004 |
| 158 | Ga0075435_100056415 | 3300007076 | Bacteria | 3175 |
| 159 | Ga0075435_100194449 | 3300007076 | Bacteria | 1717 |
| 160 | Ga0075435_100422936 | 3300007076 | Bacteria | 1147 |
| 161 | Ga0075435_100895807 | 3300007076 | Bacteria | 774 |
| 162 | Ga0105240_10168234 | 3300009093 | Bacteria | 2598 |
| 163 | Ga0105240_11574409 | 3300009093 | Bacteria | 688 |
| 164 | Ga0111539_10014220 | 3300009094 | Bacteria | 9938 |
| 165 | Ga0111539_10022709 | 3300009094 | Bacteria | 7706 |
| 166 | Ga0111539_10032649 | 3300009094 | Bacteria | 6321 |
| 167 | Ga0111539_10034811 | 3300009094 | Bacteria | 6102 |
| 168 | Ga0111539_10209650 | 3300009094 | Bacteria | 2270 |
| 169 | Ga0111539_10308036 | 3300009094 | Bacteria | 1843 |
| 170 | Ga0111539_10366088 | 3300009094 | Bacteria | 1678 |
| 171 | Ga0111539_10609070 | 3300009094 | Unclassified | 1272 |
| 172 | Ga0111539_10749319 | 3300009094 | Bacteria | 1137 |
| 173 | Ga0105245_10031404 | 3300009098 | Bacteria | 4700 |
| 174 | Ga0105245_10423813 | 3300009098 | Unclassified | 1334 |
| 175 | Ga0105245_12184923 | 3300009098 | Bacteria | 607 |
| 176 | Ga0105247_10056455 | 3300009101 | Bacteria | 2425 |
| 177 | Ga0114129_10023013 | 3300009147 | Bacteria | 8841 |
| 178 | Ga0114129_10046542 | 3300009147 | Bacteria | 6095 |
| 179 | Ga0114129_10373242 | 3300009147 | Bacteria | 1885 |
| 180 | Ga0114129_11714050 | 3300009147 | Unclassified | 766 |
| 181 | Ga0105243_10062383 | 3300009148 | Bacteria | 2984 |
| 182 | Ga0105243_10240337 | 3300009148 | Bacteria | 1611 |
| 183 | Ga0105243_10443379 | 3300009148 | Unclassified | 1216 |
| 184 | Ga0105243_10627698 | 3300009148 | Bacteria | 1038 |
| 185 | Ga0105243_10693096 | 3300009148 | Bacteria | 992 |
| 186 | Ga0105243_11373893 | 3300009148 | Bacteria | 726 |
| 187 | Ga0105242_10063292 | 3300009176 | Bacteria | 3046 |
| 188 | Ga0105242_10143754 | 3300009176 | Bacteria | 2073 |
| 189 | Ga0105242_11241834 | 3300009176 | Bacteria | 766 |
| 190 | Ga0105248_10060104 | 3300009177 | Bacteria | 4266 |
| 191 | Ga0105248_10180242 | 3300009177 | Bacteria | 2381 |
| 192 | Ga0105248_10444226 | 3300009177 | Bacteria | 1461 |
| 193 | Ga0105248_10925607 | 3300009177 | Bacteria | 984 |
| 194 | Ga0105248_11222601 | 3300009177 | Bacteria | 850 |
| 195 | Ga0105248_11446103 | 3300009177 | Bacteria | 778 |
| 196 | Ga0105238_10125539 | 3300009551 | Bacteria | 2545 |
| 197 | Ga0105249_10322248 | 3300009553 | Bacteria | 1557 |
| 198 | Ga0105249_11041447 | 3300009553 | Bacteria | 888 |
| 199 | Ga0105249_11392458 | 3300009553 | Unclassified | 773 |
| 200 | Ga0105249_11681234 | 3300009553 | Bacteria | 707 |
| 201 | Ga0105246_10370282 | 3300011119 | Bacteria | 1180 |
| 202 | Ga0157373_10000091 | 3300013100 | Bacteria | 75012 |
| 203 | Ga0157373_10098272 | 3300013100 | Bacteria | 2060 |
| 204 | Ga0157370_10068788 | 3300013104 | Bacteria | 3346 |
| 205 | Ga0157378_10058983 | 3300013297 | Bacteria | 3423 |
| 206 | Ga0163162_11390663 | 3300013306 | Bacteria | 798 |
| 207 | Ga0157372_10007451 | 3300013307 | Bacteria | 11640 |
| 208 | Ga0157375_10898117 | 3300013308 | Bacteria | 1030 |
| 209 | Ga0157375_11413986 | 3300013308 | Bacteria | 820 |
| 210 | Ga0163163_10631318 | 3300014325 | Bacteria | 1135 |
| 211 | Ga0163163_10758528 | 3300014325 | Bacteria | 1034 |
| 212 | Ga0157380_10001762 | 3300014326 | Bacteria | 14288 |
| 213 | Ga0157380_10031428 | 3300014326 | Bacteria | 4076 |
| 214 | Ga0157380_10523741 | 3300014326 | Bacteria | 1157 |
| 215 | Ga0157380_10749311 | 3300014326 | Unclassified | 988 |
| 216 | Ga0157379_10035068 | 3300014968 | Bacteria | 4472 |
| 217 | Ga0157379_11472185 | 3300014968 | Bacteria | 662 |
| 218 | Ga0157376_11161490 | 3300014969 | Bacteria | 799 |
| 219 | Ga0163161_10836667 | 3300017792 | Bacteria | 776 |
| 220 | Ga0163161_11656148 | 3300017792 | Bacteria | 566 |
| 221 | Ga0209026_1000225 | 3300025250 | Bacteria | 77234 |
| 222 | Ga0209026_1002625 | 3300025250 | Bacteria | 6562 |
| 223 | Ga0209148_1039518 | 3300025254 | Bacteria | 659 |
| 224 | Ga0207682_10421225 | 3300025893 | Bacteria | 631 |
| 225 | Ga0207642_10021644 | 3300025899 | Bacteria | 2535 |
| 226 | Ga0207642_10540104 | 3300025899 | Bacteria | 718 |
| 227 | Ga0207680_10498425 | 3300025903 | Bacteria | 867 |
| 228 | Ga0207647_10534121 | 3300025904 | Unclassified | 652 |
| 229 | Ga0207699_10244598 | 3300025906 | Unclassified | 1234 |
| 230 | Ga0207645_10245607 | 3300025907 | Bacteria | 1183 |
| 231 | Ga0207645_10913378 | 3300025907 | Unclassified | 596 |
| 232 | Ga0207707_10011369 | 3300025912 | Bacteria | 7750 |
| 233 | Ga0207707_10519507 | 3300025912 | Bacteria | 1014 |
| 234 | Ga0207663_10603790 | 3300025916 | Bacteria | 862 |
| 235 | Ga0207660_10335914 | 3300025917 | Bacteria | 1209 |
| 236 | Ga0207662_10076442 | 3300025918 | Bacteria | 2035 |
| 237 | Ga0207662_10288007 | 3300025918 | Bacteria | 1089 |
| 238 | Ga0207652_10040793 | 3300025921 | Bacteria | 3943 |
| 239 | Ga0207652_10115697 | 3300025921 | Bacteria | 2382 |
| 240 | Ga0207646_10207773 | 3300025922 | Bacteria | 1768 |
| 241 | Ga0207681_10013808 | 3300025923 | Bacteria | 5004 |
| 242 | Ga0207681_10023489 | 3300025923 | Bacteria | 3944 |
| 243 | Ga0207681_10289607 | 3300025923 | Bacteria | 1292 |
| 244 | Ga0207650_10148954 | 3300025925 | Bacteria | 1845 |
| 245 | Ga0207659_10001583 | 3300025926 | Bacteria | 13492 |
| 246 | Ga0207659_10176899 | 3300025926 | Bacteria | 1687 |
| 247 | Ga0207687_10025897 | 3300025927 | Bacteria | 3926 |
| 248 | Ga0207687_10283293 | 3300025927 | Bacteria | 1329 |
| 249 | Ga0207664_10001974 | 3300025929 | Bacteria | 13499 |
| 250 | Ga0207644_10504033 | 3300025931 | Unclassified | 999 |
| 251 | Ga0207644_10765624 | 3300025931 | Bacteria | 807 |
| 252 | Ga0207706_10144767 | 3300025933 | Bacteria | 2091 |
| 253 | Ga0207706_11166814 | 3300025933 | Bacteria | 641 |
| 254 | Ga0207686_10176597 | 3300025934 | Bacteria | 1511 |
| 255 | Ga0207686_10264878 | 3300025934 | Bacteria | 1262 |
| 256 | Ga0207709_10004342 | 3300025935 | Bacteria | 8205 |
| 257 | Ga0207709_10414799 | 3300025935 | Bacteria | 1033 |
| 258 | Ga0207670_10299379 | 3300025936 | Bacteria | 1259 |
| 259 | Ga0207670_10688261 | 3300025936 | Bacteria | 845 |
| 260 | Ga0207669_10122349 | 3300025937 | Bacteria | 1769 |
| 261 | Ga0207704_10148138 | 3300025938 | Bacteria | 1652 |
| 262 | Ga0207704_11710044 | 3300025938 | Bacteria | 541 |
| 263 | Ga0207665_10249667 | 3300025939 | Bacteria | 1311 |
| 264 | Ga0207691_10291769 | 3300025940 | Bacteria | 1402 |
| 265 | Ga0207711_10277160 | 3300025941 | Bacteria | 1544 |
| 266 | Ga0207711_10401141 | 3300025941 | Bacteria | 1274 |
| 267 | Ga0207711_10477407 | 3300025941 | Bacteria | 1161 |
| 268 | Ga0207711_11943187 | 3300025941 | Bacteria | 531 |
| 269 | Ga0207689_10712524 | 3300025942 | Bacteria | 846 |
| 270 | Ga0207661_10046300 | 3300025944 | Bacteria | 3449 |
| 271 | Ga0207651_10005977 | 3300025960 | Bacteria | 6307 |
| 272 | Ga0207651_10106035 | 3300025960 | Bacteria | 2098 |
| 273 | Ga0207651_10122496 | 3300025960 | Bacteria | 1975 |
