metagRoot

F451623

General Info

Members	Datasets	Scaffolds	Average Seq Length
476	316	394	546

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|8055266321\|8055270902
Length	574
Sequence	LARNGAQPGRRFHYFLQRMNGDRVMSAKAYSHGLEKNAANHVPLTPLTFLDRTADVYPDRTAIIHGDFRQTWAETRERCYRLASALVQLGIEPGDTVSIIAPNTPAMLEAHFGVPLSGAVLNAVNCRLDADGVAFILRHGECKLLLVDREFAPLVEKALQSVPNSPRVIDINDHEAPDGTAIGETDYESLLASGDPAFAGCHPVDEWTPIALNYTSGTTGDPKGVVPSHRGTYLMSLVQMTNWPLPRAPIYLWTLPMFHANGWCFTWAITAAAGTHVCLRKVNAANVLSAIAKHGVDHFCAAPIVLSGIASMHQSEWQPLPRRVRVLTAGSPAPAAVLEAVGAMGFDVDHVFGITEISGTPISCAWHDEWDALPAEQQGKLKARQGVRAAAFEKMSVADLATLEPVPADSKSSGEVLVQGNTVMMGYLKNPEATAKAFDGGWFHTGDIAVVHPDGYIQITDRSKDVIISGGENISSVEVEEVIYRMSGVLNAAVVAQPDDKWGETPCAFIELKADAPSITEEDVISFCRQRLAHFKCPRRVVFGELPKTATGKIQKFRLREQAGSRVAITRLAQ

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
3	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
4	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
5	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
6	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
7	2547132374	Acidovorax radicis N35	Isolate	Unclassified
8	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
9	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
10	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
11	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
12	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
13	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
14	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
15	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
16	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
17	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
18	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
19	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
20	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
21	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
22	2643221645	Massilia sp. Root351	Isolate	Unclassified
23	2643221658	Variovorax sp. Root411	Isolate	Unclassified
24	2643221672	Variovorax sp. Root434	Isolate	Unclassified
25	2643221683	Variovorax sp. Root473	Isolate	Unclassified
26	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
27	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
28	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
29	2738541280	Massilia sp. GV090	Isolate	Unclassified
30	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
31	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
32	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
33	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
34	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
35	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
36	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
37	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
38	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
39	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
40	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
41	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
42	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
43	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
44	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
45	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
46	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
47	2818991450	Burkholderia sp. 604	Isolate	Unclassified
48	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
49	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
50	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
51	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
52	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
53	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
54	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
55	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
56	2901300506	Cupriavidus sp. UYMSc13B	Isolate	Unclassified
57	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
58	2904456579	Variovorax sp. 2002	Isolate	Unclassified
59	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
60	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
61	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
62	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
63	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
64	2928163908	Burkholderia sp. 567	Isolate	Unclassified
65	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
66	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
67	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
68	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
69	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
70	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
71	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
72	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
73	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
74	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
75	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
76	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
77	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
78	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
79	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
80	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
81	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
82	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
83	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
84	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
85	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
86	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
87	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
88	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
89	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
90	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
91	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
92	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
93	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
94	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
95	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
96	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
97	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
98	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
99	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
100	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
101	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
102	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
103	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
104	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
105	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
106	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
107	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
108	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
109	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
110	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
111	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
112	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
113	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
114	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
115	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
116	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
117	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
118	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
119	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
120	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
121	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
122	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
123	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
124	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
125	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
126	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
127	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
128	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
129	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
130	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
131	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
132	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
133	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
134	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
135	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
136	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
137	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
138	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
139	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
140	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
141	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
144	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
164	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
165	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
168	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
169	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
170	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
171	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
172	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
173	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
174	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
175	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
176	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
177	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
178	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
179	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
180	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
181	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
182	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
183	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
184	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
185	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
186	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
187	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
188	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
189	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
190	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
191	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
192	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
193	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
194	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
195	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
196	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
197	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
198	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
199	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
200	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
201	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
202	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
203	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
204	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
205	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
206	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
207	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
208	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
209	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
210	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
211	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
212	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
213	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
214	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
215	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
216	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
217	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
218	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
219	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
220	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
221	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
222	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
223	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
224	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
225	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
226	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
227	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
228	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
229	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
230	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
231	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
232	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
233	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
234	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
235	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
236	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
237	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
238	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
239	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
240	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
241	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
242	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
243	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
244	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
245	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
246	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
247	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
248	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
249	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
250	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
251	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
252	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
253	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
254	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
255	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
256	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
257	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
258	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
259	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
260	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
261	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
262	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
263	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
264	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
265	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
266	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
267	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
268	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
269	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
270	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
271	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
272	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
273	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
274	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
275	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
276	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
277	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
278	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
279	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
280	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
281	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
282	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
283	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
284	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
285	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
286	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
287	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
288	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
289	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
290	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
291	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
292	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
293	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
294	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
295	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
296	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
297	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
298	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
299	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
300	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
301	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
302	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
303	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
304	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
305	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
306	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
307	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
308	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
309	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
310	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
311	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
312	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
313	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
314	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
315	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
316	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	82.77
Metatranscriptomes	0
Isolates	17.23

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.39
Nodule	2.1
Rhizoplane	4.2
Rhizosphere	70.17
Stem	0
Stem Tuber	0
Unclassified	11.13