| 274 | Ga0207651_10163087 | 3300025960 | Bacteria | 1749 |
| 275 | Ga0207651_10745595 | 3300025960 | Bacteria | 865 |
| 276 | Ga0207712_10189580 | 3300025961 | Bacteria | 1622 |
| 277 | Ga0207712_10490533 | 3300025961 | Bacteria | 1048 |
| 278 | Ga0207712_10979970 | 3300025961 | Bacteria | 750 |
| 279 | Ga0207712_11990618 | 3300025961 | Bacteria | 520 |
| 280 | Ga0207668_10221933 | 3300025972 | Bacteria | 1518 |
| 281 | Ga0207640_10093769 | 3300025981 | Bacteria | 2086 |
| 282 | Ga0207640_10206198 | 3300025981 | Bacteria | 1494 |
| 283 | Ga0207658_10238640 | 3300025986 | Bacteria | 1539 |
| 284 | Ga0207677_10061132 | 3300026023 | Bacteria | 2607 |
| 285 | Ga0207677_10455597 | 3300026023 | Bacteria | 1097 |
| 286 | Ga0207703_10016106 | 3300026035 | Bacteria | 5829 |
| 287 | Ga0207703_10030107 | 3300026035 | Bacteria | 4288 |
| 288 | Ga0207678_11529697 | 3300026067 | Bacteria | 589 |
| 289 | Ga0207708_10004696 | 3300026075 | Bacteria | 10049 |
| 290 | Ga0207708_10464023 | 3300026075 | Bacteria | 1056 |
| 291 | Ga0207708_10637366 | 3300026075 | Bacteria | 906 |
| 292 | Ga0207708_10797547 | 3300026075 | Bacteria | 813 |
| 293 | Ga0207708_11998194 | 3300026075 | Bacteria | 508 |
| 294 | Ga0207641_10640748 | 3300026088 | Bacteria | 1043 |
| 295 | Ga0207648_10018612 | 3300026089 | Bacteria | 6284 |
| 296 | Ga0207648_10590515 | 3300026089 | Bacteria | 1023 |
| 297 | Ga0207648_10890529 | 3300026089 | Bacteria | 831 |
| 298 | Ga0207676_10355299 | 3300026095 | Bacteria | 1356 |
| 299 | Ga0207676_11106673 | 3300026095 | Bacteria | 783 |
| 300 | Ga0207674_10499114 | 3300026116 | Bacteria | 1176 |
| 301 | Ga0207674_11557876 | 3300026116 | Bacteria | 629 |
| 302 | Ga0207674_11969322 | 3300026116 | Unclassified | 550 |
| 303 | Ga0207675_100069427 | 3300026118 | Bacteria | 3293 |
| 304 | Ga0207675_100304309 | 3300026118 | Bacteria | 1553 |
| 305 | Ga0207675_100312662 | 3300026118 | Bacteria | 1532 |
| 306 | Ga0207675_100762486 | 3300026118 | Bacteria | 979 |
| 307 | Ga0207683_10202428 | 3300026121 | Bacteria | 1805 |
| 308 | Ga0207698_11410228 | 3300026142 | Bacteria | 712 |
| 309 | Ga0207428_10025855 | 3300027907 | Bacteria | 4907 |
| 310 | Ga0207428_10192452 | 3300027907 | Bacteria | 1537 |
| 311 | Ga0207428_10261577 | 3300027907 | Bacteria | 1289 |
| 312 | Ga0268266_10065198 | 3300028379 | Bacteria | 3148 |
| 313 | Ga0268266_10745549 | 3300028379 | Bacteria | 945 |
| 314 | Ga0268265_10007975 | 3300028380 | Bacteria | 7148 |
| 315 | Ga0268265_10540493 | 3300028380 | Bacteria | 1104 |
| 316 | Ga0268265_10925805 | 3300028380 | Bacteria | 857 |
| 317 | Ga0268265_11173149 | 3300028380 | Bacteria | 765 |
| 318 | Ga0268265_12148484 | 3300028380 | Unclassified | 565 |
| 319 | Ga0268264_10139236 | 3300028381 | Bacteria | 2162 |
| 320 | Ga0268264_10218599 | 3300028381 | Bacteria | 1753 |
| 321 | Ga0268264_11740982 | 3300028381 | Bacteria | 634 |
| 322 | Ga0268264_12556916 | 3300028381 | Bacteria | 515 |
| 323 | Ga0265323_10004679 | 3300028653 | Bacteria | 5873 |
| 324 | Ga0265322_10014175 | 3300028654 | Bacteria | 2305 |
| 325 | Ga0307515_10001029 | 3300028794 | Bacteria | 63730 |
| 326 | Ga0307515_10759179 | 3300028794 | Bacteria | 589 |
| 327 | Ga0265330_10180813 | 3300031235 | Unclassified | 893 |
| 328 | Ga0265316_10001859 | 3300031344 | Bacteria | 22203 |
| 329 | Ga0307508_10695392 | 3300031616 | Bacteria | 626 |
| 330 | Ga0316579_10082833 | 3300031691 | Bacteria | 1529 |
| 331 | Ga0316579_10240285 | 3300031691 | Unclassified | 876 |
| 332 | Ga0316579_10591837 | 3300031691 | Bacteria | 537 |
| 333 | Ga0265342_10017863 | 3300031712 | Bacteria | 4605 |
| 334 | Ga0265342_10055083 | 3300031712 | Bacteria | 2362 |
| 335 | Ga0307405_11521302 | 3300031731 | Bacteria | 588 |
| 336 | Ga0316577_10161296 | 3300031733 | Bacteria | 1265 |
| 337 | Ga0307412_10476215 | 3300031911 | Bacteria | 1034 |
| 338 | Ga0307416_100485158 | 3300032002 | Unclassified | 1297 |
| 339 | Ga0307415_101164287 | 3300032126 | Unclassified | 725 |
| 340 | Ga0307507_10001172 | 3300033179 | Bacteria | 58234 |
| 341 | Ga0373926_0037245 | 3300035083 | Bacteria | 1730 |
| 342 | Ga0373942_0083982 | 3300035207 | Bacteria | 950 |
| 343 | Ga0316574_0338805 | 3300035398 | Bacteria | 953 |
| 344 | Ga0316574_0531512 | 3300035398 | Bacteria | 731 |
| 345 | Ga0373935_0502025 | 3300035692 | Bacteria | 881 |
| 346 | Ga0373927_1149234 | 3300035695 | Bacteria | 512 |
| 347 | Ga0373947_0117913 | 3300035725 | Bacteria | 1684 |
| 348 | Ga0373937_2003250 | 3300036401 | Bacteria | 525 |
| 349 | Ga0316582_0040533 | 3300036647 | Bacteria | 2907 |
| 350 | Ga0316582_0455491 | 3300036647 | Unclassified | 882 |
| 351 | Ga0373925_0304106 | 3300037068 | Bacteria | 1288 |
| 352 | Ga0395905_0149340 | 3300037471 | Bacteria | 2199 |
| 353 | Ga0400489_68697 | 3300039093 | Bacteria | 2062 |
| 354 | Ga0436363_1146630 | 3300039450 | Unclassified | 630 |
| 355 | Ga0439453_0021937 | 3300041408 | Bacteria | 1154 |
| 356 | Ga0451839_0161978 | 3300041496 | Bacteria | 628 |
| 357 | Ga0451841_0077381 | 3300041498 | Bacteria | 975 |
| 358 | Ga0439459_0157942 | 3300042438 | Bacteria | 597 |
| 359 | Ga0451577_0440085 | 3300042876 | Bacteria | 1184 |
| 360 | Ga0466963_0346410 | 3300044694 | Bacteria | 1046 |
| 361 | Ga0451576_0191038 | 3300045051 | Bacteria | 2139 |
| 362 | Ga0451576_1803757 | 3300045051 | Bacteria | 632 |
| 363 | Ga0495592_0037981 | 3300046454 | Bacteria | 3624 |
| 364 | Ga0495629_0239557 | 3300046459 | Bacteria | 1249 |
| 365 | Ga0495629_0419739 | 3300046459 | Bacteria | 908 |
| 366 | Ga0495641_0144745 | 3300046461 | Bacteria | 1062 |
| 367 | Ga0495582_0107079 | 3300046473 | Bacteria | 1569 |
| 368 | Ga0495585_0000654 | 3300046492 | Bacteria | 31829 |
| 369 | Ga0495606_0013471 | 3300046507 | Bacteria | 6454 |
| 370 | Ga0495628_0342708 | 3300046516 | Bacteria | 1100 |
| 371 | Ga0495628_0507291 | 3300046516 | Bacteria | 870 |
| 372 | Ga0495648_0027108 | 3300046524 | Bacteria | 3842 |
| 373 | Ga0495587_0634147 | 3300046536 | Bacteria | 587 |
| 374 | Ga0495609_0007432 | 3300046538 | Bacteria | 5475 |
| 375 | Ga0495609_0355791 | 3300046538 | Bacteria | 590 |
| 376 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 377 | Ga0495656_0282118 | 3300046615 | Unclassified | 847 |
| 378 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 379 | Ga0495634_0054681 | 3300046642 | Bacteria | 2671 |
| 380 | Ga0495625_0000660 | 3300046660 | Bacteria | 49270 |
| 381 | Ga0495625_0002214 | 3300046660 | Bacteria | 21483 |
| 382 | Ga0495625_0009378 | 3300046660 | Bacteria | 8193 |
| 383 | Ga0495599_0254412 | 3300046678 | Bacteria | 1068 |
| 384 | Ga0495658_0004851 | 3300046683 | Bacteria | 6599 |
| 385 | Ga0495600_0216260 | 3300046809 | Bacteria | 1227 |
| 386 | Ga0495660_0002682 | 3300046810 | Bacteria | 11256 |
| 387 | Ga0495679_146026 | 3300047446 | Bacteria | 637 |
| 388 | Ga0495602_0200146 | 3300048088 | Bacteria | 1525 |
| 389 | Ga0495602_0294433 | 3300048088 | Bacteria | 1190 |
| 390 | Ga0496100_0469441 | 3300048903 | Bacteria | 967 |
| 391 | Ga0496104_0807162 | 3300048907 | Bacteria | 844 |
| 392 | Ga0496104_1173150 | 3300048907 | Bacteria | 671 |
| 393 | Ga0496105_0323742 | 3300048908 | Bacteria | 1235 |
| 394 | Ga0496106_0082146 | 3300048909 | Bacteria | 2476 |
| 395 | Ga0496107_0792229 | 3300048910 | Bacteria | 694 |
| 396 | Ga0496108_0516736 | 3300048911 | Bacteria | 1043 |
| 397 | Ga0496108_1394519 | 3300048911 | Bacteria | 586 |
| 398 | Ga0496109_0712277 | 3300048912 | Bacteria | 941 |
| 399 | Ga0496109_1079828 | 3300048912 | Bacteria | 740 |
| 400 | Ga0496110_0724955 | 3300048913 | Bacteria | 896 |
| 401 | Ga0496110_1104689 | 3300048913 | Bacteria | 701 |
| 402 | Ga0496111_0102422 | 3300048914 | Bacteria | 2105 |
| 403 | Ga0496111_0297648 | 3300048914 | Bacteria | 1196 |
| 404 | Ga0496112_0987112 | 3300048915 | Bacteria | 762 |
| 405 | Ga0496112_1465286 | 3300048915 | Bacteria | 597 |
| 406 | Ga0496114_0565105 | 3300048917 | Unclassified | 1004 |
| 407 | Ga0496114_0810386 | 3300048917 | Bacteria | 815 |
| 408 | Ga0496114_1496191 | 3300048917 | Bacteria | 563 |
| 409 | Ga0495682_0007750 | 3300049460 | Bacteria | 4254 |
| 410 | Ga0501031_0587945 | 3300049568 | Bacteria | 716 |
| 411 | Ga0501039_0901941 | 3300049575 | Bacteria | 688 |
| 412 | Ga0501040_0038207 | 3300049576 | Bacteria | 3263 |
| 413 | Ga0501041_0117305 | 3300049577 | Bacteria | 1653 |
| 414 | Ga0501042_0261268 | 3300049578 | Bacteria | 1250 |
| 415 | Ga0501042_0459725 | 3300049578 | Bacteria | 923 |
| 416 | Ga0501048_0504914 | 3300049582 | Bacteria | 867 |
| 417 | Ga0501048_1389666 | 3300049582 | Bacteria | 505 |
| 418 | Ga0501068_0705603 | 3300049584 | Unclassified | 660 |
| 419 | Ga0501075_0039710 | 3300049591 | Bacteria | 3522 |
| 420 | Ga0501075_0316225 | 3300049591 | Bacteria | 1190 |
| 421 | Ga0501075_0647279 | 3300049591 | Bacteria | 806 |
| 422 | Ga0501076_0019279 | 3300049592 | Bacteria | 5212 |
| 423 | Ga0501076_0909092 | 3300049592 | Bacteria | 726 |
| 424 | Ga0501077_0842698 | 3300049593 | Bacteria | 590 |
| 425 | Ga0501079_0038754 | 3300049741 | Bacteria | 3675 |
| 426 | Ga0501079_0273791 | 3300049741 | Bacteria | 1320 |
| 427 | Ga0501080_0993760 | 3300049742 | Bacteria | 728 |
| 428 | Ga0501081_0133871 | 3300049743 | Unclassified | 1773 |
| 429 | Ga0501081_0383965 | 3300049743 | Bacteria | 1038 |
| 430 | Ga0501081_0463837 | 3300049743 | Bacteria | 942 |
| 431 | Ga0501081_0562902 | 3300049743 | Unclassified | 852 |
| 432 | Ga0501045_0216017 | 3300049824 | Bacteria | 1428 |
| 433 | nmdc:mga0k408_106_c1 | 3300050493 | Bacteria | 40767 |
| 434 | nmdc:mga0k408_166796_c1 | 3300050493 | Bacteria | 1312 |
| 435 | nmdc:mga05p37_1047736_c1 | 3300050507 | Bacteria | 861 |
| 436 | nmdc:mga05p37_16647_c1 | 3300050507 | Bacteria | 8857 |
| 437 | nmdc:mga05p37_193286_c1 | 3300050507 | Bacteria | 2469 |
| 438 | nmdc:mga05p37_197631_c1 | 3300050507 | Bacteria | 2438 |
| 439 | nmdc:mga09592_331970_c1 | 3300050508 | Bacteria | 1316 |
| 440 | nmdc:mga0qj67_568107_c1 | 3300050509 | Bacteria | 909 |
| 441 | nmdc:mga0qj67_926924_c1 | 3300050509 | Bacteria | 685 |
| 442 | nmdc:mga08y16_13913_c1 | 3300050511 | Bacteria | 8468 |
| 443 | nmdc:mga08y16_200303_c1 | 3300050511 | Bacteria | 2069 |
| 444 | nmdc:mga08y16_24560_c1 | 3300050511 | Bacteria | 6360 |
| 445 | nmdc:mga08y16_249069_c1 | 3300050511 | Bacteria | 1836 |
| 446 | nmdc:mga08y16_29270_c1 | 3300050511 | Bacteria | 5803 |
| 447 | nmdc:mga08y16_5934_c1 | 3300050511 | Bacteria | 12801 |
| 448 | nmdc:mga08y16_598027_c1 | 3300050511 | Unclassified | 1112 |
| 449 | nmdc:mga0n895_1125254_c1 | 3300050512 | Bacteria | 762 |
| 450 | nmdc:mga0n895_28663_c1 | 3300050512 | Bacteria | 5300 |
| 451 | nmdc:mga0n895_344115_c1 | 3300050512 | Bacteria | 1510 |
| 452 | nmdc:mga0n895_441670_c1 | 3300050512 | Bacteria | 1314 |
| 453 | nmdc:mga0n895_59104_c1 | 3300050512 | Bacteria | 3783 |
| 454 | nmdc:mga0n895_631931_c1 | 3300050512 | Bacteria | 1071 |
| 455 | nmdc:mga0rr50_470115_c1 | 3300050513 | Bacteria | 1067 |
| 456 | nmdc:mga0rr50_58317_c1 | 3300050513 | Bacteria | 2893 |
| 457 | nmdc:mga0rr50_627586_c1 | 3300050513 | Bacteria | 917 |
| 458 | nmdc:mga0rr50_691294_c1 | 3300050513 | Bacteria | 871 |
| 459 | nmdc:mga0rr50_878910_c1 | 3300050513 | Bacteria | 764 |
| 460 | nmdc:mga08x19_137679_c1 | 3300050514 | Bacteria | 1647 |
| 461 | nmdc:mga08x19_143753_c1 | 3300050514 | Bacteria | 1612 |
| 462 | nmdc:mga08x19_26867_c1 | 3300050514 | Bacteria | 3596 |
| 463 | nmdc:mga08x19_37315_c1 | 3300050514 | Bacteria | 3084 |
| 464 | nmdc:mga08x19_49681_c1 | 3300050514 | Bacteria | 2691 |
| 465 | nmdc:mga08x19_899038_c1 | 3300050514 | Bacteria | 629 |
| 466 | nmdc:mga0a205_25_c1 | 3300050515 | Bacteria | 87587 |
| 467 | nmdc:mga0a205_472477_c1 | 3300050515 | Bacteria | 1113 |
| 468 | nmdc:mga0a205_474679_c1 | 3300050515 | Bacteria | 1109 |
| 469 | nmdc:mga0a205_62314_c1 | 3300050515 | Bacteria | 3603 |
| 470 | nmdc:mga0a205_81371_c1 | 3300050515 | Bacteria | 3129 |
| 471 | Ga0495619_0260684 | 3300053085 | Bacteria | 1201 |
| 472 | Ga0500646_0359789 | 3300053090 | Bacteria | 532 |
| 473 | Ga0501084_0037225 | 3300054114 | Bacteria | 4065 |
| 474 | Ga0501084_0441005 | 3300054114 | Bacteria | 1101 |
| 475 | Ga0501082_0156810 | 3300060353 | Bacteria | 1978 |
| 476 | Ga0501082_0427261 | 3300060353 | Bacteria | 1157 |
| 477 | Ga0530510_0307597 | 3300061734 | Bacteria | 1187 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10076442 | Ga0207662_100764423 | 125 |
| 2 | 3300025934 | Ga0207686_10264878 | Ga0207686_102648782 | 125 |
| 3 | 3300031712 | Ga0265342_10055083 | Ga0265342_100550832 | 125 |
| 4 | 3300003323 | rootH1_10187321 | rootH1_101873212 | 131 |
| 5 | 3300005329 | Ga0070683_100012137 | Ga0070683_1000121375 | 131 |
| 6 | 3300005535 | Ga0070684_100097864 | Ga0070684_1000978642 | 131 |
| 7 | 3300005563 | Ga0068855_100393535 | Ga0068855_1003935352 | 131 |
| 8 | 3300006195 | Ga0075366_10142162 | Ga0075366_101421622 | 131 |
| 9 | 3300006852 | Ga0075433_10000238 | Ga0075433_100002389 | 131 |
| 10 | 3300025250 | Ga0209026_1000225 | Ga0209026_100022569 | 131 |
| 11 | 3300025250 | Ga0209026_1002625 | Ga0209026_10026259 | 131 |
| 12 | 3300025254 | Ga0209148_1039518 | Ga0209148_10395181 | 131 |
| 13 | 3300025944 | Ga0207661_10046300 | Ga0207661_100463003 | 131 |
| 14 | 3300041498 | Ga0451841_0077381 | Ga0451841_0077381_64_459 | 131 |
| 15 | 3300046459 | Ga0495629_0239557 | Ga0495629_0239557_809_1204 | 131 |
| 16 | 3300046461 | Ga0495641_0144745 | Ga0495641_0144745_226_621 | 131 |
| 17 | 3300046492 | Ga0495585_0000654 | Ga0495585_0000654_11271_11666 | 131 |
| 18 | 3300046516 | Ga0495628_0507291 | Ga0495628_0507291_446_841 | 131 |
| 19 | 3300046524 | Ga0495648_0027108 | Ga0495648_0027108_1326_1721 | 131 |
| 20 | 3300046538 | Ga0495609_0007432 | Ga0495609_0007432_3629_4024 | 131 |
| 21 | 3300046538 | Ga0495609_0355791 | Ga0495609_0355791_167_562 | 131 |
| 22 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_294955_295350 | 131 |
| 23 | 3300046616 | Ga0495668_0000011 | Ga0495668_0000011_282770_283165 | 131 |