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_279	2124908027	Bacteria	8187
2	JGI24740J21852_10002078	3300001979	Bacteria	9143
3	JGI24739J22299_10015148	3300001989	Bacteria	2802
4	JGI24739J22299_10015870	3300001989	Bacteria	2732
5	JGI24739J22299_10015892	3300001989	Bacteria	2731
6	JGI24738J21930_10003768	3300002075	Bacteria	3790
7	JGI24751J29686_10001377	3300002459	Bacteria	5111
8	Ga0055537_1000010	3300003773	Bacteria	138059
9	Ga0055524_1015694	3300003775	Bacteria	2750
10	Ga0055536_1000496	3300003781	Bacteria	27262
11	Ga0055534_1000015	3300003784	Bacteria	148531
12	Ga0055528_1000908	3300003790	Bacteria	19991
13	Ga0055530_10000165	3300003791	Bacteria	60120
14	Ga0055530_10004125	3300003791	Bacteria	7709
15	Ga0055540_1000142	3300003792	Bacteria	71685
16	Ga0055540_1000186	3300003792	Bacteria	60120
17	Ga0055531_10000424	3300003794	Bacteria	40020
18	Ga0065714_10003364	3300005288	Bacteria	12768
19	Ga0065714_10004687	3300005288	Bacteria	4780
20	Ga0068869_100128015	3300005334	Bacteria	1949
21	Ga0068868_100018748	3300005338	Bacteria	5176
22	Ga0070660_100000057	3300005339	Bacteria	66715
23	Ga0070691_10033276	3300005341	Bacteria	2425
24	Ga0070669_100036597	3300005353	Bacteria	3557
25	Ga0070674_100063155	3300005356	Bacteria	2591
26	Ga0070659_100000097	3300005366	Bacteria	66243
27	Ga0070667_100005568	3300005367	Bacteria	10514
28	Ga0070663_100021610	3300005455	Bacteria	4284
29	Ga0068867_100005410	3300005459	Bacteria	9031
30	Ga0070707_100011109	3300005468	Bacteria	8388
31	Ga0070698_100051917	3300005471	Bacteria	4174
32	Ga0070699_100030058	3300005518	Bacteria	4688
33	Ga0068852_100003155	3300005616	Bacteria	11496
34	Ga0068859_100023623	3300005617	Bacteria	6170
35	Ga0068859_100058010	3300005617	Bacteria	3899
36	Ga0068863_100001695	3300005841	Bacteria	21824
37	Ga0068863_100070037	3300005841	Bacteria	3316
38	Ga0068858_100165999	3300005842	Bacteria	2080
39	Ga0068862_100004065	3300005844	Bacteria	12404
40	Ga0081540_1000012	3300005983	Bacteria	189939
41	Ga0075363_100027457	3300006048	Bacteria	2919
42	Ga0075432_10000324	3300006058	Bacteria	13530
43	Ga0075432_10015014	3300006058	Bacteria	2639
44	Ga0075432_10021049	3300006058	Bacteria	2231
45	Ga0075362_10002885	3300006177	Bacteria	5884
46	Ga0075362_10004800	3300006177	Bacteria	4883
47	Ga0075362_10021514	3300006177	Bacteria	2708
48	Ga0075362_10048524	3300006177	Bacteria	1895
49	Ga0075369_10014537	3300006186	Bacteria	3146
50	Ga0075370_10000369	3300006353	Bacteria	16488
51	Ga0075431_100001585	3300006847	Bacteria	21156
52	Ga0097620_100023623	3300006931	Bacteria	6170
53	Ga0097620_100058012	3300006931	Bacteria	3899
54	Ga0079104_1015227	3300006946	Bacteria	2286
55	Ga0099826_10003210	3300006948	Bacteria	11008
56	Ga0105251_10000029	3300009011	Bacteria	125097
57	Ga0105244_10010292	3300009036	Bacteria	5679
58	Ga0105244_10010883	3300009036	Bacteria	5488
59	Ga0105250_10030261	3300009092	Bacteria	2177
60	Ga0105240_10004687	3300009093	Bacteria	20679
61	Ga0105243_10000604	3300009148	Bacteria	35803
62	Ga0105243_10013471	3300009148	Bacteria	6185
63	Ga0105243_10275946	3300009148	Bacteria	1512
64	Ga0105248_10054862	3300009177	Bacteria	4470
65	Ga0105237_10004028	3300009545	Bacteria	17166
66	Ga0105237_10008715	3300009545	Bacteria	10953
67	Ga0105237_10074193	3300009545	Bacteria	3394
68	Ga0105238_10097613	3300009551	Bacteria	2923
69	Ga0105249_10022692	3300009553	Bacteria	5624
70	Ga0105249_10118897	3300009553	Bacteria	2509
71	Ga0105239_10181559	3300010375	Bacteria	2354
72	Ga0105246_10001560	3300011119	Bacteria	13630
73	Ga0105246_10046545	3300011119	Bacteria	2959
74	Ga0157373_10000665	3300013100	Bacteria	26863
75	Ga0157373_10000941	3300013100	Bacteria	22534
76	Ga0157371_10017628	3300013102	Bacteria	5298
77	Ga0157370_10066498	3300013104	Bacteria	3409
78	Ga0157378_10292073	3300013297	Bacteria	1575
79	Ga0157375_10021779	3300013308	Bacteria	5886
80	Ga0157375_10054361	3300013308	Bacteria	3943
81	Ga0182008_10027527	3300014497	Bacteria	2878
82	Ga0182008_10059620	3300014497	Bacteria	1883
83	Ga0157379_10224551	3300014968	Bacteria	1702
84	Ga0182006_1006454	3300015261	Bacteria	5449
85	Ga0182007_10004049	3300015262	Bacteria	6748
86	Ga0182007_10008668	3300015262	Bacteria	4161
87	Ga0163161_10012160	3300017792	Bacteria	5970
88	Ga0163161_10014172	3300017792	Bacteria	5552
89	Ga0163161_10027508	3300017792	Bacteria	4035
90	Ga0209759_1001698	3300025256	Bacteria	11430
91	Ga0209565_1000025	3300025263	Bacteria	377969
92	Ga0209673_1000149	3300025273	Bacteria	148659
93	Ga0209673_1001197	3300025273	Bacteria	27836
94	Ga0209675_1000017	3300025291	Bacteria	378002
95	Ga0209675_1002159	3300025291	Bacteria	10364
96	Ga0209676_1000152	3300025292	Bacteria	166700
97	Ga0209676_1004034	3300025292	Bacteria	8455
98	Ga0209676_1005576	3300025292	Bacteria	6509
99	Ga0209050_1000037	3300025298	Bacteria	415612
100	Ga0209050_1000210	3300025298	Bacteria	129834
101	Ga0209256_1001148	3300025299	Bacteria	30046
102	Ga0209051_1000040	3300025303	Bacteria	315055
103	Ga0209051_1000074	3300025303	Bacteria	208667
104	Ga0209051_1000302	3300025303	Bacteria	77692
105	Ga0209051_1005550	3300025303	Bacteria	7337
106	Ga0209257_1000072	3300025304	Bacteria	332791
107	Ga0209257_1002314	3300025304	Bacteria	19259
108	Ga0207696_1014498	3300025711	Bacteria	2701
109	Ga0207655_1010066	3300025728	Bacteria	5783
110	Ga0207655_1019077	3300025728	Bacteria	3605
111	Ga0207713_1000112	3300025735	Bacteria	133341
112	Ga0207680_10034856	3300025903	Bacteria	2883
113	Ga0207647_10014916	3300025904	Bacteria	5340
114	Ga0207647_10024205	3300025904	Bacteria	4005
115	Ga0207657_10000118	3300025919	Bacteria	78669
116	Ga0207687_10035035	3300025927	Bacteria	3412
117	Ga0207690_10000025	3300025932	Bacteria	179019
118	Ga0207706_10014947	3300025933	Bacteria	7029
119	Ga0207709_10000411	3300025935	Bacteria	41804
120	Ga0207689_10027801	3300025942	Bacteria	4733
121	Ga0207712_10004346	3300025961	Bacteria	8954
122	Ga0207712_10049557	3300025961	Bacteria	2927
123	Ga0207668_10023058	3300025972	Bacteria	3995
124	Ga0207658_10003430	3300025986	Bacteria	11221
125	Ga0207678_10000409	3300026067	Bacteria	38784
126	Ga0207678_10091826	3300026067	Bacteria	2595
127	Ga0207648_10036370	3300026089	Bacteria	4338
128	Ga0207698_10082982	3300026142	Bacteria	2592
129	Ga0209282_1000340	3300027666	Bacteria	23191
130	Ga0207428_10013429	3300027907	Bacteria	7153
131	Ga0207428_10094348	3300027907	Bacteria	2320
132	Ga0268265_10002917	3300028380	Bacteria	12539
133	Ga0268265_10169051	3300028380	Bacteria	1866
134	Ga0268264_10040209	3300028381	Bacteria	3863
135	Ga0316177_1007315	3300030731	Bacteria	2294
136	Ga0314311_1093467	3300030733	Bacteria	19086
137	Ga0316183_1057192	3300030742	Bacteria	6511
138	Ga0265340_10023163	3300031247	Bacteria	3168
139	Ga0307513_10004128	3300031456	Bacteria	19469
140	Ga0307408_100000206	3300031548	Bacteria	63271
141	Ga0307408_100027008	3300031548	Bacteria	3951
142	Ga0307508_10023985	3300031616	Bacteria	5536
143	Ga0307405_10017224	3300031731	Bacteria	3960
144	Ga0307405_10040987	3300031731	Bacteria	2808
145	Ga0307413_10054039	3300031824	Bacteria	2435
146	Ga0307406_10000450	3300031901	Bacteria	24010
147	Ga0307407_10072537	3300031903	Bacteria	2054
148	Ga0307412_10000002	3300031911	Bacteria	743446
149	Ga0307412_10001734	3300031911	Bacteria	12053
150	Ga0307416_100104299	3300032002	Bacteria	2478
151	Ga0395899_0000005	3300037312	Bacteria	772966
152	Ga0395900_0000003	3300037418	Bacteria	587648
153	Ga0395900_0172735	3300037418	Bacteria	2199
154	Ga0395898_0000003	3300037466	Bacteria	772986
155	Ga0395905_0004495	3300037471	Bacteria	14462
156	Ga0395905_0014934	3300037471	Bacteria	7408
157	Ga0395905_0031046	3300037471	Bacteria	5031
158	Ga0395901_0000055	3300038443	Bacteria	157964
159	Ga0439447_000025	3300041407	Bacteria	50859
160	Ga0439466_0000532	3300041411	Bacteria	14397
161	Ga0439466_0002660	3300041411	Bacteria	6979
162	Ga0439431_0004711	3300041997	Bacteria	3001
163	Ga0439433_0003095	3300041999	Bacteria	3557