| 24 | 3300046660 | Ga0495625_0000660 | Ga0495625_0000660_28954_29349 | 131 |
| 25 | 3300046660 | Ga0495625_0009378 | Ga0495625_0009378_2830_3225 | 131 |
| 26 | 3300046683 | Ga0495658_0004851 | Ga0495658_0004851_4022_4417 | 131 |
| 27 | 3300046809 | Ga0495600_0216260 | Ga0495600_0216260_592_987 | 131 |
| 28 | 3300047446 | Ga0495679_146026 | Ga0495679_146026_182_577 | 131 |
| 29 | 3300049460 | Ga0495682_0007750 | Ga0495682_0007750_1250_1645 | 131 |
| 30 | 3300050515 | nmdc:mga0a205_25_c1 | nmdc:mga0a205_25_c1_66773_67219 | 131 |
| 31 | 3300053090 | Ga0500646_0359789 | Ga0500646_0359789_116_511 | 131 |
| 32 | 3300005439 | Ga0070711_100855264 | Ga0070711_1008552642 | 133 |
| 33 | 3300005985 | Ga0081539_10021620 | Ga0081539_100216205 | 133 |
| 34 | 3300009094 | Ga0111539_10308036 | Ga0111539_103080363 | 133 |
| 35 | 3300050511 | nmdc:mga08y16_249069_c1 | nmdc:mga08y16_249069_c1_751_1152 | 133 |
| 36 | 3300005338 | Ga0068868_100476657 | Ga0068868_1004766572 | 134 |
| 37 | 3300013308 | Ga0157375_11413986 | Ga0157375_114139862 | 134 |
| 38 | 3300014325 | Ga0163163_10631318 | Ga0163163_106313182 | 134 |
| 39 | 3300026023 | Ga0207677_10455597 | Ga0207677_104555972 | 134 |
| 40 | 3300048907 | Ga0496104_1173150 | Ga0496104_1173150_211_621 | 134 |
| 41 | 3300048913 | Ga0496110_1104689 | Ga0496110_1104689_60_470 | 134 |
| 42 | 3300048914 | Ga0496111_0102422 | Ga0496111_0102422_116_526 | 134 |
| 43 | 3300048914 | Ga0496111_0297648 | Ga0496111_0297648_301_711 | 134 |
| 44 | 3300048917 | Ga0496114_0810386 | Ga0496114_0810386_175_585 | 134 |
| 45 | 3300005467 | Ga0070706_100769713 | Ga0070706_1007697132 | 135 |
| 46 | 3300002459 | JGI24751J29686_10023968 | JGI24751J29686_100239682 | 137 |
| 47 | 3300003322 | rootL2_10093759 | rootL2_100937596 | 137 |
| 48 | 3300004803 | Ga0058862_12379370 | Ga0058862_123793702 | 137 |
| 49 | 3300005293 | Ga0065715_10098529 | Ga0065715_100985294 | 137 |
| 50 | 3300005293 | Ga0065715_10190822 | Ga0065715_101908223 | 137 |
| 51 | 3300005293 | Ga0065715_10372249 | Ga0065715_103722491 | 137 |
| 52 | 3300005295 | Ga0065707_10186311 | Ga0065707_101863112 | 137 |
| 53 | 3300005295 | Ga0065707_10411315 | Ga0065707_104113151 | 137 |
| 54 | 3300005328 | Ga0070676_10011008 | Ga0070676_100110083 | 137 |
| 55 | 3300005328 | Ga0070676_10251957 | Ga0070676_102519571 | 137 |
| 56 | 3300005331 | Ga0070670_100173094 | Ga0070670_1001730943 | 137 |
| 57 | 3300005334 | Ga0068869_101101039 | Ga0068869_1011010392 | 137 |
| 58 | 3300005335 | Ga0070666_10095575 | Ga0070666_100955752 | 137 |
| 59 | 3300005335 | Ga0070666_10281076 | Ga0070666_102810762 | 137 |
| 60 | 3300005335 | Ga0070666_10498294 | Ga0070666_104982941 | 137 |
| 61 | 3300005336 | Ga0070680_100232887 | Ga0070680_1002328872 | 137 |
| 62 | 3300005338 | Ga0068868_100634454 | Ga0068868_1006344541 | 137 |
| 63 | 3300005340 | Ga0070689_100275994 | Ga0070689_1002759942 | 137 |
| 64 | 3300005340 | Ga0070689_100461699 | Ga0070689_1004616992 | 137 |
| 65 | 3300005341 | Ga0070691_10056269 | Ga0070691_100562693 | 137 |
| 66 | 3300005343 | Ga0070687_100506396 | Ga0070687_1005063962 | 137 |
| 67 | 3300005347 | Ga0070668_100098442 | Ga0070668_1000984424 | 137 |
| 68 | 3300005353 | Ga0070669_100104564 | Ga0070669_1001045643 | 137 |
| 69 | 3300005353 | Ga0070669_100130587 | Ga0070669_1001305872 | 137 |
| 70 | 3300005353 | Ga0070669_100345394 | Ga0070669_1003453942 | 137 |
| 71 | 3300005354 | Ga0070675_100000055 | Ga0070675_10000005517 | 137 |
| 72 | 3300005354 | Ga0070675_100268899 | Ga0070675_1002688993 | 137 |
| 73 | 3300005355 | Ga0070671_100284468 | Ga0070671_1002844681 | 137 |
| 74 | 3300005356 | Ga0070674_100323363 | Ga0070674_1003233631 | 137 |
| 75 | 3300005356 | Ga0070674_100580226 | Ga0070674_1005802262 | 137 |
| 76 | 3300005364 | Ga0070673_100065744 | Ga0070673_1000657444 | 137 |
| 77 | 3300005364 | Ga0070673_100132427 | Ga0070673_1001324273 | 137 |
| 78 | 3300005364 | Ga0070673_100179289 | Ga0070673_1001792893 | 137 |
| 79 | 3300005364 | Ga0070673_100248346 | Ga0070673_1002483462 | 137 |
| 80 | 3300005365 | Ga0070688_100939007 | Ga0070688_1009390071 | 137 |
| 81 | 3300005367 | Ga0070667_100375915 | Ga0070667_1003759152 | 137 |
| 82 | 3300005406 | Ga0070703_10040617 | Ga0070703_100406172 | 137 |
| 83 | 3300005435 | Ga0070714_100053101 | Ga0070714_1000531015 | 137 |
| 84 | 3300005438 | Ga0070701_10030874 | Ga0070701_100308744 | 137 |
| 85 | 3300005440 | Ga0070705_100038938 | Ga0070705_1000389383 | 137 |
| 86 | 3300005440 | Ga0070705_100078211 | Ga0070705_1000782111 | 137 |
| 87 | 3300005441 | Ga0070700_100005782 | Ga0070700_1000057823 | 137 |
| 88 | 3300005441 | Ga0070700_100331311 | Ga0070700_1003313111 | 137 |
| 89 | 3300005441 | Ga0070700_100604546 | Ga0070700_1006045461 | 137 |
| 90 | 3300005441 | Ga0070700_100731899 | Ga0070700_1007318992 | 137 |
| 91 | 3300005441 | Ga0070700_100800967 | Ga0070700_1008009672 | 137 |
| 92 | 3300005444 | Ga0070694_100036188 | Ga0070694_1000361883 | 137 |
| 93 | 3300005444 | Ga0070694_100213730 | Ga0070694_1002137303 | 137 |
| 94 | 3300005444 | Ga0070694_101056538 | Ga0070694_1010565382 | 137 |
| 95 | 3300005444 | Ga0070694_101066701 | Ga0070694_1010667011 | 137 |
| 96 | 3300005445 | Ga0070708_101535867 | Ga0070708_1015358672 | 137 |
| 97 | 3300005455 | Ga0070663_100088734 | Ga0070663_1000887343 | 137 |
| 98 | 3300005455 | Ga0070663_100512314 | Ga0070663_1005123141 | 137 |
| 99 | 3300005455 | Ga0070663_101063012 | Ga0070663_1010630122 | 137 |
| 100 | 3300005456 | Ga0070678_100128353 | Ga0070678_1001283532 | 137 |
| 101 | 3300005457 | Ga0070662_100211369 | Ga0070662_1002113692 | 137 |
| 102 | 3300005457 | Ga0070662_100396819 | Ga0070662_1003968192 | 137 |
| 103 | 3300005458 | Ga0070681_10042317 | Ga0070681_100423175 | 137 |
| 104 | 3300005458 | Ga0070681_10136275 | Ga0070681_101362752 | 137 |
| 105 | 3300005459 | Ga0068867_100012999 | Ga0068867_1000129995 | 137 |
| 106 | 3300005459 | Ga0068867_100570580 | Ga0068867_1005705802 | 137 |
| 107 | 3300005459 | Ga0068867_102219996 | Ga0068867_1022199961 | 137 |
| 108 | 3300005467 | Ga0070706_101637414 | Ga0070706_1016374142 | 137 |
| 109 | 3300005468 | Ga0070707_100243323 | Ga0070707_1002433232 | 137 |
| 110 | 3300005468 | Ga0070707_100684735 | Ga0070707_1006847351 | 137 |
| 111 | 3300005471 | Ga0070698_100051643 | Ga0070698_1000516433 | 137 |
| 112 | 3300005471 | Ga0070698_100143310 | Ga0070698_1001433102 | 137 |
| 113 | 3300005518 | Ga0070699_100066431 | Ga0070699_1000664314 | 137 |
| 114 | 3300005518 | Ga0070699_100116323 | Ga0070699_1001163234 | 137 |
| 115 | 3300005518 | Ga0070699_100226446 | Ga0070699_1002264463 | 137 |
| 116 | 3300005518 | Ga0070699_100242887 | Ga0070699_1002428874 | 137 |
| 117 | 3300005530 | Ga0070679_100016517 | Ga0070679_1000165177 | 137 |
| 118 | 3300005530 | Ga0070679_100425654 | Ga0070679_1004256542 | 137 |
| 119 | 3300005536 | Ga0070697_100016556 | Ga0070697_1000165565 | 137 |
| 120 | 3300005543 | Ga0070672_100798763 | Ga0070672_1007987632 | 137 |
| 121 | 3300005544 | Ga0070686_100077016 | Ga0070686_1000770163 | 137 |
| 122 | 3300005544 | Ga0070686_100719069 | Ga0070686_1007190691 | 137 |
| 123 | 3300005545 | Ga0070695_100232150 | Ga0070695_1002321502 | 137 |
| 124 | 3300005545 | Ga0070695_100251150 | Ga0070695_1002511503 | 137 |
| 125 | 3300005545 | Ga0070695_100622095 | Ga0070695_1006220951 | 137 |
| 126 | 3300005546 | Ga0070696_100161162 | Ga0070696_1001611623 | 137 |
| 127 | 3300005548 | Ga0070665_100030161 | Ga0070665_1000301615 | 137 |
| 128 | 3300005549 | Ga0070704_100122684 | Ga0070704_1001226842 | 137 |
| 129 | 3300005549 | Ga0070704_100273465 | Ga0070704_1002734652 | 137 |
| 130 | 3300005549 | Ga0070704_100373903 | Ga0070704_1003739032 | 137 |
| 131 | 3300005549 | Ga0070704_100554214 | Ga0070704_1005542143 | 137 |
| 132 | 3300005549 | Ga0070704_100645467 | Ga0070704_1006454671 | 137 |
| 133 | 3300005549 | Ga0070704_100810937 | Ga0070704_1008109371 | 137 |
| 134 | 3300005563 | Ga0068855_100206959 | Ga0068855_1002069591 | 137 |
| 135 | 3300005577 | Ga0068857_102241808 | Ga0068857_1022418081 | 137 |
| 136 | 3300005578 | Ga0068854_100037831 | Ga0068854_1000378314 | 137 |
| 137 | 3300005578 | Ga0068854_100104542 | Ga0068854_1001045424 | 137 |
| 138 | 3300005615 | Ga0070702_100029043 | Ga0070702_1000290432 | 137 |
| 139 | 3300005615 | Ga0070702_100206209 | Ga0070702_1002062093 | 137 |
| 140 | 3300005615 | Ga0070702_100718267 | Ga0070702_1007182672 | 137 |
| 141 | 3300005617 | Ga0068859_100012519 | Ga0068859_1000125192 | 137 |
| 142 | 3300005617 | Ga0068859_100104910 | Ga0068859_1001049104 | 137 |
| 143 | 3300005617 | Ga0068859_100302619 | Ga0068859_1003026194 | 137 |
| 144 | 3300005618 | Ga0068864_100257585 | Ga0068864_1002575853 | 137 |
| 145 | 3300005618 | Ga0068864_101099718 | Ga0068864_1010997182 | 137 |
| 146 | 3300005718 | Ga0068866_10074412 | Ga0068866_100744121 | 137 |
| 147 | 3300005718 | Ga0068866_10876226 | Ga0068866_108762262 | 137 |
| 148 | 3300005719 | Ga0068861_100010150 | Ga0068861_1000101503 | 137 |
| 149 | 3300005719 | Ga0068861_100063772 | Ga0068861_1000637723 | 137 |
| 150 | 3300005719 | Ga0068861_100164631 | Ga0068861_1001646313 | 137 |
| 151 | 3300005719 | Ga0068861_100233922 | Ga0068861_1002339222 | 137 |
| 152 | 3300005719 | Ga0068861_100358439 | Ga0068861_1003584393 | 137 |
| 153 | 3300005719 | Ga0068861_100692441 | Ga0068861_1006924412 | 137 |
| 154 | 3300005719 | Ga0068861_100886749 | Ga0068861_1008867491 | 137 |
| 155 | 3300005841 | Ga0068863_100406122 | Ga0068863_1004061222 | 137 |
| 156 | 3300005842 | Ga0068858_100006437 | Ga0068858_1000064376 | 137 |
| 157 | 3300005843 | Ga0068860_100476900 | Ga0068860_1004769002 | 137 |
| 158 | 3300005844 | Ga0068862_100011943 | Ga0068862_1000119437 | 137 |
| 159 | 3300005844 | Ga0068862_100114836 | Ga0068862_1001148362 | 137 |
| 160 | 3300005844 | Ga0068862_100264105 | Ga0068862_1002641052 | 137 |
| 161 | 3300005844 | Ga0068862_100705613 | Ga0068862_1007056132 | 137 |
| 162 | 3300006028 | Ga0070717_10298964 | Ga0070717_102989643 | 137 |
| 163 | 3300006042 | Ga0075368_10577921 | Ga0075368_105779211 | 137 |
| 164 | 3300006163 | Ga0070715_10332350 | Ga0070715_103323503 | 137 |
| 165 | 3300006195 | Ga0075366_10000073 | Ga0075366_1000007312 | 137 |
| 166 | 3300006237 | Ga0097621_100432165 | Ga0097621_1004321652 | 137 |
| 167 | 3300006358 | Ga0068871_100127124 | Ga0068871_1001271243 | 137 |
| 168 | 3300006358 | Ga0068871_100428978 | Ga0068871_1004289782 | 137 |
| 169 | 3300006844 | Ga0075428_100003953 | Ga0075428_1000039539 | 137 |
| 170 | 3300006844 | Ga0075428_100412915 | Ga0075428_1004129151 | 137 |
| 171 | 3300006846 | Ga0075430_100647391 | Ga0075430_1006473912 | 137 |
| 172 | 3300006846 | Ga0075430_101475088 | Ga0075430_1014750881 | 137 |
| 173 | 3300006847 | Ga0075431_100026134 | Ga0075431_1000261342 | 137 |
| 174 | 3300006852 | Ga0075433_10087165 | Ga0075433_100871654 | 137 |
| 175 | 3300006852 | Ga0075433_10185875 | Ga0075433_101858752 | 137 |
| 176 | 3300006852 | Ga0075433_10193776 | Ga0075433_101937763 | 137 |
| 177 | 3300006852 | Ga0075433_10200329 | Ga0075433_102003294 | 137 |
| 178 | 3300006871 | Ga0075434_100026749 | Ga0075434_1000267494 | 137 |
| 179 | 3300006871 | Ga0075434_100125622 | Ga0075434_1001256223 | 137 |
| 180 | 3300006871 | Ga0075434_100190056 | Ga0075434_1001900563 | 137 |
| 181 | 3300006871 | Ga0075434_100259767 | Ga0075434_1002597672 | 137 |
| 182 | 3300006871 | Ga0075434_100279545 | Ga0075434_1002795453 | 137 |
| 183 | 3300006880 | Ga0075429_100376226 | Ga0075429_1003762261 | 137 |
| 184 | 3300006881 | Ga0068865_100153658 | Ga0068865_1001536582 | 137 |
| 185 | 3300006914 | Ga0075436_100006766 | Ga0075436_1000067665 | 137 |
| 186 | 3300006914 | Ga0075436_100010266 | Ga0075436_1000102666 | 137 |
| 187 | 3300006914 | Ga0075436_100032710 | Ga0075436_1000327103 | 137 |
| 188 | 3300006914 | Ga0075436_100040108 | Ga0075436_1000401085 | 137 |
| 189 | 3300006931 | Ga0097620_100012519 | Ga0097620_1000125192 | 137 |
| 190 | 3300006931 | Ga0097620_100104908 | Ga0097620_1001049084 | 137 |
| 191 | 3300006931 | Ga0097620_100302608 | Ga0097620_1003026082 | 137 |
| 192 | 3300007076 | Ga0075435_100009659 | Ga0075435_1000096593 | 137 |
| 193 | 3300007076 | Ga0075435_100056415 | Ga0075435_1000564152 | 137 |
| 194 | 3300007076 | Ga0075435_100194449 | Ga0075435_1001944493 | 137 |
| 195 | 3300007076 | Ga0075435_100422936 | Ga0075435_1004229363 | 137 |
| 196 | 3300007076 | Ga0075435_100895807 | Ga0075435_1008958072 | 137 |
| 197 | 3300009093 | Ga0105240_10168234 | Ga0105240_101682343 | 137 |
| 198 | 3300009093 | Ga0105240_11574409 | Ga0105240_115744092 | 137 |
| 199 | 3300009094 | Ga0111539_10014220 | Ga0111539_100142207 | 137 |
| 200 | 3300009094 | Ga0111539_10022709 | Ga0111539_100227098 | 137 |
| 201 | 3300009094 | Ga0111539_10032649 | Ga0111539_100326496 | 137 |
| 202 | 3300009094 | Ga0111539_10034811 | Ga0111539_100348116 | 137 |
| 203 | 3300009094 | Ga0111539_10209650 | Ga0111539_102096503 | 137 |
| 204 | 3300009094 | Ga0111539_10366088 | Ga0111539_103660882 | 137 |
| 205 | 3300009094 | Ga0111539_10609070 | Ga0111539_106090701 | 137 |
| 206 | 3300009094 | Ga0111539_10749319 | Ga0111539_107493192 | 137 |
| 207 | 3300009098 | Ga0105245_10031404 | Ga0105245_100314044 | 137 |
| 208 | 3300009098 | Ga0105245_10423813 | Ga0105245_104238133 | 137 |
| 209 | 3300009098 | Ga0105245_12184923 | Ga0105245_121849231 | 137 |
| 210 | 3300009101 | Ga0105247_10056455 | Ga0105247_100564551 | 137 |
| 211 | 3300009147 | Ga0114129_10023013 | Ga0114129_100230134 | 137 |
| 212 | 3300009147 | Ga0114129_10046542 | Ga0114129_100465426 | 137 |
| 213 | 3300009147 | Ga0114129_10373242 | Ga0114129_103732423 | 137 |
| 214 | 3300009147 | Ga0114129_11714050 | Ga0114129_117140502 | 137 |
| 215 | 3300009148 | Ga0105243_10062383 | Ga0105243_100623833 | 137 |
| 216 | 3300009148 | Ga0105243_10240337 | Ga0105243_102403373 | 137 |
| 217 | 3300009148 | Ga0105243_10443379 | Ga0105243_104433792 | 137 |
| 218 | 3300009148 | Ga0105243_10627698 | Ga0105243_106276983 | 137 |