164	Ga0439432_000961	3300042006	Bacteria	10889
165	Ga0439432_002431	3300042006	Bacteria	7011
166	Ga0439452_019771	3300042010	Bacteria	1776
167	Ga0450920_008289	3300042122	Bacteria	1897
168	Ga0450922_001746	3300042124	Bacteria	2107
169	Ga0450923_000327	3300042125	Bacteria	4864
170	Ga0450890_000917	3300042127	Bacteria	4258
171	Ga0450898_004493	3300042134	Bacteria	2065
172	Ga0450902_000008	3300042137	Bacteria	18232
173	Ga0450906_005301	3300042145	Bacteria	2659
174	Ga0450907_000039	3300042146	Bacteria	57175
175	Ga0450907_000904	3300042146	Bacteria	7078
176	Ga0450910_000003	3300042147	Bacteria	81243
177	Ga0450908_003080	3300042184	Bacteria	3246
178	Ga0450893_0004831	3300042532	Bacteria	2152
179	Ga0466966_0047281	3300044684	Bacteria	2744
180	Ga0495617_000553	3300046452	Bacteria	19272
181	Ga0495617_002778	3300046452	Bacteria	6754
182	Ga0495603_0000009	3300046455	Bacteria	72869
183	Ga0495603_0004175	3300046455	Bacteria	8608
184	Ga0495603_0022410	3300046455	Bacteria	3824
185	Ga0495590_0002317	3300046457	Bacteria	7918
186	Ga0495629_0000235	3300046459	Bacteria	48444
187	Ga0495629_0001133	3300046459	Bacteria	21076
188	Ga0495629_0112683	3300046459	Bacteria	1896
189	Ga0495638_0015634	3300046460	Bacteria	5093
190	Ga0495638_0031655	3300046460	Bacteria	3398
191	Ga0495653_0000627	3300046463	Bacteria	26951
192	Ga0495653_0003966	3300046463	Bacteria	11951
193	Ga0495653_0004762	3300046463	Bacteria	10989
194	Ga0495580_0005556	3300046472	Bacteria	10397
195	Ga0495580_0008556	3300046472	Bacteria	8123
196	Ga0495580_0011047	3300046472	Bacteria	7000
197	Ga0495580_0029319	3300046472	Bacteria	3995
198	Ga0495580_0034436	3300046472	Bacteria	3646
199	Ga0495605_0000889	3300046474	Bacteria	20561
200	Ga0495605_0002073	3300046474	Bacteria	12635
201	Ga0495605_0004952	3300046474	Bacteria	7783
202	Ga0495605_0005213	3300046474	Bacteria	7577
203	Ga0495605_0008319	3300046474	Bacteria	5865
204	Ga0495664_0000252	3300046477	Bacteria	25891
205	Ga0495584_0000213	3300046491	Bacteria	41737
206	Ga0495584_0037597	3300046491	Bacteria	2447
207	Ga0495585_0002452	3300046492	Bacteria	13281
208	Ga0495585_0011323	3300046492	Bacteria	5281
209	Ga0495594_0002731	3300046499	Bacteria	9155
210	Ga0495596_0026995	3300046500	Bacteria	2312
211	Ga0495596_0045061	3300046500	Bacteria	1734
212	Ga0495607_0003184	3300046501	Bacteria	12674
213	Ga0495607_0008673	3300046501	Bacteria	6930
214	Ga0495607_0013805	3300046501	Bacteria	5278
215	Ga0495607_0070116	3300046501	Bacteria	1960
216	Ga0495583_0000040	3300046506	Bacteria	236558
217	Ga0495583_0000805	3300046506	Bacteria	38685
218	Ga0495583_0003411	3300046506	Bacteria	12120
219	Ga0495583_0007121	3300046506	Bacteria	7127
220	Ga0495583_0009937	3300046506	Bacteria	5620
221	Ga0495583_0038308	3300046506	Bacteria	2265
222	Ga0495610_0009495	3300046512	Bacteria	6144
223	Ga0495610_0040038	3300046512	Bacteria	2365
224	Ga0495616_0001101	3300046513	Bacteria	19244
225	Ga0495616_0029058	3300046513	Bacteria	2921
226	Ga0495628_0005523	3300046516	Bacteria	11063
227	Ga0495628_0013588	3300046516	Bacteria	6846
228	Ga0495630_0045482	3300046517	Bacteria	3281
229	Ga0495631_0000007	3300046518	Bacteria	130158
230	Ga0495632_0000406	3300046519	Bacteria	40685
231	Ga0495637_0019240	3300046520	Bacteria	3159
232	Ga0495643_0000141	3300046522	Bacteria	115660
233	Ga0495644_0000141	3300046523	Bacteria	34630
234	Ga0495648_0002752	3300046524	Bacteria	15878
235	Ga0495648_0005450	3300046524	Bacteria	10562
236	Ga0495648_0007995	3300046524	Bacteria	8387
237	Ga0495648_0009953	3300046524	Bacteria	7296
238	Ga0495648_0029040	3300046524	Bacteria	3675
239	Ga0495666_0001709	3300046526	Bacteria	10848
240	Ga0495642_0000036	3300046528	Bacteria	79741
241	Ga0495654_0002604	3300046530	Bacteria	11509
242	Ga0495654_0003814	3300046530	Bacteria	9117
243	Ga0495665_0000205	3300046531	Bacteria	30190
244	Ga0495665_0002813	3300046531	Bacteria	9387
245	Ga0495665_0050859	3300046531	Bacteria	2196
246	Ga0495609_0000310	3300046538	Bacteria	43799
247	Ga0495609_0001830	3300046538	Bacteria	13629
248	Ga0495609_0002674	3300046538	Bacteria	10792
249	Ga0495609_0013607	3300046538	Bacteria	3840
250	Ga0495597_0006782	3300046542	Bacteria	5892
251	Ga0495622_0005580	3300046557	Bacteria	5834
252	Ga0495633_0014566	3300046558	Bacteria	4106
253	Ga0495656_0006187	3300046615	Bacteria	4187
254	Ga0495611_0000611	3300046648	Bacteria	20600
255	Ga0495625_0000056	3300046660	Bacteria	186024
256	Ga0495625_0004514	3300046660	Bacteria	13131
257	Ga0495625_0006100	3300046660	Bacteria	10803
258	Ga0495625_0020458	3300046660	Bacteria	5109
259	Ga0495635_0005280	3300046663	Bacteria	8985
260	Ga0495659_0000348	3300046664	Bacteria	18131
261	Ga0495659_0000356	3300046664	Bacteria	17886
262	Ga0495659_0001849	3300046664	Bacteria	6993
263	Ga0495661_0007489	3300046665	Bacteria	7613
264	Ga0495661_0011439	3300046665	Bacteria	6023
265	Ga0495661_0023297	3300046665	Bacteria	4020
266	Ga0495588_0009901	3300046674	Bacteria	4418
267	Ga0495588_0022146	3300046674	Bacteria	3139
268	Ga0495623_0002428	3300046679	Bacteria	12352
269	Ga0495658_0003299	3300046683	Bacteria	8018
270	Ga0495669_0001326	3300046684	Bacteria	10238
271	Ga0495624_0000868	3300046690	Bacteria	23979
272	Ga0495624_0001065	3300046690	Bacteria	21634
273	Ga0495624_0001651	3300046690	Bacteria	17117
274	Ga0495670_0000107	3300046691	Bacteria	36797
275	Ga0495670_0000322	3300046691	Bacteria	22906
276	Ga0495670_0005304	3300046691	Bacteria	6342
277	Ga0495671_0000159	3300046692	Bacteria	59318
278	Ga0495671_0001185	3300046692	Bacteria	17838
279	Ga0495671_0002137	3300046692	Bacteria	12623
280	Ga0495671_0003162	3300046692	Bacteria	10232
281	Ga0495671_0059679	3300046692	Bacteria	1884
282	Ga0495649_0005109	3300046694	Bacteria	8422
283	Ga0495649_0010313	3300046694	Bacteria	5518
284	Ga0495589_0004803	3300046794	Bacteria	7183
285	Ga0495660_0001291	3300046810	Bacteria	17347
286	Ga0495660_0004375	3300046810	Bacteria	8557
287	Ga0495604_0008520	3300047317	Bacteria	8097
288	Ga0495604_0012301	3300047317	Bacteria	6803
289	Ga0495604_0092137	3300047317	Bacteria	2245
290	Ga0495636_0000859	3300047318	Bacteria	11232
291	Ga0495674_0000616	3300047319	Bacteria	33302
292	Ga0495674_0002864	3300047319	Bacteria	16763
293	Ga0495674_0010007	3300047319	Bacteria	8986
294	Ga0495672_0000116	3300047320	Bacteria	127119
295	Ga0495672_0000443	3300047320	Bacteria	49356
296	Ga0495672_0000507	3300047320	Bacteria	44916
297	Ga0495672_0000835	3300047320	Bacteria	32845
298	Ga0495672_0003525	3300047320	Bacteria	13336
299	Ga0495672_0010317	3300047320	Bacteria	6671
300	Ga0495672_0012616	3300047320	Bacteria	5883
301	Ga0495672_0016598	3300047320	Bacteria	4955
302	Ga0495676_0014139	3300047321	Bacteria	7147
303	Ga0495676_0123762	3300047321	Bacteria	1877
304	Ga0495680_0008823	3300047322	Bacteria	9128
305	Ga0495683_0000949	3300047323	Bacteria	20404
306	Ga0495683_0001063	3300047323	Bacteria	18985
307	Ga0495683_0001956	3300047323	Bacteria	12863
308	Ga0495687_000050	3300047443	Bacteria	200856
309	Ga0495687_000159	3300047443	Bacteria	101178
310	Ga0495687_000160	3300047443	Bacteria	100989
311	Ga0495687_000173	3300047443	Bacteria	95361
312	Ga0495687_016727	3300047443	Bacteria	3680
313	Ga0495677_0000681	3300047445	Bacteria	13766
314	Ga0495679_000183	3300047446	Bacteria	56008
315	Ga0495679_015311	3300047446	Bacteria	2809
316	Ga0495685_000124	3300047447	Bacteria	26703
317	Ga0495673_0000015	3300047469	Bacteria	598766
318	Ga0495673_0002000	3300047469	Bacteria	14998
319	Ga0495673_0003069	3300047469	Bacteria	11231
320	Ga0495673_0004139	3300047469	Bacteria	9179
321	Ga0495673_0007250	3300047469	Bacteria	6404
322	Ga0495681_0000838	3300047470	Bacteria	23671
323	Ga0495681_0001873	3300047470	Bacteria	15453
324	Ga0495681_0026926	3300047470	Bacteria	2982
325	Ga0495593_0000051	3300047673	Bacteria	47877
326	Ga0495593_0000564	3300047673	Bacteria	21049
327	Ga0495593_0001352	3300047673	Bacteria	14314
328	Ga0495593_0011892	3300047673	Bacteria	4990
329	Ga0495602_0000105	3300048088	Bacteria	80480