| 219 | 3300009148 | Ga0105243_10693096 | Ga0105243_106930962 | 137 |
| 220 | 3300009148 | Ga0105243_11373893 | Ga0105243_113738932 | 137 |
| 221 | 3300009176 | Ga0105242_10063292 | Ga0105242_100632921 | 137 |
| 222 | 3300009176 | Ga0105242_10143754 | Ga0105242_101437543 | 137 |
| 223 | 3300009176 | Ga0105242_11241834 | Ga0105242_112418341 | 137 |
| 224 | 3300009177 | Ga0105248_10060104 | Ga0105248_100601046 | 137 |
| 225 | 3300009177 | Ga0105248_10180242 | Ga0105248_101802423 | 137 |
| 226 | 3300009177 | Ga0105248_10444226 | Ga0105248_104442262 | 137 |
| 227 | 3300009177 | Ga0105248_10925607 | Ga0105248_109256073 | 137 |
| 228 | 3300009177 | Ga0105248_11222601 | Ga0105248_112226012 | 137 |
| 229 | 3300009177 | Ga0105248_11446103 | Ga0105248_114461031 | 137 |
| 230 | 3300009551 | Ga0105238_10125539 | Ga0105238_101255393 | 137 |
| 231 | 3300009553 | Ga0105249_10322248 | Ga0105249_103222483 | 137 |
| 232 | 3300009553 | Ga0105249_11041447 | Ga0105249_110414471 | 137 |
| 233 | 3300009553 | Ga0105249_11392458 | Ga0105249_113924581 | 137 |
| 234 | 3300009553 | Ga0105249_11681234 | Ga0105249_116812341 | 137 |
| 235 | 3300011119 | Ga0105246_10370282 | Ga0105246_103702822 | 137 |
| 236 | 3300013100 | Ga0157373_10000091 | Ga0157373_1000009148 | 137 |
| 237 | 3300013100 | Ga0157373_10098272 | Ga0157373_100982722 | 137 |
| 238 | 3300013104 | Ga0157370_10068788 | Ga0157370_100687882 | 137 |
| 239 | 3300013297 | Ga0157378_10058983 | Ga0157378_100589834 | 137 |
| 240 | 3300013306 | Ga0163162_11390663 | Ga0163162_113906632 | 137 |
| 241 | 3300013307 | Ga0157372_10007451 | Ga0157372_1000745112 | 137 |
| 242 | 3300013308 | Ga0157375_10898117 | Ga0157375_108981172 | 137 |
| 243 | 3300014325 | Ga0163163_10758528 | Ga0163163_107585282 | 137 |
| 244 | 3300014326 | Ga0157380_10001762 | Ga0157380_100017628 | 137 |
| 245 | 3300014326 | Ga0157380_10031428 | Ga0157380_100314283 | 137 |
| 246 | 3300014326 | Ga0157380_10523741 | Ga0157380_105237412 | 137 |
| 247 | 3300014326 | Ga0157380_10749311 | Ga0157380_107493112 | 137 |
| 248 | 3300014968 | Ga0157379_10035068 | Ga0157379_100350686 | 137 |
| 249 | 3300014968 | Ga0157379_11472185 | Ga0157379_114721851 | 137 |
| 250 | 3300014969 | Ga0157376_11161490 | Ga0157376_111614902 | 137 |
| 251 | 3300017792 | Ga0163161_10836667 | Ga0163161_108366671 | 137 |
| 252 | 3300017792 | Ga0163161_11656148 | Ga0163161_116561482 | 137 |
| 253 | 3300025893 | Ga0207682_10421225 | Ga0207682_104212252 | 137 |
| 254 | 3300025899 | Ga0207642_10021644 | Ga0207642_100216444 | 137 |
| 255 | 3300025899 | Ga0207642_10540104 | Ga0207642_105401041 | 137 |
| 256 | 3300025903 | Ga0207680_10498425 | Ga0207680_104984252 | 137 |
| 257 | 3300025904 | Ga0207647_10534121 | Ga0207647_105341211 | 137 |
| 258 | 3300025906 | Ga0207699_10244598 | Ga0207699_102445982 | 137 |
| 259 | 3300025907 | Ga0207645_10245607 | Ga0207645_102456071 | 137 |
| 260 | 3300025907 | Ga0207645_10913378 | Ga0207645_109133781 | 137 |
| 261 | 3300025912 | Ga0207707_10011369 | Ga0207707_100113697 | 137 |
| 262 | 3300025912 | Ga0207707_10519507 | Ga0207707_105195071 | 137 |
| 263 | 3300025916 | Ga0207663_10603790 | Ga0207663_106037902 | 137 |
| 264 | 3300025917 | Ga0207660_10335914 | Ga0207660_103359143 | 137 |
| 265 | 3300025918 | Ga0207662_10288007 | Ga0207662_102880071 | 137 |
| 266 | 3300025921 | Ga0207652_10040793 | Ga0207652_100407932 | 137 |
| 267 | 3300025921 | Ga0207652_10115697 | Ga0207652_101156972 | 137 |
| 268 | 3300025922 | Ga0207646_10207773 | Ga0207646_102077733 | 137 |
| 269 | 3300025923 | Ga0207681_10013808 | Ga0207681_100138083 | 137 |
| 270 | 3300025923 | Ga0207681_10023489 | Ga0207681_100234895 | 137 |
| 271 | 3300025923 | Ga0207681_10289607 | Ga0207681_102896073 | 137 |
| 272 | 3300025925 | Ga0207650_10148954 | Ga0207650_101489543 | 137 |
| 273 | 3300025926 | Ga0207659_10001583 | Ga0207659_100015839 | 137 |
| 274 | 3300025926 | Ga0207659_10176899 | Ga0207659_101768993 | 137 |
| 275 | 3300025927 | Ga0207687_10025897 | Ga0207687_100258974 | 137 |
| 276 | 3300025927 | Ga0207687_10283293 | Ga0207687_102832932 | 137 |
| 277 | 3300025929 | Ga0207664_10001974 | Ga0207664_100019747 | 137 |
| 278 | 3300025931 | Ga0207644_10504033 | Ga0207644_105040333 | 137 |
| 279 | 3300025931 | Ga0207644_10765624 | Ga0207644_107656241 | 137 |
| 280 | 3300025933 | Ga0207706_10144767 | Ga0207706_101447671 | 137 |
| 281 | 3300025933 | Ga0207706_11166814 | Ga0207706_111668141 | 137 |
| 282 | 3300025934 | Ga0207686_10176597 | Ga0207686_101765971 | 137 |
| 283 | 3300025935 | Ga0207709_10004342 | Ga0207709_100043426 | 137 |
| 284 | 3300025935 | Ga0207709_10414799 | Ga0207709_104147992 | 137 |
| 285 | 3300025936 | Ga0207670_10299379 | Ga0207670_102993792 | 137 |
| 286 | 3300025936 | Ga0207670_10688261 | Ga0207670_106882612 | 137 |
| 287 | 3300025937 | Ga0207669_10122349 | Ga0207669_101223493 | 137 |
| 288 | 3300025938 | Ga0207704_10148138 | Ga0207704_101481382 | 137 |
| 289 | 3300025938 | Ga0207704_11710044 | Ga0207704_117100441 | 137 |
| 290 | 3300025939 | Ga0207665_10249667 | Ga0207665_102496673 | 137 |
| 291 | 3300025940 | Ga0207691_10291769 | Ga0207691_102917693 | 137 |
| 292 | 3300025941 | Ga0207711_10277160 | Ga0207711_102771602 | 137 |
| 293 | 3300025941 | Ga0207711_10401141 | Ga0207711_104011412 | 137 |
| 294 | 3300025941 | Ga0207711_10477407 | Ga0207711_104774072 | 137 |
| 295 | 3300025941 | Ga0207711_11943187 | Ga0207711_119431871 | 137 |
| 296 | 3300025942 | Ga0207689_10712524 | Ga0207689_107125242 | 137 |
| 297 | 3300025960 | Ga0207651_10005977 | Ga0207651_100059777 | 137 |
| 298 | 3300025960 | Ga0207651_10106035 | Ga0207651_101060353 | 137 |
| 299 | 3300025960 | Ga0207651_10122496 | Ga0207651_101224961 | 137 |
| 300 | 3300025960 | Ga0207651_10163087 | Ga0207651_101630873 | 137 |
| 301 | 3300025960 | Ga0207651_10745595 | Ga0207651_107455952 | 137 |
| 302 | 3300025961 | Ga0207712_10189580 | Ga0207712_101895804 | 137 |
| 303 | 3300025961 | Ga0207712_10490533 | Ga0207712_104905332 | 137 |
| 304 | 3300025961 | Ga0207712_10979970 | Ga0207712_109799701 | 137 |
| 305 | 3300025961 | Ga0207712_11990618 | Ga0207712_119906181 | 137 |
| 306 | 3300025972 | Ga0207668_10221933 | Ga0207668_102219333 | 137 |
| 307 | 3300025981 | Ga0207640_10093769 | Ga0207640_100937694 | 137 |
| 308 | 3300025981 | Ga0207640_10206198 | Ga0207640_102061983 | 137 |
| 309 | 3300025986 | Ga0207658_10238640 | Ga0207658_102386402 | 137 |
| 310 | 3300026023 | Ga0207677_10061132 | Ga0207677_100611324 | 137 |
| 311 | 3300026035 | Ga0207703_10016106 | Ga0207703_100161064 | 137 |
| 312 | 3300026035 | Ga0207703_10030107 | Ga0207703_100301073 | 137 |
| 313 | 3300026067 | Ga0207678_11529697 | Ga0207678_115296971 | 137 |
| 314 | 3300026075 | Ga0207708_10004696 | Ga0207708_100046966 | 137 |
| 315 | 3300026075 | Ga0207708_10464023 | Ga0207708_104640232 | 137 |
| 316 | 3300026075 | Ga0207708_10637366 | Ga0207708_106373662 | 137 |
| 317 | 3300026075 | Ga0207708_10797547 | Ga0207708_107975472 | 137 |
| 318 | 3300026075 | Ga0207708_11998194 | Ga0207708_119981941 | 137 |
| 319 | 3300026088 | Ga0207641_10640748 | Ga0207641_106407482 | 137 |
| 320 | 3300026089 | Ga0207648_10018612 | Ga0207648_100186126 | 137 |
| 321 | 3300026089 | Ga0207648_10590515 | Ga0207648_105905152 | 137 |
| 322 | 3300026089 | Ga0207648_10890529 | Ga0207648_108905292 | 137 |
| 323 | 3300026095 | Ga0207676_10355299 | Ga0207676_103552992 | 137 |
| 324 | 3300026095 | Ga0207676_11106673 | Ga0207676_111066731 | 137 |
| 325 | 3300026116 | Ga0207674_10499114 | Ga0207674_104991141 | 137 |
| 326 | 3300026116 | Ga0207674_11557876 | Ga0207674_115578761 | 137 |
| 327 | 3300026116 | Ga0207674_11969322 | Ga0207674_119693221 | 137 |
| 328 | 3300026118 | Ga0207675_100069427 | Ga0207675_1000694275 | 137 |
| 329 | 3300026118 | Ga0207675_100304309 | Ga0207675_1003043092 | 137 |
| 330 | 3300026118 | Ga0207675_100312662 | Ga0207675_1003126622 | 137 |
| 331 | 3300026118 | Ga0207675_100762486 | Ga0207675_1007624862 | 137 |
| 332 | 3300026121 | Ga0207683_10202428 | Ga0207683_102024283 | 137 |
| 333 | 3300026142 | Ga0207698_11410228 | Ga0207698_114102282 | 137 |
| 334 | 3300027907 | Ga0207428_10025855 | Ga0207428_100258553 | 137 |
| 335 | 3300027907 | Ga0207428_10192452 | Ga0207428_101924522 | 137 |
| 336 | 3300027907 | Ga0207428_10261577 | Ga0207428_102615773 | 137 |
| 337 | 3300028379 | Ga0268266_10065198 | Ga0268266_100651983 | 137 |
| 338 | 3300028379 | Ga0268266_10745549 | Ga0268266_107455492 | 137 |
| 339 | 3300028380 | Ga0268265_10007975 | Ga0268265_100079754 | 137 |
| 340 | 3300028380 | Ga0268265_10540493 | Ga0268265_105404933 | 137 |
| 341 | 3300028380 | Ga0268265_10925805 | Ga0268265_109258051 | 137 |
| 342 | 3300028380 | Ga0268265_11173149 | Ga0268265_111731491 | 137 |
| 343 | 3300028380 | Ga0268265_12148484 | Ga0268265_121484841 | 137 |
| 344 | 3300028381 | Ga0268264_10139236 | Ga0268264_101392363 | 137 |
| 345 | 3300028381 | Ga0268264_10218599 | Ga0268264_102185993 | 137 |
| 346 | 3300028381 | Ga0268264_11740982 | Ga0268264_117409821 | 137 |
| 347 | 3300028381 | Ga0268264_12556916 | Ga0268264_125569161 | 137 |
| 348 | 3300028653 | Ga0265323_10004679 | Ga0265323_100046795 | 137 |
| 349 | 3300028654 | Ga0265322_10014175 | Ga0265322_100141753 | 137 |
| 350 | 3300028794 | Ga0307515_10001029 | Ga0307515_1000102935 | 137 |
| 351 | 3300028794 | Ga0307515_10759179 | Ga0307515_107591791 | 137 |
| 352 | 3300031235 | Ga0265330_10180813 | Ga0265330_101808132 | 137 |
| 353 | 3300031344 | Ga0265316_10001859 | Ga0265316_1000185912 | 137 |
| 354 | 3300031616 | Ga0307508_10695392 | Ga0307508_106953922 | 137 |
| 355 | 3300031691 | Ga0316579_10082833 | Ga0316579_100828332 | 137 |
| 356 | 3300031691 | Ga0316579_10240285 | Ga0316579_102402852 | 137 |
| 357 | 3300031691 | Ga0316579_10591837 | Ga0316579_105918371 | 137 |
| 358 | 3300031712 | Ga0265342_10017863 | Ga0265342_100178636 | 137 |
| 359 | 3300031731 | Ga0307405_11521302 | Ga0307405_115213021 | 137 |
| 360 | 3300031733 | Ga0316577_10161296 | Ga0316577_101612962 | 137 |
| 361 | 3300031911 | Ga0307412_10476215 | Ga0307412_104762152 | 137 |
| 362 | 3300032002 | Ga0307416_100485158 | Ga0307416_1004851583 | 137 |
| 363 | 3300032126 | Ga0307415_101164287 | Ga0307415_1011642872 | 137 |
| 364 | 3300033179 | Ga0307507_10001172 | Ga0307507_1000117237 | 137 |
| 365 | 3300035083 | Ga0373926_0037245 | Ga0373926_0037245_541_954 | 137 |
| 366 | 3300035207 | Ga0373942_0083982 | Ga0373942_0083982_432_848 | 137 |
| 367 | 3300035398 | Ga0316574_0338805 | Ga0316574_0338805_526_942 | 137 |
| 368 | 3300035398 | Ga0316574_0531512 | Ga0316574_0531512_144_560 | 137 |
| 369 | 3300035692 | Ga0373935_0502025 | Ga0373935_0502025_216_629 | 137 |
| 370 | 3300035695 | Ga0373927_1149234 | Ga0373927_1149234_65_478 | 137 |
| 371 | 3300035725 | Ga0373947_0117913 | Ga0373947_0117913_1094_1507 | 137 |
| 372 | 3300036401 | Ga0373937_2003250 | Ga0373937_2003250_32_445 | 137 |
| 373 | 3300036647 | Ga0316582_0040533 | Ga0316582_0040533_1999_2445 | 137 |
| 374 | 3300036647 | Ga0316582_0455491 | Ga0316582_0455491_196_642 | 137 |
| 375 | 3300037068 | Ga0373925_0304106 | Ga0373925_0304106_331_744 | 137 |
| 376 | 3300037471 | Ga0395905_0149340 | Ga0395905_0149340_1541_1960 | 137 |
| 377 | 3300039093 | Ga0400489_68697 | Ga0400489_68697_1119_1535 | 137 |
| 378 | 3300039450 | Ga0436363_1146630 | Ga0436363_1146630_132_551 | 137 |
| 379 | 3300041408 | Ga0439453_0021937 | Ga0439453_0021937_17_430 | 137 |
| 380 | 3300041496 | Ga0451839_0161978 | Ga0451839_0161978_108_560 | 137 |
| 381 | 3300042438 | Ga0439459_0157942 | Ga0439459_0157942_120_539 | 137 |
| 382 | 3300042876 | Ga0451577_0440085 | Ga0451577_0440085_565_978 | 137 |
| 383 | 3300044694 | Ga0466963_0346410 | Ga0466963_0346410_141_662 | 137 |
| 384 | 3300045051 | Ga0451576_0191038 | Ga0451576_0191038_137_553 | 137 |
| 385 | 3300045051 | Ga0451576_1803757 | Ga0451576_1803757_148_564 | 137 |
| 386 | 3300046454 | Ga0495592_0037981 | Ga0495592_0037981_2635_3051 | 137 |
| 387 | 3300046459 | Ga0495629_0419739 | Ga0495629_0419739_51_464 | 137 |
| 388 | 3300046473 | Ga0495582_0107079 | Ga0495582_0107079_1032_1445 | 137 |
| 389 | 3300046507 | Ga0495606_0013471 | Ga0495606_0013471_2993_3412 | 137 |
| 390 | 3300046516 | Ga0495628_0342708 | Ga0495628_0342708_393_806 | 137 |
| 391 | 3300046536 | Ga0495587_0634147 | Ga0495587_0634147_126_539 | 137 |
| 392 | 3300046615 | Ga0495656_0282118 | Ga0495656_0282118_308_724 | 137 |
| 393 | 3300046642 | Ga0495634_0054681 | Ga0495634_0054681_1603_2028 | 137 |
| 394 | 3300046660 | Ga0495625_0002214 | Ga0495625_0002214_10341_10760 | 137 |
| 395 | 3300046678 | Ga0495599_0254412 | Ga0495599_0254412_180_596 | 137 |
| 396 | 3300046810 | Ga0495660_0002682 | Ga0495660_0002682_4506_4925 | 137 |
| 397 | 3300048088 | Ga0495602_0200146 | Ga0495602_0200146_532_948 | 137 |
| 398 | 3300048088 | Ga0495602_0294433 | Ga0495602_0294433_402_815 | 137 |
| 399 | 3300048903 | Ga0496100_0469441 | Ga0496100_0469441_222_638 | 137 |
| 400 | 3300048907 | Ga0496104_0807162 | Ga0496104_0807162_251_667 | 137 |
| 401 | 3300048908 | Ga0496105_0323742 | Ga0496105_0323742_32_448 | 137 |
| 402 | 3300048909 | Ga0496106_0082146 | Ga0496106_0082146_1522_1938 | 137 |
| 403 | 3300048910 | Ga0496107_0792229 | Ga0496107_0792229_14_427 | 137 |
| 404 | 3300048911 | Ga0496108_0516736 | Ga0496108_0516736_237_650 | 137 |
| 405 | 3300048911 | Ga0496108_1394519 | Ga0496108_1394519_90_506 | 137 |
| 406 | 3300048912 | Ga0496109_0712277 | Ga0496109_0712277_409_825 | 137 |
| 407 | 3300048912 | Ga0496109_1079828 | Ga0496109_1079828_226_639 | 137 |
| 408 | 3300048913 | Ga0496110_0724955 | Ga0496110_0724955_154_567 | 137 |
| 409 | 3300048915 | Ga0496112_0987112 | Ga0496112_0987112_241_657 | 137 |
| 410 | 3300048915 | Ga0496112_1465286 | Ga0496112_1465286_64_477 | 137 |
| 411 | 3300048917 | Ga0496114_0565105 | Ga0496114_0565105_314_730 | 137 |
| 412 | 3300048917 | Ga0496114_1496191 | Ga0496114_1496191_96_512 | 137 |
| 413 | 3300049568 | Ga0501031_0587945 | Ga0501031_0587945_265_681 | 137 |
| 414 | 3300049575 | Ga0501039_0901941 | Ga0501039_0901941_63_479 | 137 |