330	Ga0495614_0004544	3300048089	Bacteria	6255
331	Ga0495626_0009362	3300048091	Bacteria	5297
332	Ga0495626_0022876	3300048091	Bacteria	3084
333	Ga0496100_0007150	3300048903	Bacteria	6132
334	Ga0496100_0048240	3300048903	Bacteria	2748
335	Ga0496101_0047564	3300048904	Bacteria	3080
336	Ga0496102_0058525	3300048905	Bacteria	3521
337	Ga0496102_0201693	3300048905	Bacteria	1875
338	Ga0496104_0031261	3300048907	Bacteria	4951
339	Ga0496106_0152562	3300048909	Bacteria	1823
340	Ga0496110_0182053	3300048913	Bacteria	1908
341	Ga0496116_0007049	3300048919	Bacteria	10066
342	Ga0496116_0016164	3300048919	Bacteria	5856
343	Ga0496117_0004567	3300048920	Bacteria	15154
344	Ga0496117_0016852	3300048920	Bacteria	6136
345	Ga0496117_0053965	3300048920	Bacteria	2819
346	Ga0496118_0002082	3300048921	Bacteria	28141
347	Ga0496118_0002433	3300048921	Bacteria	25052
348	Ga0496118_0014372	3300048921	Bacteria	7417
349	Ga0496118_0014897	3300048921	Bacteria	7243
350	Ga0496118_0029614	3300048921	Bacteria	4587
351	Ga0496121_0003972	3300048924	Bacteria	20405
352	Ga0496121_0006629	3300048924	Bacteria	14258
353	Ga0496121_0037767	3300048924	Bacteria	4284
354	Ga0496124_0015512	3300048927	Bacteria	7295
355	Ga0496125_0005016	3300048928	Bacteria	14951
356	Ga0496125_0066976	3300048928	Bacteria	2833
357	Ga0495678_002624	3300049459	Bacteria	11991
358	Ga0495678_003490	3300049459	Bacteria	9685
359	Ga0495678_007470	3300049459	Bacteria	5656
360	Ga0495682_0000202	3300049460	Bacteria	47912
361	Ga0495682_0001271	3300049460	Bacteria	14154
362	Ga0495682_0001369	3300049460	Bacteria	13363
363	Ga0495682_0008951	3300049460	Bacteria	3927
364	Ga0501034_0000106	3300049571	Bacteria	153523
365	Ga0501227_002945	3300049665	Bacteria	3722
366	Ga0501249_002550	3300049679	Bacteria	3675
367	Ga0501225_0001936	3300049705	Bacteria	6482
368	Ga0501262_000018	3300049759	Bacteria	23886
369	Ga0501226_000161	3300049853	Bacteria	11694
370	nmdc:mga03683_10865_c1	3300050489	Bacteria	3275
371	nmdc:mga03683_11850_c1	3300050489	Bacteria	3169
372	nmdc:mga03683_997_c2	3300050489	Bacteria	5792
373	nmdc:mga03n38_6432_c1	3300050490	Bacteria	4079
374	nmdc:mga0k408_11603_c1	3300050493	Bacteria	4802
375	nmdc:mga0k408_28581_c1	3300050493	Bacteria	3171
376	nmdc:mga07m45_286_c1	3300050496	Bacteria	20367
377	nmdc:mga0sz30_3117_c1	3300050516	Bacteria	5941
378	Ga0500610_0000091	3300053079	Bacteria	27427
379	Ga0500610_0000460	3300053079	Bacteria	12558
380	Ga0500643_007027	3300053087	Bacteria	4615
381	Ga0500651_0000038	3300053093	Bacteria	101707
382	Ga0500566_0008492	3300053094	Bacteria	6072
383	Ga0500571_000091	3300053110	Bacteria	29044
384	Ga0500593_000115	3300053117	Bacteria	30964
385	Ga0500594_0001341	3300053118	Bacteria	5330
386	Ga0500597_001054	3300053120	Bacteria	6593
387	Ga0500607_001314	3300053121	Bacteria	22652
388	Ga0500655_004222	3300053133	Bacteria	2587
389	Ga0500658_0000732	3300053134	Bacteria	13527
390	Ga0500658_0004761	3300053134	Bacteria	5057
391	Ga0500574_000613	3300053141	Bacteria	4604
392	Ga0500634_0005260	3300053161	Bacteria	6113
393	Ga0500638_000631	3300053162	Bacteria	9119
394	Ga0500636_0026441	3300053177	Bacteria	3429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046516	Ga0495628_0013588	Ga0495628_0013588_4432_5841	441
2	3300009553	Ga0105249_10022692	Ga0105249_100226923	456
3	iso_pu_bacteria	2901300506	2901312717	465
4	3300014497	Ga0182008_10027527	Ga0182008_100275273	466
5	3300015261	Ga0182006_1006454	Ga0182006_10064544	466
6	3300015262	Ga0182007_10008668	Ga0182007_100086683	466
7	3300009148	Ga0105243_10275946	Ga0105243_102759462	468
8	3300013297	Ga0157378_10292073	Ga0157378_102920731	468
9	3300014497	Ga0182008_10059620	Ga0182008_100596201	468
10	3300041407	Ga0439447_000025	Ga0439447_000025_11626_13032	468
11	3300042122	Ga0450920_008289	Ga0450920_008289_241_1647	468
12	3300042124	Ga0450922_001746	Ga0450922_001746_358_1764	468
13	3300042146	Ga0450907_000039	Ga0450907_000039_13744_15150	468
14	3300042147	Ga0450910_000003	Ga0450910_000003_37902_39308	468
15	3300042184	Ga0450908_003080	Ga0450908_003080_647_2053	468
16	3300049459	Ga0495678_007470	Ga0495678_007470_4222_5628	468
17	3300042134	Ga0450898_004493	Ga0450898_004493_596_2047	478
18	3300053121	Ga0500607_001314	Ga0500607_001314_14512_15972	486
19	3300005617	Ga0068859_100058010	Ga0068859_1000580102	494
20	3300005841	Ga0068863_100001695	Ga0068863_10000169524	494
21	3300005842	Ga0068858_100165999	Ga0068858_1001659992	494
22	3300005844	Ga0068862_100004065	Ga0068862_1000040654	494
23	3300006931	Ga0097620_100058012	Ga0097620_1000580122	494
24	3300014968	Ga0157379_10224551	Ga0157379_102245512	494
25	3300025961	Ga0207712_10004346	Ga0207712_100043464	494
26	3300028380	Ga0268265_10002917	Ga0268265_100029175	494
27	3300009036	Ga0105244_10010292	Ga0105244_100102921	495
28	3300046506	Ga0495583_0000040	Ga0495583_0000040_229649_231301	508
29	3300046542	Ga0495597_0006782	Ga0495597_0006782_4046_5707	508
30	3300046692	Ga0495671_0000159	Ga0495671_0000159_3659_5320	508
31	3300047320	Ga0495672_0012616	Ga0495672_0012616_3803_5464	508
32	iso_pu_bacteria	2599185318	2600037233	508
33	3300042532	Ga0450893_0004831	Ga0450893_0004831_32_1594	510
34	3300042010	Ga0439452_019771	Ga0439452_019771_78_1622	512
35	3300046530	Ga0495654_0003814	Ga0495654_0003814_1613_3271	514
36	3300050493	nmdc:mga0k408_11603_c1	nmdc:mga0k408_11603_c1_132_1709	515
37	3300048903	Ga0496100_0048240	Ga0496100_0048240_1101_2687	516
38	3300003775	Ga0055524_1015694	Ga0055524_10156941	517
39	3300025299	Ga0209256_1001148	Ga0209256_100114823	517
40	3300053161	Ga0500634_0005260	Ga0500634_0005260_2016_3638	518
41	3300046500	Ga0495596_0045061	Ga0495596_0045061_121_1716	519
42	3300049571	Ga0501034_0000106	Ga0501034_0000106_37258_38913	521
43	3300046452	Ga0495617_002778	Ga0495617_002778_4760_6412	522
44	3300046474	Ga0495605_0002073	Ga0495605_0002073_8710_10362	522
45	3300046501	Ga0495607_0070116	Ga0495607_0070116_197_1849	522
46	3300046506	Ga0495583_0000805	Ga0495583_0000805_11889_13541	522
47	3300046524	Ga0495648_0005450	Ga0495648_0005450_1309_2961	522
48	3300046530	Ga0495654_0002604	Ga0495654_0002604_3141_4793	522
49	3300046660	Ga0495625_0004514	Ga0495625_0004514_2786_4438	522
50	3300046691	Ga0495670_0000107	Ga0495670_0000107_26425_28077	522
51	3300047320	Ga0495672_0000443	Ga0495672_0000443_9840_11492	522
52	3300047443	Ga0495687_000159	Ga0495687_000159_73717_75369	522
53	3300047469	Ga0495673_0007250	Ga0495673_0007250_613_2265	522
54	3300049460	Ga0495682_0000202	Ga0495682_0000202_8785_10437	522
55	3300005468	Ga0070707_100011109	Ga0070707_1000111097	523
56	3300005471	Ga0070698_100051917	Ga0070698_1000519171	523
57	3300005518	Ga0070699_100030058	Ga0070699_1000300581	523
58	3300046472	Ga0495580_0011047	Ga0495580_0011047_1004_2692	523
59	3300046499	Ga0495594_0002731	Ga0495594_0002731_1700_3388	523
60	3300046526	Ga0495666_0001709	Ga0495666_0001709_6669_8357	523
61	3300046531	Ga0495665_0002813	Ga0495665_0002813_80_1768	523
62	3300047317	Ga0495604_0092137	Ga0495604_0092137_15_1703	523
63	3300025972	Ga0207668_10023058	Ga0207668_100230582	524
64	3300003791	Ga0055530_10000165	Ga0055530_1000016510	527
65	3300003792	Ga0055540_1000186	Ga0055540_100018610	527
66	3300025292	Ga0209676_1005576	Ga0209676_10055764	527
67	3300025298	Ga0209050_1000037	Ga0209050_1000037214	527
68	3300025303	Ga0209051_1000040	Ga0209051_1000040215	527
69	3300025304	Ga0209257_1002314	Ga0209257_100231410	527
70	3300046557	Ga0495622_0005580	Ga0495622_0005580_2227_3879	527
71	3300046558	Ga0495633_0014566	Ga0495633_0014566_2384_4036	527
72	3300047320	Ga0495672_0000507	Ga0495672_0000507_6249_7901	527
73	3300006058	Ga0075432_10000324	Ga0075432_100003243	528
74	3300027907	Ga0207428_10013429	Ga0207428_100134293	528
75	3300005341	Ga0070691_10033276	Ga0070691_100332762	529
76	3300005983	Ga0081540_1000012	Ga0081540_100001265	529
77	3300006847	Ga0075431_100001585	Ga0075431_1000015855	530
78	3300031456	Ga0307513_10004128	Ga0307513_100041284	531
79	3300042137	Ga0450902_000008	Ga0450902_000008_13476_15134	531
80	3300046491	Ga0495584_0037597	Ga0495584_0037597_556_2214	531
81	3300047319	Ga0495674_0010007	Ga0495674_0010007_3951_5600	531
82	3300002459	JGI24751J29686_10001377	JGI24751J29686_100013772	533
83	3300031247	Ga0265340_10023163	Ga0265340_100231632	533
84	3300047317	Ga0495604_0012301	Ga0495604_0012301_385_2028	534
85	iso_pu_bacteria	2508501125	2509132118	534
86	iso_pu_bacteria	2511231002	2511246963	534
87	iso_pu_bacteria	2513237165	2514040431	534
88	iso_pu_bacteria	2548876994	2550695954	534
89	iso_pu_bacteria	2599185240	2599745035	534
90	iso_pu_bacteria	2599185355	2600206784	534
91	iso_pu_bacteria	2643221645	2644252576	534
92	iso_pu_bacteria	2675903129	2676743237	534
93	iso_pu_bacteria	2738541280	2738741314	534
94	iso_pu_bacteria	2738541296	2738820544	534
95	iso_pu_bacteria	2738541298	2738833024	534
96	iso_pu_bacteria	2738541306	2738874551	534
97	iso_pu_bacteria	2738543002	2739186181	534
98	iso_pu_bacteria	2738543008	2739221149	534
99	iso_pu_bacteria	2808606386	2808981100	534
100	iso_pu_bacteria	2808606415	2809128320	534
101	iso_pu_bacteria	2808606419	2809147941	534
102	iso_pu_bacteria	2818991450	2819621192	534
103	iso_pu_bacteria	2852618963	2852620646	534
104	iso_pu_bacteria	2884811622	2884815902	534
105	iso_pu_bacteria	2884836552	2884838710	534
106	iso_pu_bacteria	2884852848	2884855002	534
107	iso_pu_bacteria	2896154374	2896156330	534
108	iso_pu_bacteria	2904615490	2904623155	534
109	iso_pu_bacteria	2928108538	2928109292	534
110	iso_pu_bacteria	2928135762	2928136514	534
111	iso_pu_bacteria	2928157003	2928163532	534
112	iso_pu_bacteria	2928163908	2928166581	534
113	iso_pu_bacteria	2928503688	2928503706	534
114	iso_pu_bacteria	2945934425	2945938675	534
115	iso_pu_bacteria	2981990288	2981996572	534
116	iso_pu_bacteria	2990703756	2990708674	534
117	iso_pu_bacteria	641736151	642426408	534
118	iso_pu_bacteria	641736154	642414437	534
119	iso_pu_bacteria	642555112	642596651	534
120	iso_pu_bacteria	8003400568	8003402525	534
121	iso_pu_bacteria	8020938398	8020941476	534
122	iso_pu_bacteria	8020953355	8020955442	534
123	3300037418	Ga0395900_0172735	Ga0395900_0172735_530_2173	535
124	iso_pu_bacteria	2945945610	2945950034	535
125	iso_pu_bacteria	2511231022	2511365165	536
126	iso_pu_bacteria	2513020051	2513230723	536
127	iso_pu_bacteria	2599185212	2599614655	536
128	iso_pu_bacteria	2599185289	2599884432	536
129	iso_pu_bacteria	2599185291	2599896389	536
130	iso_pu_bacteria	2599185315	2600015998	536
131	iso_pu_bacteria	2599185321	2600051204	536
132	iso_pu_bacteria	2599185322	2600059533	536
133	iso_pu_bacteria	2643221628	2644160123	536
134	iso_pu_bacteria	2643221633	2644186612	536
135	iso_pu_bacteria	2643221658	2644328247	536
136	iso_pu_bacteria	2643221672	2644400110	536
137	iso_pu_bacteria	2643221683	2644465274	536
138	iso_pu_bacteria	2667528170	2671089084	536
139	iso_pu_bacteria	2738543004	2739199641	536
140	iso_pu_bacteria	2808606361	2808858661	536
141	iso_pu_bacteria	2808606376	2808925571	536
142	iso_pu_bacteria	2808606378	2808937991	536
143	iso_pu_bacteria	2808606380	2808947745	536
144	iso_pu_bacteria	2808606383	2808967166	536
145	iso_pu_bacteria	2808606389	2809001976	536
146	iso_pu_bacteria	2842677519	2842677705	536
147	iso_pu_bacteria	2842854478	2842855191	536
148	iso_pu_bacteria	2885192300	2885195084	536
149	iso_pu_bacteria	2901300506	2901307421	536
150	iso_pu_bacteria	2904449895	2904455921	536
151	iso_pu_bacteria	2904456579	2904461682	536
152	iso_pu_bacteria	2919462493	2919467043	536
153	iso_pu_bacteria	2929520902	2929523093	536
154	iso_pu_bacteria	2945909444	2945911363	536
155	iso_pu_bacteria	2945972063	2945972243	536
156	iso_pu_bacteria	2945984333	2945986349	536
157	iso_pu_bacteria	2974320154	2974320387	536
158	iso_pu_bacteria	8056143049	8056146683	536
159	3300041411	Ga0439466_0000532	Ga0439466_0000532_1994_3637	537
160	3300047469	Ga0495673_0000015	Ga0495673_0000015_468142_469791	537
161	3300047470	Ga0495681_0000838	Ga0495681_0000838_9487_11130	537
162	3300001979	JGI24740J21852_10002078	JGI24740J21852_100020783	538
163	3300001989	JGI24739J22299_10015870	JGI24739J22299_100158702	538
164	3300001989	JGI24739J22299_10015892	JGI24739J22299_100158922	538
165	3300002075	JGI24738J21930_10003768	JGI24738J21930_100037682	538
166	3300005339	Ga0070660_100000057	Ga0070660_10000005755	538
167	3300005366	Ga0070659_100000097	Ga0070659_10000009755	538
168	3300005455	Ga0070663_100021610	Ga0070663_1000216103	538
169	3300005616	Ga0068852_100003155	Ga0068852_1000031559	538
170	3300009011	Ga0105251_10000029	Ga0105251_1000002919	538
171	3300009093	Ga0105240_10004687	Ga0105240_1000468716	538
172	3300009545	Ga0105237_10004028	Ga0105237_1000402814	538
173	3300009545	Ga0105237_10074193	Ga0105237_100741932	538
174	3300009551	Ga0105238_10097613	Ga0105238_100976132	538
175	3300013104	Ga0157370_10066498	Ga0157370_100664981	538
176	3300015262	Ga0182007_10004049	Ga0182007_100040494	538
177	3300025735	Ga0207713_1000112	Ga0207713_1000112102	538
178	3300025904	Ga0207647_10014916	Ga0207647_100149166	538
179	3300025904	Ga0207647_10024205	Ga0207647_100242052	538
180	3300025919	Ga0207657_10000118	Ga0207657_1000011815	538
181	3300025932	Ga0207690_10000025	Ga0207690_1000002553	538
182	3300026067	Ga0207678_10000409	Ga0207678_1000040925	538
183	3300026142	Ga0207698_10082982	Ga0207698_100829822	538
184	3300031911	Ga0307412_10000002	Ga0307412_10000002250	538
185	3300037312	Ga0395899_0000005	Ga0395899_0000005_524494_526164	538
186	3300037418	Ga0395900_0000003	Ga0395900_0000003_246803_248473	538
187	3300037466	Ga0395898_0000003	Ga0395898_0000003_524514_526184	538
188	3300037471	Ga0395905_0004495	Ga0395905_0004495_5473_7143	538
189	3300037471	Ga0395905_0031046	Ga0395905_0031046_2678_4336	538
190	3300038443	Ga0395901_0000055	Ga0395901_0000055_94037_95707	538
191	3300046455	Ga0495603_0004175	Ga0495603_0004175_2738_4408	538
192	3300046455	Ga0495603_0022410	Ga0495603_0022410_262_1932	538
193	3300046457	Ga0495590_0002317	Ga0495590_0002317_4171_5841	538
194	3300046459	Ga0495629_0000235	Ga0495629_0000235_9028_10698	538
195	3300046459	Ga0495629_0001133	Ga0495629_0001133_14840_16495	538
196	3300046459	Ga0495629_0112683	Ga0495629_0112683_66_1736	538
197	3300046463	Ga0495653_0000627	Ga0495653_0000627_16137_17807	538
198	3300046463	Ga0495653_0003966	Ga0495653_0003966_2544_4214	538
199	3300046463	Ga0495653_0004762	Ga0495653_0004762_4793_6448	538
200	3300046472	Ga0495580_0005556	Ga0495580_0005556_5230_6900	538
201	3300046472	Ga0495580_0008556	Ga0495580_0008556_2340_4010	538
202	3300046472	Ga0495580_0029319	Ga0495580_0029319_1887_3542	538
203	3300046472	Ga0495580_0034436	Ga0495580_0034436_1328_2998	538
204	3300046474	Ga0495605_0004952	Ga0495605_0004952_5630_7300	538
205	3300046474	Ga0495605_0005213	Ga0495605_0005213_1420_3090	538
206	3300046474	Ga0495605_0008319	Ga0495605_0008319_3181_4851	538
207	3300046477	Ga0495664_0000252	Ga0495664_0000252_19294_20964	538
208	3300046500	Ga0495596_0026995	Ga0495596_0026995_484_2154	538
209	3300046506	Ga0495583_0009937	Ga0495583_0009937_1654_3324	538
210	3300046506	Ga0495583_0038308	Ga0495583_0038308_165_1835	538
211	3300046512	Ga0495610_0040038	Ga0495610_0040038_365_2035	538
212	3300046516	Ga0495628_0005523	Ga0495628_0005523_2218_3888	538
213	3300046517	Ga0495630_0045482	Ga0495630_0045482_170_1840	538
214	3300046524	Ga0495648_0009953	Ga0495648_0009953_1036_2691	538
215	3300046524	Ga0495648_0029040	Ga0495648_0029040_524_2194	538
216	3300046531	Ga0495665_0000205	Ga0495665_0000205_7879_9549	538
217	3300046531	Ga0495665_0050859	Ga0495665_0050859_534_2186	538
218	3300046663	Ga0495635_0005280	Ga0495635_0005280_235_1905	538
219	3300046665	Ga0495661_0023297	Ga0495661_0023297_1239_2909	538
220	3300046679	Ga0495623_0002428	Ga0495623_0002428_6339_8009	538
221	3300046690	Ga0495624_0000868	Ga0495624_0000868_14174_15844	538
222	3300046690	Ga0495624_0001065	Ga0495624_0001065_5140_6795	538
223	3300046690	Ga0495624_0001651	Ga0495624_0001651_9028_10698	538
224	3300046692	Ga0495671_0003162	Ga0495671_0003162_6434_8104	538
225	3300046692	Ga0495671_0059679	Ga0495671_0059679_147_1817	538
226	3300046694	Ga0495649_0010313	Ga0495649_0010313_2777_4447	538
227	3300047317	Ga0495604_0008520	Ga0495604_0008520_3466_5136	538
228	3300047319	Ga0495674_0000616	Ga0495674_0000616_8962_10632	538
229	3300047319	Ga0495674_0002864	Ga0495674_0002864_5942_7612	538
230	3300047320	Ga0495672_0016598	Ga0495672_0016598_2077_3747	538
231	3300047321	Ga0495676_0123762	Ga0495676_0123762_37_1692	538
232	3300047322	Ga0495680_0008823	Ga0495680_0008823_115_1785	538
233	3300047323	Ga0495683_0000949	Ga0495683_0000949_3887_5557	538
234	3300047443	Ga0495687_016727	Ga0495687_016727_28_1698	538
235	3300047446	Ga0495679_000183	Ga0495679_000183_38107_39777	538
236	3300047469	Ga0495673_0004139	Ga0495673_0004139_3216_4886	538
237	3300047673	Ga0495593_0000051	Ga0495593_0000051_38459_40129	538
238	3300047673	Ga0495593_0000564	Ga0495593_0000564_4580_6235	538
239	3300047673	Ga0495593_0001352	Ga0495593_0001352_6598_8268	538
240	3300048088	Ga0495602_0000105	Ga0495602_0000105_7357_9027	538
241	3300048091	Ga0495626_0022876	Ga0495626_0022876_25_1695	538
242	3300048903	Ga0496100_0007150	Ga0496100_0007150_390_2060	538
243	3300048904	Ga0496101_0047564	Ga0496101_0047564_431_2101	538
244	3300048905	Ga0496102_0201693	Ga0496102_0201693_152_1822	538
245	3300048907	Ga0496104_0031261	Ga0496104_0031261_112_1782	538
246	3300048913	Ga0496110_0182053	Ga0496110_0182053_141_1811	538
247	3300048919	Ga0496116_0016164	Ga0496116_0016164_202_1872	538
248	3300048920	Ga0496117_0016852	Ga0496117_0016852_3209_4879	538
249	3300048920	Ga0496117_0053965	Ga0496117_0053965_178_1848	538
250	3300048921	Ga0496118_0002433	Ga0496118_0002433_9414_11084	538
251	3300048921	Ga0496118_0014372	Ga0496118_0014372_56_1726	538
252	3300048921	Ga0496118_0014897	Ga0496118_0014897_164_1834	538
253	3300048921	Ga0496118_0029614	Ga0496118_0029614_2732_4402	538
254	3300048924	Ga0496121_0003972	Ga0496121_0003972_11161_12831	538
255	3300048924	Ga0496121_0037767	Ga0496121_0037767_148_1818	538
256	3300048927	Ga0496124_0015512	Ga0496124_0015512_5614_7284	538
257	3300048928	Ga0496125_0005016	Ga0496125_0005016_11087_12757	538
258	3300048928	Ga0496125_0066976	Ga0496125_0066976_502_2172	538
259	3300049459	Ga0495678_003490	Ga0495678_003490_3364_5034	538
260	iso_pu_bacteria	8055266321	8055270902	538
261	3300025291	Ga0209675_1002159	Ga0209675_10021593	539
262	3300037471	Ga0395905_0014934	Ga0395905_0014934_4761_6416	539
263	3300046674	Ga0495588_0009901	Ga0495588_0009901_1587_3245	539
264	3300046683	Ga0495658_0003299	Ga0495658_0003299_4307_5965	539
265	3300047321	Ga0495676_0014139	Ga0495676_0014139_3450_5108	539
266	3300047673	Ga0495593_0011892	Ga0495593_0011892_2942_4600	539
267	3300048089	Ga0495614_0004544	Ga0495614_0004544_2039_3697	539
268	3300048919	Ga0496116_0007049	Ga0496116_0007049_500_2158	539
269	3300053079	Ga0500610_0000091	Ga0500610_0000091_1875_3560	539
270	3300053087	Ga0500643_007027	Ga0500643_007027_703_2361	539
271	3300053093	Ga0500651_0000038	Ga0500651_0000038_67273_68931	539
272	3300053094	Ga0500566_0008492	Ga0500566_0008492_849_2507	539
273	3300053110	Ga0500571_000091	Ga0500571_000091_25233_26891	539
274	3300053120	Ga0500597_001054	Ga0500597_001054_3682_5340	539
275	3300053133	Ga0500655_004222	Ga0500655_004222_32_1690	539
276	3300053134	Ga0500658_0004761	Ga0500658_0004761_1245_2903	539
277	3300053141	Ga0500574_000613	Ga0500574_000613_2154_3812	539
278	3300053162	Ga0500638_000631	Ga0500638_000631_572_2230	539
279	3300053177	Ga0500636_0026441	Ga0500636_0026441_1261_2919	539
280	2124908027	MRS2a_Contig_279	MRS2a_00179410	540
281	3300001989	JGI24739J22299_10015148	JGI24739J22299_100151481	540
282	3300003773	Ga0055537_1000010	Ga0055537_100001016	540
283	3300003781	Ga0055536_1000496	Ga0055536_100049617	540
284	3300003784	Ga0055534_1000015	Ga0055534_1000015114	540
285	3300003790	Ga0055528_1000908	Ga0055528_10009086	540
286	3300003791	Ga0055530_10004125	Ga0055530_100041255	540
287	3300003792	Ga0055540_1000142	Ga0055540_100014244	540
288	3300003794	Ga0055531_10000424	Ga0055531_100004247	540
289	3300005288	Ga0065714_10003364	Ga0065714_100033647	540
290	3300005288	Ga0065714_10004687	Ga0065714_100046874	540
291	3300005334	Ga0068869_100128015	Ga0068869_1001280151	540
292	3300005338	Ga0068868_100018748	Ga0068868_1000187482	540
293	3300005353	Ga0070669_100036597	Ga0070669_1000365972	540
294	3300005356	Ga0070674_100063155	Ga0070674_1000631552	540
295	3300005367	Ga0070667_100005568	Ga0070667_1000055688	540
296	3300005459	Ga0068867_100005410	Ga0068867_1000054106	540
297	3300005617	Ga0068859_100023623	Ga0068859_1000236233	540
298	3300005841	Ga0068863_100070037	Ga0068863_1000700373	540
299	3300006048	Ga0075363_100027457	Ga0075363_1000274573	540
300	3300006058	Ga0075432_10015014	Ga0075432_100150143	540
301	3300006058	Ga0075432_10021049	Ga0075432_100210492	540
302	3300006177	Ga0075362_10002885	Ga0075362_100028853	540
303	3300006177	Ga0075362_10004800	Ga0075362_100048004	540
304	3300006177	Ga0075362_10021514	Ga0075362_100215142	540
305	3300006177	Ga0075362_10048524	Ga0075362_100485241	540
306	3300006186	Ga0075369_10014537	Ga0075369_100145373	540
307	3300006353	Ga0075370_10000369	Ga0075370_1000036919	540
308	3300006931	Ga0097620_100023623	Ga0097620_1000236233	540
309	3300006946	Ga0079104_1015227	Ga0079104_10152272	540
310	3300006948	Ga0099826_10003210	Ga0099826_100032102	540
311	3300009036	Ga0105244_10010883	Ga0105244_100108833	540
312	3300009092	Ga0105250_10030261	Ga0105250_100302611	540
313	3300009148	Ga0105243_10000604	Ga0105243_1000060420	540
314	3300009148	Ga0105243_10013471	Ga0105243_100134714	540
315	3300009177	Ga0105248_10054862	Ga0105248_100548622	540
316	3300009545	Ga0105237_10008715	Ga0105237_100087153	540
317	3300009553	Ga0105249_10118897	Ga0105249_101188972	540
318	3300010375	Ga0105239_10181559	Ga0105239_101815592	540
319	3300011119	Ga0105246_10001560	Ga0105246_1000156014	540
320	3300011119	Ga0105246_10046545	Ga0105246_100465453	540
321	3300013100	Ga0157373_10000665	Ga0157373_100006656	540
322	3300013100	Ga0157373_10000941	Ga0157373_1000094121	540
323	3300013102	Ga0157371_10017628	Ga0157371_100176283	540
324	3300013308	Ga0157375_10021779	Ga0157375_100217793	540
325	3300013308	Ga0157375_10054361	Ga0157375_100543613	540
326	3300017792	Ga0163161_10012160	Ga0163161_100121604	540
327	3300017792	Ga0163161_10014172	Ga0163161_100141721	540
328	3300017792	Ga0163161_10027508	Ga0163161_100275082	540
329	3300025256	Ga0209759_1001698	Ga0209759_10016987	540
330	3300025263	Ga0209565_1000025	Ga0209565_100002580	540
331	3300025273	Ga0209673_1000149	Ga0209673_100014967	540
332	3300025273	Ga0209673_1001197	Ga0209673_10011977	540
333	3300025291	Ga0209675_1000017	Ga0209675_1000017294	540
334	3300025292	Ga0209676_1000152	Ga0209676_1000152124	540
335	3300025292	Ga0209676_1004034	Ga0209676_10040349	540
336	3300025298	Ga0209050_1000210	Ga0209050_100021042	540
337	3300025303	Ga0209051_1000074	Ga0209051_100007441	540
338	3300025303	Ga0209051_1000302	Ga0209051_100030264	540
339	3300025303	Ga0209051_1005550	Ga0209051_10055503	540
340	3300025304	Ga0209257_1000072	Ga0209257_100007242	540
341	3300025711	Ga0207696_1014498	Ga0207696_10144982	540
342	3300025728	Ga0207655_1010066	Ga0207655_10100665	540
343	3300025728	Ga0207655_1019077	Ga0207655_10190772	540
344	3300025903	Ga0207680_10034856	Ga0207680_100348562	540
345	3300025927	Ga0207687_10035035	Ga0207687_100350352	540
346	3300025933	Ga0207706_10014947	Ga0207706_100149473	540
347	3300025935	Ga0207709_10000411	Ga0207709_1000041120	540
348	3300025942	Ga0207689_10027801	Ga0207689_100278013	540
349	3300025961	Ga0207712_10049557	Ga0207712_100495572	540
350	3300025986	Ga0207658_10003430	Ga0207658_100034303	540
351	3300026067	Ga0207678_10091826	Ga0207678_100918262	540
352	3300026089	Ga0207648_10036370	Ga0207648_100363703	540
353	3300027666	Ga0209282_1000340	Ga0209282_100034012	540
354	3300027907	Ga0207428_10094348	Ga0207428_100943482	540
355	3300028380	Ga0268265_10169051	Ga0268265_101690511	540
356	3300028381	Ga0268264_10040209	Ga0268264_100402093	540
357	3300030731	Ga0316177_1007315	Ga0316177_10073152	540
358	3300030733	Ga0314311_1093467	Ga0314311_109346718	540
359	3300030742	Ga0316183_1057192	Ga0316183_10571928	540
360	3300031548	Ga0307408_100000206	Ga0307408_10000020626	540
361	3300031548	Ga0307408_100027008	Ga0307408_1000270083	540
362	3300031616	Ga0307508_10023985	Ga0307508_100239855	540
363	3300031731	Ga0307405_10017224	Ga0307405_100172242	540
364	3300031731	Ga0307405_10040987	Ga0307405_100409872	540
365	3300031824	Ga0307413_10054039	Ga0307413_100540391	540
366	3300031901	Ga0307406_10000450	Ga0307406_100004506	540
367	3300031903	Ga0307407_10072537	Ga0307407_100725371	540
368	3300031911	Ga0307412_10001734	Ga0307412_100017348	540
369	3300032002	Ga0307416_100104299	Ga0307416_1001042992	540
370	3300041411	Ga0439466_0002660	Ga0439466_0002660_3745_5397	540
371	3300041997	Ga0439431_0004711	Ga0439431_0004711_678_2330	540
372	3300041999	Ga0439433_0003095	Ga0439433_0003095_382_2064	540
373	3300042006	Ga0439432_000961	Ga0439432_000961_2195_3847	540
374	3300042006	Ga0439432_002431	Ga0439432_002431_1608_3260	540
375	3300042125	Ga0450923_000327	Ga0450923_000327_396_2078	540
376	3300042127	Ga0450890_000917	Ga0450890_000917_496_2148	540
377	3300042145	Ga0450906_005301	Ga0450906_005301_91_1773	540
378	3300042146	Ga0450907_000904	Ga0450907_000904_3844_5496	540
379	3300044684	Ga0466966_0047281	Ga0466966_0047281_772_2478	540
380	3300046452	Ga0495617_000553	Ga0495617_000553_5518_7221	540
381	3300046455	Ga0495603_0000009	Ga0495603_0000009_14059_15711	540
382	3300046460	Ga0495638_0015634	Ga0495638_0015634_1743_3395	540
383	3300046460	Ga0495638_0031655	Ga0495638_0031655_1188_2840	540
384	3300046474	Ga0495605_0000889	Ga0495605_0000889_5376_7079	540
385	3300046491	Ga0495584_0000213	Ga0495584_0000213_5070_6773	540
386	3300046492	Ga0495585_0002452	Ga0495585_0002452_6428_8131	540
387	3300046492	Ga0495585_0011323	Ga0495585_0011323_2086_3738	540
388	3300046501	Ga0495607_0003184	Ga0495607_0003184_5378_7081	540
389	3300046501	Ga0495607_0008673	Ga0495607_0008673_1150_2853	540
390	3300046501	Ga0495607_0013805	Ga0495607_0013805_1702_3411	540
391	3300046506	Ga0495583_0003411	Ga0495583_0003411_4820_6523	540
392	3300046506	Ga0495583_0007121	Ga0495583_0007121_3993_5702	540
393	3300046512	Ga0495610_0009495	Ga0495610_0009495_302_1954	540
394	3300046513	Ga0495616_0001101	Ga0495616_0001101_11866_13569	540
395	3300046513	Ga0495616_0029058	Ga0495616_0029058_17_1669	540
396	3300046518	Ga0495631_0000007	Ga0495631_0000007_70176_71828	540
397	3300046519	Ga0495632_0000406	Ga0495632_0000406_8835_10544	540
398	3300046520	Ga0495637_0019240	Ga0495637_0019240_1433_3085	540
399	3300046522	Ga0495643_0000141	Ga0495643_0000141_23675_25384	540
400	3300046523	Ga0495644_0000141	Ga0495644_0000141_18818_20521	540
401	3300046524	Ga0495648_0002752	Ga0495648_0002752_9527_11230	540
402	3300046524	Ga0495648_0007995	Ga0495648_0007995_2116_3768	540
403	3300046528	Ga0495642_0000036	Ga0495642_0000036_19484_21136	540
404	3300046538	Ga0495609_0000310	Ga0495609_0000310_16956_18608	540
405	3300046538	Ga0495609_0001830	Ga0495609_0001830_4820_6523	540
406	3300046538	Ga0495609_0002674	Ga0495609_0002674_1856_3565	540
407	3300046538	Ga0495609_0013607	Ga0495609_0013607_635_2287	540
408	3300046615	Ga0495656_0006187	Ga0495656_0006187_905_2608	540
409	3300046648	Ga0495611_0000611	Ga0495611_0000611_4820_6523	540
410	3300046660	Ga0495625_0000056	Ga0495625_0000056_108733_110385	540
411	3300046660	Ga0495625_0006100	Ga0495625_0006100_2491_4194	540
412	3300046660	Ga0495625_0020458	Ga0495625_0020458_2978_4630	540
413	3300046664	Ga0495659_0000348	Ga0495659_0000348_5879_7582	540
414	3300046664	Ga0495659_0000356	Ga0495659_0000356_5088_6740	540
415	3300046664	Ga0495659_0001849	Ga0495659_0001849_806_2515	540
416	3300046665	Ga0495661_0007489	Ga0495661_0007489_364_2073	540
417	3300046665	Ga0495661_0011439	Ga0495661_0011439_3581_5284	540
418	3300046674	Ga0495588_0022146	Ga0495588_0022146_654_2306	540
419	3300046684	Ga0495669_0001326	Ga0495669_0001326_5259_6968	540
420	3300046691	Ga0495670_0000322	Ga0495670_0000322_5908_7611	540
421	3300046691	Ga0495670_0005304	Ga0495670_0005304_3582_5234	540
422	3300046692	Ga0495671_0001185	Ga0495671_0001185_5381_7084	540
423	3300046692	Ga0495671_0002137	Ga0495671_0002137_2283_3953	540
424	3300046694	Ga0495649_0005109	Ga0495649_0005109_3654_5363	540
425	3300046794	Ga0495589_0004803	Ga0495589_0004803_4073_5725	540
426	3300046810	Ga0495660_0001291	Ga0495660_0001291_1232_2884	540
427	3300046810	Ga0495660_0004375	Ga0495660_0004375_661_2370	540
428	3300047318	Ga0495636_0000859	Ga0495636_0000859_3586_5289	540
429	3300047320	Ga0495672_0000116	Ga0495672_0000116_116055_117764	540
430	3300047320	Ga0495672_0000835	Ga0495672_0000835_5619_7322	540
431	3300047320	Ga0495672_0003525	Ga0495672_0003525_6041_7744	540
432	3300047320	Ga0495672_0010317	Ga0495672_0010317_4146_5798	540
433	3300047323	Ga0495683_0001063	Ga0495683_0001063_10814_12466	540
434	3300047323	Ga0495683_0001956	Ga0495683_0001956_5618_7321	540
435	3300047443	Ga0495687_000050	Ga0495687_000050_120984_122636	540
436	3300047443	Ga0495687_000160	Ga0495687_000160_73908_75560	540
437	3300047443	Ga0495687_000173	Ga0495687_000173_88041_89744	540
438	3300047445	Ga0495677_0000681	Ga0495677_0000681_3747_5450	540
439	3300047446	Ga0495679_015311	Ga0495679_015311_610_2262	540
440	3300047447	Ga0495685_000124	Ga0495685_000124_5245_6948	540
441	3300047469	Ga0495673_0002000	Ga0495673_0002000_7713_9416	540
442	3300047469	Ga0495673_0003069	Ga0495673_0003069_1962_3614	540
443	3300047470	Ga0495681_0001873	Ga0495681_0001873_11528_13180	540
444	3300047470	Ga0495681_0026926	Ga0495681_0026926_92_1801	540
445	3300048091	Ga0495626_0009362	Ga0495626_0009362_1513_3165	540
446	3300048905	Ga0496102_0058525	Ga0496102_0058525_1536_3245	540
447	3300048909	Ga0496106_0152562	Ga0496106_0152562_49_1758	540
448	3300048920	Ga0496117_0004567	Ga0496117_0004567_4073_5740	540
449	3300048921	Ga0496118_0002082	Ga0496118_0002082_8280_9947	540
450	3300048924	Ga0496121_0006629	Ga0496121_0006629_11879_13531	540
451	3300049459	Ga0495678_002624	Ga0495678_002624_5585_7288	540
452	3300049460	Ga0495682_0001271	Ga0495682_0001271_6694_8346	540
453	3300049460	Ga0495682_0001369	Ga0495682_0001369_7723_9426	540
454	3300049460	Ga0495682_0008951	Ga0495682_0008951_49_1701	540
455	3300049665	Ga0501227_002945	Ga0501227_002945_1801_3453	540
456	3300049679	Ga0501249_002550	Ga0501249_002550_1037_2692	540
457	3300049705	Ga0501225_0001936	Ga0501225_0001936_1140_2795	540
458	3300049759	Ga0501262_000018	Ga0501262_000018_14346_16001	540
459	3300049853	Ga0501226_000161	Ga0501226_000161_5504_7156	540
460	3300050489	nmdc:mga03683_10865_c1	nmdc:mga03683_10865_c1_748_2400	540
461	3300050489	nmdc:mga03683_11850_c1	nmdc:mga03683_11850_c1_342_1994	540
462	3300050489	nmdc:mga03683_997_c2	nmdc:mga03683_997_c2_1663_3315	540
463	3300050490	nmdc:mga03n38_6432_c1	nmdc:mga03n38_6432_c1_320_1972	540
464	3300050493	nmdc:mga0k408_28581_c1	nmdc:mga0k408_28581_c1_307_1977	540
465	3300050496	nmdc:mga07m45_286_c1	nmdc:mga07m45_286_c1_18155_19807	540
466	3300050516	nmdc:mga0sz30_3117_c1	nmdc:mga0sz30_3117_c1_1874_3526	540
467	3300053079	Ga0500610_0000460	Ga0500610_0000460_4966_6618	540
468	3300053117	Ga0500593_000115	Ga0500593_000115_5452_7122	540
469	3300053118	Ga0500594_0001341	Ga0500594_0001341_3638_5290	540
470	3300053134	Ga0500658_0000732	Ga0500658_0000732_9188_10840	540
471	iso_pu_bacteria	2547132374	2548498717	540
472	iso_pu_bacteria	2643221609	2644062090	540
473	iso_pu_bacteria	2643221611	2644070380	540
474	iso_pu_bacteria	2643221717	2644649448	540
475	iso_pu_bacteria	2738543012	2739243962	540
476	iso_pu_bacteria	2816332133	2816472795	540

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

478

553

0.95 PF00501

AMP-binding

AMP-binding enzyme

50

428

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1v26-assembly1.cif.gz_A	crystal structure of tt0168 from thermus thermophilus hb8	0.8783	10	526
1v26-assembly1.cif.gz_B	crystal structure of tt0168 from thermus thermophilus hb8	0.8749	10	530
1v26-assembly1.cif.gz_B	crystal structure of tt0168 from thermus thermophilus hb8	0.8683	10	530
3ivr-assembly1.cif.gz_B	crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009	0.8679	21	426
1v25-assembly1.cif.gz_B	crystal structure of tt0168 from thermus thermophilus hb8	0.8665	10	530

ID	Description	Score	Start	End	Superfamily
af_Q9LQS1_441_544_3.30.300.30	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain	0.9893	429	527	3.30.300.30
af_K7VHQ0_441_545_3.30.300.30	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain	0.9558	429	527	3.30.300.30
5buqA02	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain	0.9542	429	509	3.30.300.30
af_A0A1D6KNL0_124_190_3.30.300.30	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain	0.952	433	495	3.30.300.30
af_I1JAL4_4_443_3.40.50.12780	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain	0.9511	10	428	3.40.50.12780

ID	Description	Score	Start	End	GO Terms
AF-A0A1F4E6F9-F1-model_v4	Acyl-CoA synthetase	0.9358	6	399	GO:0016874
AF-A0A0V0GIL0-F1-model_v4	Putative ovule protein	0.932	425	529	GO:0016874
AF-A0A3C0C8A4-F1-model_v4	AMP-binding enzyme C-terminal domain-containing protein	0.9204	439	523	GO:0016878 GO:0044550
AF-A0A1F4E6F9-F1-model_v4	Acyl-CoA synthetase	0.8917	6	399	GO:0016874
AF-A0A7N0TP75-F1-model_v4	AMP-dependent synthetase/ligase domain-containing protein	0.8878	8	208	GO:0016874

Feature Viewer

pLDDT	pTM	Quality
81.11	0.81	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F451623

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

478

553

0.95

PF00501

AMP-binding

AMP-binding enzyme

50

428

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map