| 415 | 3300049576 | Ga0501040_0038207 | Ga0501040_0038207_86_502 | 137 |
| 416 | 3300049577 | Ga0501041_0117305 | Ga0501041_0117305_1056_1472 | 137 |
| 417 | 3300049578 | Ga0501042_0261268 | Ga0501042_0261268_370_786 | 137 |
| 418 | 3300049578 | Ga0501042_0459725 | Ga0501042_0459725_117_533 | 137 |
| 419 | 3300049582 | Ga0501048_0504914 | Ga0501048_0504914_402_818 | 137 |
| 420 | 3300049582 | Ga0501048_1389666 | Ga0501048_1389666_70_483 | 137 |
| 421 | 3300049584 | Ga0501068_0705603 | Ga0501068_0705603_89_529 | 137 |
| 422 | 3300049591 | Ga0501075_0039710 | Ga0501075_0039710_2895_3311 | 137 |
| 423 | 3300049591 | Ga0501075_0316225 | Ga0501075_0316225_223_642 | 137 |
| 424 | 3300049591 | Ga0501075_0647279 | Ga0501075_0647279_189_605 | 137 |
| 425 | 3300049592 | Ga0501076_0019279 | Ga0501076_0019279_349_765 | 137 |
| 426 | 3300049592 | Ga0501076_0909092 | Ga0501076_0909092_196_612 | 137 |
| 427 | 3300049593 | Ga0501077_0842698 | Ga0501077_0842698_117_539 | 137 |
| 428 | 3300049741 | Ga0501079_0038754 | Ga0501079_0038754_2294_2710 | 137 |
| 429 | 3300049741 | Ga0501079_0273791 | Ga0501079_0273791_275_691 | 137 |
| 430 | 3300049742 | Ga0501080_0993760 | Ga0501080_0993760_108_524 | 137 |
| 431 | 3300049743 | Ga0501081_0133871 | Ga0501081_0133871_1316_1735 | 137 |
| 432 | 3300049743 | Ga0501081_0383965 | Ga0501081_0383965_193_609 | 137 |
| 433 | 3300049743 | Ga0501081_0463837 | Ga0501081_0463837_262_678 | 137 |
| 434 | 3300049743 | Ga0501081_0562902 | Ga0501081_0562902_84_500 | 137 |
| 435 | 3300049824 | Ga0501045_0216017 | Ga0501045_0216017_702_1124 | 137 |
| 436 | 3300050493 | nmdc:mga0k408_106_c1 | nmdc:mga0k408_106_c1_23189_23608 | 137 |
| 437 | 3300050493 | nmdc:mga0k408_166796_c1 | nmdc:mga0k408_166796_c1_202_627 | 137 |
| 438 | 3300050507 | nmdc:mga05p37_1047736_c1 | nmdc:mga05p37_1047736_c1_162_611 | 137 |
| 439 | 3300050507 | nmdc:mga05p37_16647_c1 | nmdc:mga05p37_16647_c1_6829_7245 | 137 |
| 440 | 3300050507 | nmdc:mga05p37_193286_c1 | nmdc:mga05p37_193286_c1_1639_2055 | 137 |
| 441 | 3300050507 | nmdc:mga05p37_197631_c1 | nmdc:mga05p37_197631_c1_1495_1911 | 137 |
| 442 | 3300050508 | nmdc:mga09592_331970_c1 | nmdc:mga09592_331970_c1_169_633 | 137 |
| 443 | 3300050509 | nmdc:mga0qj67_568107_c1 | nmdc:mga0qj67_568107_c1_149_613 | 137 |
| 444 | 3300050509 | nmdc:mga0qj67_926924_c1 | nmdc:mga0qj67_926924_c1_162_578 | 137 |
| 445 | 3300050511 | nmdc:mga08y16_13913_c1 | nmdc:mga08y16_13913_c1_4274_4690 | 137 |
| 446 | 3300050511 | nmdc:mga08y16_200303_c1 | nmdc:mga08y16_200303_c1_919_1335 | 137 |
| 447 | 3300050511 | nmdc:mga08y16_24560_c1 | nmdc:mga08y16_24560_c1_5620_6036 | 137 |
| 448 | 3300050511 | nmdc:mga08y16_29270_c1 | nmdc:mga08y16_29270_c1_4860_5276 | 137 |
| 449 | 3300050511 | nmdc:mga08y16_5934_c1 | nmdc:mga08y16_5934_c1_7069_7485 | 137 |
| 450 | 3300050511 | nmdc:mga08y16_598027_c1 | nmdc:mga08y16_598027_c1_613_1029 | 137 |
| 451 | 3300050512 | nmdc:mga0n895_1125254_c1 | nmdc:mga0n895_1125254_c1_231_659 | 137 |
| 452 | 3300050512 | nmdc:mga0n895_28663_c1 | nmdc:mga0n895_28663_c1_3513_3929 | 137 |
| 453 | 3300050512 | nmdc:mga0n895_344115_c1 | nmdc:mga0n895_344115_c1_328_747 | 137 |
| 454 | 3300050512 | nmdc:mga0n895_441670_c1 | nmdc:mga0n895_441670_c1_505_918 | 137 |
| 455 | 3300050512 | nmdc:mga0n895_59104_c1 | nmdc:mga0n895_59104_c1_2222_2638 | 137 |
| 456 | 3300050512 | nmdc:mga0n895_631931_c1 | nmdc:mga0n895_631931_c1_636_1052 | 137 |
| 457 | 3300050513 | nmdc:mga0rr50_470115_c1 | nmdc:mga0rr50_470115_c1_550_966 | 137 |
| 458 | 3300050513 | nmdc:mga0rr50_58317_c1 | nmdc:mga0rr50_58317_c1_459_875 | 137 |
| 459 | 3300050513 | nmdc:mga0rr50_627586_c1 | nmdc:mga0rr50_627586_c1_447_863 | 137 |
| 460 | 3300050513 | nmdc:mga0rr50_691294_c1 | nmdc:mga0rr50_691294_c1_151_579 | 137 |
| 461 | 3300050513 | nmdc:mga0rr50_878910_c1 | nmdc:mga0rr50_878910_c1_205_621 | 137 |
| 462 | 3300050514 | nmdc:mga08x19_137679_c1 | nmdc:mga08x19_137679_c1_18_467 | 137 |
| 463 | 3300050514 | nmdc:mga08x19_143753_c1 | nmdc:mga08x19_143753_c1_450_866 | 137 |
| 464 | 3300050514 | nmdc:mga08x19_26867_c1 | nmdc:mga08x19_26867_c1_1158_1574 | 137 |
| 465 | 3300050514 | nmdc:mga08x19_37315_c1 | nmdc:mga08x19_37315_c1_2481_2897 | 137 |
| 466 | 3300050514 | nmdc:mga08x19_49681_c1 | nmdc:mga08x19_49681_c1_660_1076 | 137 |
| 467 | 3300050514 | nmdc:mga08x19_899038_c1 | nmdc:mga08x19_899038_c1_41_469 | 137 |
| 468 | 3300050515 | nmdc:mga0a205_472477_c1 | nmdc:mga0a205_472477_c1_31_447 | 137 |
| 469 | 3300050515 | nmdc:mga0a205_474679_c1 | nmdc:mga0a205_474679_c1_511_930 | 137 |
| 470 | 3300050515 | nmdc:mga0a205_62314_c1 | nmdc:mga0a205_62314_c1_193_609 | 137 |
| 471 | 3300050515 | nmdc:mga0a205_81371_c1 | nmdc:mga0a205_81371_c1_345_761 | 137 |
| 472 | 3300053085 | Ga0495619_0260684 | Ga0495619_0260684_152_565 | 137 |
| 473 | 3300054114 | Ga0501084_0037225 | Ga0501084_0037225_1374_1790 | 137 |
| 474 | 3300054114 | Ga0501084_0441005 | Ga0501084_0441005_334_753 | 137 |
| 475 | 3300060353 | Ga0501082_0156810 | Ga0501082_0156810_983_1399 | 137 |
| 476 | 3300060353 | Ga0501082_0427261 | Ga0501082_0427261_273_689 | 137 |
| 477 | 3300061734 | Ga0530510_0307597 | Ga0530510_0307597_567_992 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6aes-assembly2.cif.gz_B | crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. | 0.9948 | 2 | 136 |
| 2nck-assembly1.cif.gz_R | crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution | 0.9944 | 2 | 136 |
| 6ay1-assembly5.cif.gz_E | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9928 | 1 | 136 |
| 4ek2-assembly1.cif.gz_A | the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate | 0.9923 | 2 | 136 |
| 5v6d-assembly3.cif.gz_F | crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate | 0.9917 | 2 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z7E5_29_180_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9896 | 2 | 131 | 3.30.70.141 |
| 4w98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.986 | 2 | 136 | 3.30.70.141 |
| af_I1KHD6_3_118_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9832 | 31 | 131 | 3.30.70.141 |
| af_F1R4T6_18_163_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9817 | 2 | 131 | 3.30.70.141 |
| af_O88425_6_161_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.981 | 2 | 131 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M2CU60-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 1 | 137 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A388PZN9-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 1 | 131 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A524K0C0-F1-model_v4 | Nucleoside-diphosphate kinase (EC 2.7.4.6) | 1.001 | 1 | 131 |
GO:0004550
GO:0006183 GO:0006228 GO:0006241 |
| AF-A0A2D7MEP1-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1 | 3 | 137 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-V6DH04-F1-model_v4 | Nucleoside diphosphate kinase (EC 2.7.4.6) | 1 | 2 | 132 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar