F451569

General Info

Members Datasets Scaffolds Average Seq Length
476 236 436 341

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0000224|Ga0495603_0000224_2850_4007
Length 385
Sequence MALVLIGNARTARGCLPFNVLSELDVGNSQSSFAQVELFPRGQAVFFPVFLSVVFVVRNQARDLDAMLKDAAAVMGTLVSDYELIVVDNASEDDSVSELKQLAGERGLPNLQVYALTKEVDSDTASWVGLENALGDFVAVVDPLIDDIRFLPTMLDKAASGADVVFAANQQKPVQSWAYRACLSAFNALYKWSNGVHLAKDAPQYRLLSKRVINFMLQHPMPAMTYRYLPATGGFARVNLTYSAPPKAAQAKRLSHSIDRGIRLLVSTTKAPMRLVTALSLFGAVSNLIYSVYVIAVGLLKSNVAPGWVTLSLQQSGMFFLISLVLLVLGEYILQMARLSNEGPLYHVAQEFTSSVMTRREKLNIEDVRLPEQHRADVSDSLHSS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2511231020 Pseudomonas sp. GM74 Isolate Nodule
9 2511231022 Pseudomonas sp. GM79 Isolate Nodule
10 2511231023 Pseudomonas sp. GM80 Isolate Nodule
11 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
12 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
13 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
14 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
15 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
16 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
17 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
18 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
19 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
20 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
21 2643221638 Duganella sp. Root336D2 Isolate Unclassified
22 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
23 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
24 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
25 2784132063 Pseudomonas sp. 424 Isolate Unclassified
26 2816332133 Acidovorax radicis 2721A Isolate Unclassified
27 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
28 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
29 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
30 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
31 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
32 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
33 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
34 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
35 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
36 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
37 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
38 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
39 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
40 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
41 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
111 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
115 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
116 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
119 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
222 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 639633007 Azoarcus olearius BH72 Isolate Unclassified
231 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
232 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
233 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
234 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
235 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
236 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0.21
Isolates 8.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 14.92
Nodule 1.26
Rhizoplane 2.52
Rhizosphere 68.28
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_237 2124908027 Bacteria 31415
2 SwRhRL2b_contig_190046 2162886007 Bacteria 3832
3 MRS1b_contig_8356243 2162886011 Bacteria 1416
4 JGI25156J39149_1005558 3300002705 Bacteria 3612
5 JGI25154J39366_1000190 3300002738 Bacteria 45605
6 JGI25158J39367_1000031 3300002739 Bacteria 31699
7 JGI25152J39213_1010825 3300002773 Bacteria 2058
8 JGI25150J39212_1000274 3300002774 Bacteria 27353
9 JGI25159J45721_1000129 3300002987 Bacteria 36238
10 rootH1_10174005 3300003323 Bacteria 3967
11 rootH1_10296988 3300003323 Bacteria 1516
12 JGI25160J50197_1000286 3300003354 Bacteria 36574
13 JGI25161J50226_1000217 3300003374 Bacteria 36238
14 Ga0055533_1000124 3300003756 Bacteria 87900
15 Ga0055526_1000287 3300003771 Bacteria 42257
16 Ga0055526_1000496 3300003771 Bacteria 31280
17 Ga0055526_1002209 3300003771 Bacteria 13339
18 Ga0055526_1005613 3300003771 Bacteria 7143
19 Ga0055537_1000342 3300003773 Bacteria 31899
20 Ga0055537_1000806 3300003773 Bacteria 15544
21 Ga0055537_1005214 3300003773 Bacteria 3528
22 Ga0055537_1006338 3300003773 Bacteria 3019
23 Ga0055524_1001544 3300003775 Bacteria 13025
24 Ga0055524_1002975 3300003775 Bacteria 8432
25 Ga0055524_1009722 3300003775 Bacteria 3886
26 Ga0055536_1000536 3300003781 Bacteria 26048
27 Ga0055534_1000329 3300003784 Bacteria 31280
28 Ga0055534_1000589 3300003784 Bacteria 18935
29 Ga0055530_10000266 3300003791 Bacteria 47362
30 Ga0055530_10000283 3300003791 Bacteria 46150
31 Ga0055540_1000606 3300003792 Bacteria 25717
32 Ga0055543_1000267 3300004625 Bacteria 38844
33 Ga0065165_1000898 3300005262 Bacteria 38426
34 Ga0065714_10002270 3300005288 Bacteria 29515
35 Ga0065714_10002559 3300005288 Bacteria 17358
36 Ga0065714_10005092 3300005288 Bacteria 5306
37 Ga0065714_10066213 3300005288 Bacteria 7350
38 Ga0065704_10070851 3300005289 Bacteria 15396
39 Ga0065704_10095085 3300005289 Bacteria 2506
40 Ga0065712_10068142 3300005290 Bacteria 13939
41 Ga0070669_100030754 3300005353 Bacteria 3875
42 Ga0070711_100287011 3300005439 Bacteria 1304
43 Ga0070694_100024956 3300005444 Bacteria 3863
44 Ga0075364_10000388 3300006051 Bacteria 21839
45 Ga0075364_10018899 3300006051 Bacteria 4321
46 Ga0105251_10000011 3300009011 Bacteria 180176
47 Ga0105251_10000893 3300009011 Bacteria 26707
48 Ga0105251_10001164 3300009011 Bacteria 22818
49 Ga0105251_10004073 3300009011 Bacteria 10255
50 Ga0105251_10018328 3300009011 Bacteria 3725
51 Ga0105244_10000638 3300009036 Bacteria 30900
52 Ga0105244_10090188 3300009036 Bacteria 1508
53 Ga0105250_10000746 3300009092 Bacteria 19826
54 Ga0105250_10008314 3300009092 Bacteria 4416
55 Ga0105246_10000232 3300011119 Bacteria 28535
56 Ga0157373_10000529 3300013100 Bacteria 29839
57 Ga0157373_10000759 3300013100 Bacteria 25031
58 Ga0157373_10038354 3300013100 Bacteria 3434
59 Ga0157373_10124859 3300013100 Bacteria 1810
60 Ga0157373_10226715 3300013100 Bacteria 1319
61 Ga0157371_10001343 3300013102 Bacteria 25909
62 Ga0157371_10002469 3300013102 Bacteria 17608
63 Ga0157371_10005135 3300013102 Bacteria 11162
64 Ga0157371_10011536 3300013102 Bacteria 6795
65 Ga0157370_10003020 3300013104 Bacteria 19973
66 Ga0157370_10003235 3300013104 Bacteria 19221
67 Ga0157370_10011642 3300013104 Bacteria 9183
68 Ga0157370_10017881 3300013104 Bacteria 7141
69 Ga0157369_10048951 3300013105 Bacteria 4584
70 Ga0163162_10000688 3300013306 Bacteria 31284
71 Ga0157375_10010776 3300013308 Bacteria 8053
72 Ga0182008_10000650 3300014497 Bacteria 25384
73 Ga0182008_10001249 3300014497 Bacteria 17458
74 Ga0182008_10009213 3300014497 Bacteria 5337
75 Ga0182006_1006610 3300015261 Bacteria 5369
76 Ga0182007_10000296 3300015262 Bacteria 32264
77 Ga0182007_10000636 3300015262 Bacteria 20375
78 Ga0182005_1000014 3300015265 Bacteria 389763
79 Ga0182005_1000319 3300015265 Bacteria 28646
80 Ga0182005_1000325 3300015265 Bacteria 28280
81 Ga0182005_1000529 3300015265 Bacteria 19383
82 Ga0182005_1000970 3300015265 Bacteria 12455
83 Ga0182005_1007304 3300015265 Bacteria 3321
84 Ga0183361_10022 3300016635 Bacteria 112719
85 Ga0209436_100116 3300025208 Bacteria 39369
86 Ga0209566_102920 3300025225 Bacteria 2866
87 Ga0209674_100005 3300025226 Bacteria 1708125
88 Ga0207427_102292 3300025231 Bacteria 5314
89 Ga0207425_1000050 3300025245 Bacteria 177008
90 Ga0209646_1000075 3300025246 Bacteria 221755
91 Ga0209759_1001109 3300025256 Bacteria 17383
92 Ga0209129_1001335 3300025258 Bacteria 13951
93 Ga0209233_1000016 3300025261 Bacteria 907830
94 Ga0209565_1000296 3300025263 Bacteria 47631
95 Ga0209565_1000348 3300025263 Bacteria 40662
96 Ga0209565_1000367 3300025263 Bacteria 38709
97 Ga0209565_1000379 3300025263 Bacteria 38059
98 Ga0209565_1000421 3300025263 Bacteria 34378
99 Ga0209565_1000439 3300025263 Bacteria 33341
100 Ga0209565_1001005 3300025263 Bacteria 14486
101 Ga0209673_1002992 3300025273 Bacteria 10520
102 Ga0209130_1000518 3300025284 Bacteria 38858
103 Ga0209675_1000268 3300025291 Bacteria 49787
104 Ga0209675_1000418 3300025291 Bacteria 34762
105 Ga0209675_1000861 3300025291 Bacteria 19674
106 Ga0209676_1000255 3300025292 Bacteria 112911
107 Ga0209676_1002912 3300025292 Bacteria 11197
108 Ga0209564_1000063 3300025295 Bacteria 318515
109 Ga0209564_1000908 3300025295 Bacteria 38758
110 Ga0209564_1001027 3300025295 Bacteria 34378
111 Ga0209564_1001062 3300025295 Bacteria 33341
112 Ga0209564_1001288 3300025295 Bacteria 27437
113 Ga0209564_1024870 3300025295 Bacteria 2034
114 Ga0209050_1000271 3300025298 Bacteria 110802
115 Ga0209050_1000420 3300025298 Bacteria 78413
116 Ga0209050_1000904 3300025298 Bacteria 39210
117 Ga0209256_1000227 3300025299 Bacteria 103299
118 Ga0209256_1000638 3300025299 Bacteria 47804
119 Ga0209256_1000757 3300025299 Bacteria 42054
120 Ga0209256_1001485 3300025299 Bacteria 23951
121 Ga0209256_1005349 3300025299 Bacteria 7437
122 Ga0209256_1008277 3300025299 Bacteria 4862
123 Ga0207426_1000506 3300025302 Bacteria 57538
124 Ga0209051_1000250 3300025303 Bacteria 90973
125 Ga0207655_1000857 3300025728 Bacteria 32446
126 Ga0207655_1001579 3300025728 Bacteria 20452
127 Ga0207655_1039833 3300025728 Bacteria 2036
128 Ga0207713_1000073 3300025735 Bacteria 181519
129 Ga0207713_1000614 3300025735 Bacteria 35058
130 Ga0207713_1002635 3300025735 Bacteria 12899
131 Ga0207713_1048650 3300025735 Bacteria 1706
132 Ga0207681_10065901 3300025923 Bacteria 2505
133 Ga0209371_1014634 3300027312 Bacteria 2142
134 Ga0209371_1018514 3300027312 Bacteria 1767
135 Ga0307515_10192988 3300028794 Bacteria 1940
136 Ga0265338_10132433 3300028800 Bacteria 1966
137 Ga0268256_1011860 3300030500 Bacteria 2728
138 Ga0268256_1020706 3300030500 Bacteria 1767
139 Ga0265328_10014887 3300031239 Bacteria 3055
140 Ga0265331_10000024 3300031250 Bacteria 235118
141 Ga0265327_10000079 3300031251 Bacteria 206892
142 Ga0265327_10001446 3300031251 Bacteria 29886
143 Ga0307408_100002453 3300031548 Bacteria 13008
144 Ga0307412_10120654 3300031911 Bacteria 1887
145 Ga0395905_0003906 3300037471 Bacteria 15715
146 Ga0439438_000275 3300041405 Bacteria 23167
147 Ga0439447_000209 3300041407 Bacteria 20602
148 Ga0439466_0001149 3300041411 Bacteria 10290
149 Ga0439432_000099 3300042006 Bacteria 27419
150 Ga0439451_000343 3300042009 Bacteria 9025
151 Ga0439452_001021 3300042010 Bacteria 12401
152 Ga0439456_008307 3300042013 Bacteria 2142
153 Ga0439463_000475 3300042016 Bacteria 11182
154 Ga0439463_002335 3300042016 Bacteria 4840
155 Ga0450911_000103 3300042115 Bacteria 34739
156 Ga0450905_000007 3300042142 Bacteria 28289
157 Ga0439460_0000071 3300042461 Bacteria 15336
158 Ga0453684_0000273 3300044712 Bacteria 222658
159 Ga0495617_000086 3300046452 Bacteria 67731
160 Ga0495617_000200 3300046452 Bacteria 37820
161 Ga0495617_010961 3300046452 Bacteria 3099
162 Ga0495592_0148181 3300046454 Bacteria 1625
163 Ga0495603_0000188 3300046455 Bacteria 32204
164 Ga0495603_0000224 3300046455 Bacteria 29469
165 Ga0495603_0019126 3300046455 Bacteria 4146
166 Ga0495590_0006315 3300046457 Bacteria 4639
167 Ga0495591_000430 3300046458 Bacteria 34469
168 Ga0495591_006900 3300046458 Bacteria 4924
169 Ga0495591_029814 3300046458 Bacteria 1652
170 Ga0495629_0009792 3300046459 Bacteria 6994
171 Ga0495629_0061657 3300046459 Bacteria 2621
172 Ga0495638_0000583 3300046460 Bacteria 41251
173 Ga0495638_0000868 3300046460 Bacteria 31437
174 Ga0495651_0002753 3300046462 Bacteria 13636
175 Ga0495653_0000603 3300046463 Bacteria 27534
176 Ga0495653_0007878 3300046463 Bacteria 8720
177 Ga0495653_0020010 3300046463 Bacteria 5424
178 Ga0495650_0000015 3300046471 Bacteria 557595
179 Ga0495650_0000311 3300046471 Bacteria 87755
180 Ga0495650_0001217 3300046471 Bacteria 26985
181 Ga0495580_0003355 3300046472 Bacteria 13684
182 Ga0495605_0000484 3300046474 Bacteria 34548
183 Ga0495605_0000672 3300046474 Bacteria 25764
184 Ga0495605_0001027 3300046474 Bacteria 18778
185 Ga0495605_0009278 3300046474 Bacteria 5530
186 Ga0495605_0009532 3300046474 Bacteria 5451
187 Ga0495605_0009896 3300046474 Bacteria 5346
188 Ga0495605_0012955 3300046474 Bacteria 4611
189 Ga0495639_0041571 3300046475 Bacteria 2071
190 Ga0495664_0023716 3300046477 Bacteria 3561
191 Ga0495584_0019325 3300046491 Bacteria 3460
192 Ga0495585_0000671 3300046492 Bacteria 31409
193 Ga0495585_0000992 3300046492 Bacteria 23785
194 Ga0495585_0001976 3300046492 Bacteria 15273
195 Ga0495585_0004263 3300046492 Bacteria 9314
196 Ga0495594_0012069 3300046499 Bacteria 4498
197 Ga0495596_0000283 3300046500 Bacteria 33843
198 Ga0495596_0000781 3300046500 Bacteria 19375
199 Ga0495596_0002336 3300046500 Bacteria 10283
200 Ga0495607_0000639 3300046501 Bacteria 34018
201 Ga0495607_0000882 3300046501 Bacteria 27974
202 Ga0495607_0002158 3300046501 Bacteria 16384
203 Ga0495607_0011963 3300046501 Bacteria 5746
204 Ga0495607_0073643 3300046501 Bacteria 1898
205 Ga0495583_0000867 3300046506 Bacteria 36740
206 Ga0495583_0001402 3300046506 Bacteria 24561
207 Ga0495583_0002001 3300046506 Bacteria 18656
208 Ga0495606_0000722 3300046507 Bacteria 51115
209 Ga0495606_0001551 3300046507 Bacteria 30264
210 Ga0495606_0002756 3300046507 Bacteria 19703
211 Ga0495616_0016137 3300046513 Bacteria 4140
212 Ga0495620_0000025 3300046515 Bacteria 125369
213 Ga0495628_0002727 3300046516 Bacteria 15792
214 Ga0495628_0026149 3300046516 Bacteria 4764
215 Ga0495628_0047189 3300046516 Bacteria 3418
216 Ga0495630_0006132 3300046517 Bacteria 8522
217 Ga0495630_0048351 3300046517 Bacteria 3183
218 Ga0495630_0052325 3300046517 Bacteria 3057
219 Ga0495631_0000299 3300046518 Bacteria 34689
220 Ga0495631_0001870 3300046518 Bacteria 12427
221 Ga0495631_0003654 3300046518 Bacteria 8399
222 Ga0495632_0003475 3300046519 Bacteria 11144
223 Ga0495632_0019963 3300046519 Bacteria 3639
224 Ga0495637_0000064 3300046520 Bacteria 92793
225 Ga0495637_0001020 3300046520 Bacteria 17613
226 Ga0495637_0003599 3300046520 Bacteria 8206
227 Ga0495637_0052462 3300046520 Bacteria 1702
228 Ga0495643_0000897 3300046522 Bacteria 31700
229 Ga0495643_0001100 3300046522 Bacteria 26910
230 Ga0495643_0007806 3300046522 Bacteria 6845
231 Ga0495643_0012465 3300046522 Bacteria 5129
232 Ga0495644_0019921 3300046523 Bacteria 2560
233 Ga0495648_0000742 3300046524 Bacteria 34816
234 Ga0495648_0000821 3300046524 Bacteria 32785
235 Ga0495648_0005216 3300046524 Bacteria 10870
236 Ga0495648_0062725 3300046524 Bacteria 2199
237 Ga0495648_0112721 3300046524 Bacteria 1476
238 Ga0495666_0000555 3300046526 Bacteria 16646
239 Ga0495666_0000650 3300046526 Bacteria 15630
240 Ga0495666_0008816 3300046526 Bacteria 5053
241 Ga0495666_0024162 3300046526 Bacteria 3003
242 Ga0495652_0002143 3300046529 Bacteria 20798
243 Ga0495652_0017629 3300046529 Bacteria 6371
244 Ga0495654_0000487 3300046530 Bacteria 32718
245 Ga0495654_0001495 3300046530 Bacteria 15987
246 Ga0495654_0002608 3300046530 Bacteria 11491
247 Ga0495654_0062234 3300046530 Bacteria 1789
248 Ga0495654_0064099 3300046530 Bacteria 1757
249 Ga0495665_0006505 3300046531 Bacteria 6310
250 Ga0495665_0009603 3300046531 Bacteria 5242
251 Ga0495640_0010398 3300046533 Bacteria 7198
252 Ga0495586_0000504 3300046535 Bacteria 23022
253 Ga0495587_0000318 3300046536 Bacteria 34260
254 Ga0495587_0046018 3300046536 Bacteria 2591
255 Ga0495609_0000073 3300046538 Bacteria 124227
256 Ga0495609_0000161 3300046538 Bacteria 69842
257 Ga0495609_0000262 3300046538 Bacteria 49441
258 Ga0495609_0000689 3300046538 Bacteria 26028
259 Ga0495609_0007387 3300046538 Bacteria 5492
260 Ga0495597_0000305 3300046542 Bacteria 44060
261 Ga0495645_0005249 3300046543 Bacteria 8869
262 Ga0495622_0000253 3300046557 Bacteria 41481
263 Ga0495622_0003438 3300046557 Bacteria 7465
264 Ga0495622_0003490 3300046557 Bacteria 7405
265 Ga0495622_0037610 3300046557 Unclassified 2254
266 Ga0495622_0091451 3300046557 Bacteria 1398
267 Ga0495633_0000078 3300046558 Bacteria 128668
268 Ga0495633_0001202 3300046558 Bacteria 20822
269 Ga0495668_0000689 3300046616 Bacteria 40549
270 Ga0495668_0011388 3300046616 Bacteria 5329
271 Ga0495668_0030964 3300046616 Bacteria 3016
272 Ga0495668_0045748 3300046616 Unclassified 2433
273 Ga0495668_0078655 3300046616 Bacteria 1810
274 Ga0495634_0009358 3300046642 Bacteria 7227
275 Ga0495634_0015713 3300046642 Bacteria 5428
276 Ga0495611_0000562 3300046648 Bacteria 21465
277 Ga0495611_0001808 3300046648 Bacteria 10254
278 Ga0495625_0000194 3300046660 Bacteria 96964
279 Ga0495635_0000131 3300046663 Bacteria 45264
280 Ga0495635_0001553 3300046663 Bacteria 15411
281 Ga0495661_0000087 3300046665 Bacteria 112658
282 Ga0495661_0000233 3300046665 Bacteria 64169
283 Ga0495661_0002251 3300046665 Bacteria 14952
284 Ga0495661_0009390 3300046665 Bacteria 6714
285 Ga0495588_0016004 3300046674 Bacteria 3620
286 Ga0495623_0001154 3300046679 Bacteria 17868
287 Ga0495623_0005761 3300046679 Bacteria 8083
288 Ga0495646_0000526 3300046680 Bacteria 20513
289 Ga0495646_0002594 3300046680 Bacteria 11134
290 Ga0495646_0002700 3300046680 Bacteria 10975
291 Ga0495646_0013040 3300046680 Bacteria 5283
292 Ga0495613_0004907 3300046689 Bacteria 10054
293 Ga0495613_0016251 3300046689 Bacteria 5545
294 Ga0495624_0004754 3300046690 Bacteria 9880
295 Ga0495624_0005422 3300046690 Bacteria 9192
296 Ga0495624_0037495 3300046690 Bacteria 3117
297 Ga0495670_0000159 3300046691 Bacteria 29368
298 Ga0495671_0001364 3300046692 Bacteria 16559
299 Ga0495649_0008297 3300046694 Bacteria 6254
300 Ga0495649_0034496 3300046694 Bacteria 2784
301 Ga0495589_0000504 3300046794 Bacteria 27610
302 Ga0495589_0000525 3300046794 Bacteria 26868
303 Ga0495589_0000578 3300046794 Bacteria 25244
304 Ga0495589_0000809 3300046794 Bacteria 19813
305 Ga0495589_0003801 3300046794 Bacteria 8123
306 Ga0495600_0000982 3300046809 Bacteria 15361
307 Ga0495600_0015625 3300046809 Bacteria 4805
308 Ga0495660_0000049 3300046810 Bacteria 142727
309 Ga0495660_0001216 3300046810 Bacteria 17979
310 Ga0495660_0016592 3300046810 Bacteria 4246
311 Ga0495660_0086722 3300046810 Bacteria 1633
312 Ga0495581_0011790 3300047315 Bacteria 5060
313 Ga0495581_0016877 3300047315 Bacteria 4244
314 Ga0495604_0000827 3300047317 Bacteria 25855
315 Ga0495604_0087083 3300047317 Bacteria 2327
316 Ga0495636_0000132 3300047318 Bacteria 29973
317 Ga0495674_0004354 3300047319 Bacteria 13608
318 Ga0495674_0035708 3300047319 Bacteria 4481
319 Ga0495674_0062213 3300047319 Bacteria 3251
320 Ga0495674_0086348 3300047319 Bacteria 2686
321 Ga0495672_0000378 3300047320 Bacteria 55187
322 Ga0495672_0059687 3300047320 Bacteria 2206
323 Ga0495676_0000052 3300047321 Bacteria 97049
324 Ga0495676_0000157 3300047321 Bacteria 52412
325 Ga0495676_0053990 3300047321 Bacteria 3197
326 Ga0495676_0059802 3300047321 Bacteria 2990
327 Ga0495676_0225273 3300047321 Bacteria 1290
328 Ga0495680_0000664 3300047322 Bacteria 38534
329 Ga0495680_0003077 3300047322 Bacteria 16613
330 Ga0495680_0005574 3300047322 Bacteria 11816
331 Ga0495680_0010696 3300047322 Bacteria 8182
332 Ga0495683_0000320 3300047323 Bacteria 40260
333 Ga0495683_0000619 3300047323 Bacteria 26557
334 Ga0495683_0000991 3300047323 Bacteria 19870
335 Ga0495683_0001295 3300047323 Bacteria 16901
336 Ga0495683_0001332 3300047323 Bacteria 16524
337 Ga0495683_0002448 3300047323 Bacteria 11213
338 Ga0495683_0031772 3300047323 Bacteria 2690
339 Ga0495683_0101700 3300047323 Bacteria 1381
340 Ga0495675_0001718 3300047444 Bacteria 13101
341 Ga0495675_0027134 3300047444 Bacteria 3650
342 Ga0495677_0016641 3300047445 Unclassified 2669
343 Ga0495679_000136 3300047446 Bacteria 65848
344 Ga0495679_000326 3300047446 Bacteria 37937
345 Ga0495679_000812 3300047446 Bacteria 19836
346 Ga0495679_001561 3300047446 Bacteria 12929
347 Ga0495679_006450 3300047446 Bacteria 5045
348 Ga0495673_0000903 3300047469 Bacteria 27211
349 Ga0495673_0007082 3300047469 Bacteria 6499
350 Ga0495673_0010769 3300047469 Bacteria 4955
351 Ga0495673_0027039 3300047469 Unclassified 2734
352 Ga0495673_0030642 3300047469 Bacteria 2524
353 Ga0495673_0055976 3300047469 Bacteria 1708
354 Ga0495681_0004449 3300047470 Bacteria 9560
355 Ga0495681_0004815 3300047470 Bacteria 9144
356 Ga0495681_0005391 3300047470 Bacteria 8574
357 Ga0495593_0000168 3300047673 Bacteria 33647
358 Ga0495593_0001237 3300047673 Bacteria 14948
359 Ga0495593_0033303 3300047673 Bacteria 2806
360 Ga0495602_0002520 3300048088 Bacteria 18667
361 Ga0495614_0007342 3300048089 Bacteria 4907
362 Ga0495626_0000126 3300048091 Bacteria 99054
363 Ga0495626_0000621 3300048091 Bacteria 34549
364 Ga0495626_0000703 3300048091 Bacteria 31806
365 Ga0495626_0009082 3300048091 Bacteria 5393
366 Ga0495626_0032846 3300048091 Bacteria 2490
367 Ga0495626_0044618 3300048091 Bacteria 2073
368 Ga0496102_0136230 3300048905 Bacteria 2301
369 Ga0496110_0176954 3300048913 Bacteria 1937
370 Ga0496112_0128140 3300048915 Bacteria 2509
371 Ga0496116_0001011 3300048919 Bacteria 34292
372 Ga0496116_0004915 3300048919 Bacteria 12594
373 Ga0496116_0148193 3300048919 Bacteria 1308
374 Ga0496117_0001649 3300048920 Bacteria 31378
375 Ga0496117_0002337 3300048920 Bacteria 24254
376 Ga0496117_0003251 3300048920 Bacteria 19125
377 Ga0496117_0018252 3300048920 Bacteria 5822
378 Ga0496117_0116414 3300048920 Bacteria 1652
379 Ga0496118_0001738 3300048921 Bacteria 31643
380 Ga0496118_0001895 3300048921 Bacteria 29825
381 Ga0496118_0002512 3300048921 Bacteria 24623
382 Ga0496118_0010986 3300048921 Bacteria 8896
383 Ga0496118_0016450 3300048921 Bacteria 6785
384 Ga0496118_0083103 3300048921 Bacteria 2240
385 Ga0496119_0001204 3300048922 Bacteria 32316
386 Ga0496119_0001356 3300048922 Bacteria 29915
387 Ga0496120_0001293 3300048923 Bacteria 31131
388 Ga0496120_0001399 3300048923 Bacteria 29187
389 Ga0496121_0001685 3300048924 Bacteria 36349
390 Ga0496121_0002045 3300048924 Bacteria 31934
391 Ga0496121_0002454 3300048924 Bacteria 28322
392 Ga0496121_0004065 3300048924 Bacteria 20095
393 Ga0496122_0000434 3300048925 Bacteria 87536
394 Ga0496122_0000847 3300048925 Bacteria 57788
395 Ga0496122_0003546 3300048925 Bacteria 20414
396 Ga0496122_0022901 3300048925 Bacteria 5530
397 Ga0496122_0024345 3300048925 Bacteria 5300
398 Ga0496122_0024953 3300048925 Bacteria 5216
399 Ga0496123_0000318 3300048926 Bacteria 91911
400 Ga0496123_0000794 3300048926 Bacteria 50999
401 Ga0496123_0016191 3300048926 Bacteria 6070
402 Ga0496123_0019173 3300048926 Bacteria 5399
403 Ga0496124_0000699 3300048927 Bacteria 54987
404 Ga0496124_0003860 3300048927 Bacteria 17927
405 Ga0496124_0007001 3300048927 Bacteria 12086
406 Ga0496124_0011728 3300048927 Bacteria 8743
407 Ga0496124_0017256 3300048927 Bacteria 6809
408 Ga0496124_0032847 3300048927 Bacteria 4576
409 Ga0496124_0125107 3300048927 Bacteria 2049
410 Ga0496125_0000714 3300048928 Bacteria 54950
411 Ga0496125_0001710 3300048928 Bacteria 30576
412 Ga0501310_000805 3300049130 Bacteria 2787
413 Ga0495678_000073 3300049459 Bacteria 126095
414 Ga0495678_012790 3300049459 Bacteria 3964
415 Ga0495682_0000080 3300049460 Bacteria 84736
416 Ga0495682_0000466 3300049460 Bacteria 27939
417 Ga0495682_0000723 3300049460 Bacteria 21436
418 Ga0495682_0011220 3300049460 Bacteria 3451
419 Ga0495682_0027946 3300049460 Bacteria 2091
420 Ga0495682_0031698 3300049460 Bacteria 1953
421 Ga0501032_0000420 3300049569 Bacteria 35147
422 Ga0501034_0033897 3300049571 Bacteria 5176
423 Ga0501037_0005990 3300049573 Bacteria 8880
424 Ga0501038_0043260 3300049574 Bacteria 3917
425 Ga0501038_0140597 3300049574 Bacteria 1975
426 Ga0501039_0080436 3300049575 Unclassified 2536
427 Ga0501043_0005811 3300049579 Bacteria 9924
428 Ga0501227_003287 3300049665 Bacteria 3510
429 Ga0501241_000477 3300049758 Bacteria 8685
430 Ga0501044_0034034 3300049823 Bacteria 5348
431 Ga0501226_001491 3300049853 Bacteria 2987
432 nmdc:mga00v17_367_c1 3300050491 Bacteria 25605
433 Ga0500607_077614 3300053121 Bacteria 1700
434 Ga0500618_002755 3300053125 Bacteria 6391
435 Ga0500621_000036 3300053126 Bacteria 25015
436 Ga0500636_0001254 3300053177 Bacteria 13752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002705 JGI25156J39149_1005558 JGI25156J39149_10055581 299
2 3300003756 Ga0055533_1000124 Ga0055533_100012427 299
3 3300046616 Ga0495668_0000689 Ga0495668_0000689_30005_30937 299
4 3300005288 Ga0065714_10002559 Ga0065714_100025599 301
5 3300009092 Ga0105250_10008314 Ga0105250_100083141 301
6 3300013104 Ga0157370_10003235 Ga0157370_100032357 301
7 3300014497 Ga0182008_10001249 Ga0182008_100012497 301
8 3300015265 Ga0182005_1000325 Ga0182005_100032510 301
9 3300046455 Ga0495603_0000188 Ga0495603_0000188_9068_10093 301
10 3300046463 Ga0495653_0020010 Ga0495653_0020010_2893_3918 301
11 3300046501 Ga0495607_0000882 Ga0495607_0000882_2912_3937 301
12 3300046522 Ga0495643_0000897 Ga0495643_0000897_18132_19070 301
13 3300046526 Ga0495666_0000555 Ga0495666_0000555_12956_13981 301
14 3300046536 Ga0495587_0046018 Ga0495587_0046018_941_1966 301
15 3300046663 Ga0495635_0000131 Ga0495635_0000131_10456_11481 301
16 3300046680 Ga0495646_0013040 Ga0495646_0013040_3462_4487 301
17 3300046809 Ga0495600_0015625 Ga0495600_0015625_2258_3283 301
18 3300047319 Ga0495674_0004354 Ga0495674_0004354_7909_8934 301
19 3300047322 Ga0495680_0000664 Ga0495680_0000664_6919_7944 301
20 3300047323 Ga0495683_0000619 Ga0495683_0000619_7143_8168 301
21 3300047444 Ga0495675_0027134 Ga0495675_0027134_2178_3203 301
22 3300047673 Ga0495593_0000168 Ga0495593_0000168_16689_17714 301
23 3300048921 Ga0496118_0001738 Ga0496118_0001738_16808_17866 301
24 3300048925 Ga0496122_0003546 Ga0496122_0003546_5579_6637 301
25 3300048926 Ga0496123_0000794 Ga0496123_0000794_17766_18824 301
26 3300049460 Ga0495682_0027946 Ga0495682_0027946_610_1692 301
27 3300046517 Ga0495630_0052325 Ga0495630_0052325_565_1590 302
28 3300046536 Ga0495587_0000318 Ga0495587_0000318_19694_20719 302
29 3300046679 Ga0495623_0001154 Ga0495623_0001154_4728_5753 302
30 3300046680 Ga0495646_0002700 Ga0495646_0002700_9154_10179 302
31 3300047322 Ga0495680_0010696 Ga0495680_0010696_6338_7363 302
32 3300046794 Ga0495589_0000809 Ga0495589_0000809_7867_8892 303
33 3300047315 Ga0495581_0011790 Ga0495581_0011790_3935_4960 303
34 3300047323 Ga0495683_0001295 Ga0495683_0001295_5178_6203 303
35 3300049569 Ga0501032_0000420 Ga0501032_0000420_22946_23983 303
36 3300049573 Ga0501037_0005990 Ga0501037_0005990_251_1288 303
37 3300049574 Ga0501038_0043260 Ga0501038_0043260_1280_2317 303
38 3300049575 Ga0501039_0080436 Ga0501039_0080436_685_1722 303
39 3300046501 Ga0495607_0011963 Ga0495607_0011963_666_1688 305
40 3300046519 Ga0495632_0003475 Ga0495632_0003475_3338_4372 305
41 3300046648 Ga0495611_0000562 Ga0495611_0000562_9588_10610 305
42 3300047470 Ga0495681_0004449 Ga0495681_0004449_7914_8948 305
43 3300013100 Ga0157373_10124859 Ga0157373_101248592 306
44 3300047469 Ga0495673_0055976 Ga0495673_0055976_653_1678 308
45 3300013104 Ga0157370_10011642 Ga0157370_100116422 312
46 3300046520 Ga0495637_0001020 Ga0495637_0001020_14855_15880 312
47 3300046526 Ga0495666_0024162 Ga0495666_0024162_722_1828 314
48 3300046680 Ga0495646_0000526 Ga0495646_0000526_16585_17691 314
49 3300046689 Ga0495613_0004907 Ga0495613_0004907_6614_7720 314
50 3300046690 Ga0495624_0005422 Ga0495624_0005422_4778_5884 314
51 3300046809 Ga0495600_0000982 Ga0495600_0000982_1227_2333 314
52 3300031911 Ga0307412_10120654 Ga0307412_101206541 317
53 3300046454 Ga0495592_0148181 Ga0495592_0148181_50_1042 318
54 3300046524 Ga0495648_0062725 Ga0495648_0062725_1122_2114 318
55 3300047321 Ga0495676_0225273 Ga0495676_0225273_56_1048 318
56 iso_pu_bacteria 2917832318 2917834790 318
57 iso_pu_bacteria 2919125081 2919128903 318
58 iso_pu_bacteria 2984504281 2984508164 318
59 iso_pu_bacteria 8016728285 8016729639 318
60 iso_pu_bacteria 2510065053 2510281207 319
61 iso_pu_bacteria 2510065055 2510294513 319
62 iso_pu_bacteria 2510065058 2510309355 319
63 iso_pu_bacteria 2773857672 2774131774 319
64 iso_pu_bacteria 2974298342 2974300887 319
65 iso_pu_bacteria 2984499530 2984503359 319
66 3300049571 Ga0501034_0033897 Ga0501034_0033897_1778_2815 320
67 3300049574 Ga0501038_0140597 Ga0501038_0140597_823_1860 320
68 3300049579 Ga0501043_0005811 Ga0501043_0005811_1965_3002 320
69 3300003771 Ga0055526_1002209 Ga0055526_10022094 321
70 3300005444 Ga0070694_100024956 Ga0070694_1000249562 321
71 3300006051 Ga0075364_10000388 Ga0075364_100003882 321
72 3300006051 Ga0075364_10018899 Ga0075364_100188994 321
73 3300025263 Ga0209565_1000439 Ga0209565_10004394 321
74 3300025273 Ga0209673_1002992 Ga0209673_10029923 321
75 3300025295 Ga0209564_1001062 Ga0209564_10010624 321
76 3300025299 Ga0209256_1008277 Ga0209256_10082773 321
77 3300048921 Ga0496118_0016450 Ga0496118_0016450_4310_5311 321
78 3300048927 Ga0496124_0017256 Ga0496124_0017256_4233_5234 321
79 3300050491 nmdc:mga00v17_367_c1 nmdc:mga00v17_367_c1_23810_24814 321
80 iso_pu_bacteria 2908446538 2908451156 321
81 3300048919 Ga0496116_0004915 Ga0496116_0004915_7710_8720 322
82 3300003323 rootH1_10296988 rootH1_102969882 323
83 3300009011 Ga0105251_10018328 Ga0105251_100183281 323
84 3300013100 Ga0157373_10226715 Ga0157373_102267151 323
85 3300013102 Ga0157371_10002469 Ga0157371_1000246920 323
86 3300013105 Ga0157369_10048951 Ga0157369_100489514 323
87 3300015265 Ga0182005_1000014 Ga0182005_100001452 323
88 3300025728 Ga0207655_1039833 Ga0207655_10398332 323
89 3300025735 Ga0207713_1048650 Ga0207713_10486502 323
90 3300027312 Ga0209371_1014634 Ga0209371_10146342 323
91 3300030500 Ga0268256_1011860 Ga0268256_10118604 323
92 3300044712 Ga0453684_0000273 Ga0453684_0000273_32340_33350 323
93 3300046474 Ga0495605_0009896 Ga0495605_0009896_3815_4825 323
94 3300046492 Ga0495585_0000671 Ga0495585_0000671_21308_22333 323
95 3300046500 Ga0495596_0000781 Ga0495596_0000781_18034_19044 323
96 3300046507 Ga0495606_0002756 Ga0495606_0002756_4921_5925 323
97 3300046518 Ga0495631_0003654 Ga0495631_0003654_6527_7537 323
98 3300046522 Ga0495643_0007806 Ga0495643_0007806_2090_3100 323
99 3300046538 Ga0495609_0007387 Ga0495609_0007387_307_1317 323
100 3300046557 Ga0495622_0037610 Ga0495622_0037610_647_1657 323
101 3300046616 Ga0495668_0045748 Ga0495668_0045748_733_1743 323
102 3300046810 Ga0495660_0016592 Ga0495660_0016592_1327_2346 323
103 3300047323 Ga0495683_0031772 Ga0495683_0031772_1122_2132 323
104 3300047445 Ga0495677_0016641 Ga0495677_0016641_412_1422 323
105 3300047469 Ga0495673_0027039 Ga0495673_0027039_1589_2599 323
106 3300048091 Ga0495626_0009082 Ga0495626_0009082_2783_3793 323
107 3300048925 Ga0496122_0000847 Ga0496122_0000847_28619_29677 323
108 3300048926 Ga0496123_0019173 Ga0496123_0019173_4289_5347 323
109 3300005439 Ga0070711_100287011 Ga0070711_1002870111 324
110 3300049460 Ga0495682_0000723 Ga0495682_0000723_13887_14900 324
111 iso_pu_bacteria 2919063839 2919068923 324
112 iso_pu_bacteria 3007718800 3007718943 324
113 3300046520 Ga0495637_0052462 Ga0495637_0052462_122_1135 325
114 3300048920 Ga0496117_0002337 Ga0496117_0002337_18867_19880 325
115 3300048921 Ga0496118_0002512 Ga0496118_0002512_18920_19933 325
116 iso_pu_bacteria 2510065045 2510250105 325
117 iso_pu_bacteria 2599185160 2599358273 325
118 iso_pu_bacteria 2599185164 2599383438 325
119 iso_pu_bacteria 2599185165 2599389885 325
120 iso_pu_bacteria 2599185181 2599465088 325
121 iso_pu_bacteria 2599185186 2599493997 325
122 iso_pu_bacteria 2599185189 2599507479 325
123 iso_pu_bacteria 2599185356 2600217822 325
124 iso_pu_bacteria 2600255313 2601777989 325
125 iso_pu_bacteria 2643221638 2644216686 325
126 iso_pu_bacteria 2718217991 2719639263 325
127 iso_pu_bacteria 2885080285 2885083332 325
128 iso_pu_bacteria 8054347763 8054352024 325
129 iso_pu_bacteria 8057798959 8057805169 325
130 3300009011 Ga0105251_10001164 Ga0105251_1000116424 326
131 3300015265 Ga0182005_1000529 Ga0182005_10005298 326
132 3300025735 Ga0207713_1002635 Ga0207713_10026354 326
133 3300031239 Ga0265328_10014887 Ga0265328_100148873 326
134 3300031250 Ga0265331_10000024 Ga0265331_10000024237 326
135 3300031251 Ga0265327_10000079 Ga0265327_100000798 326
136 3300046455 Ga0495603_0019126 Ga0495603_0019126_3121_4134 326
137 3300046458 Ga0495591_029814 Ga0495591_029814_183_1196 326
138 3300046474 Ga0495605_0001027 Ga0495605_0001027_8048_9061 326
139 3300046475 Ga0495639_0041571 Ga0495639_0041571_189_1202 326
140 3300046499 Ga0495594_0012069 Ga0495594_0012069_395_1408 326
141 3300046506 Ga0495583_0002001 Ga0495583_0002001_8131_9144 326
142 3300046513 Ga0495616_0016137 Ga0495616_0016137_961_1974 326
143 3300046515 Ga0495620_0000025 Ga0495620_0000025_114973_115986 326
144 3300046518 Ga0495631_0001870 Ga0495631_0001870_5299_6312 326
145 3300046520 Ga0495637_0003599 Ga0495637_0003599_6264_7277 326
146 3300046524 Ga0495648_0005216 Ga0495648_0005216_8639_9652 326
147 3300046529 Ga0495652_0017629 Ga0495652_0017629_464_1477 326
148 3300046530 Ga0495654_0001495 Ga0495654_0001495_742_1755 326
149 3300046538 Ga0495609_0000073 Ga0495609_0000073_97876_98889 326
150 3300046542 Ga0495597_0000305 Ga0495597_0000305_9513_10526 326
151 3300046558 Ga0495633_0000078 Ga0495633_0000078_93101_94114 326
152 3300046665 Ga0495661_0000087 Ga0495661_0000087_82140_83153 326
153 3300046674 Ga0495588_0016004 Ga0495588_0016004_243_1256 326
154 3300046794 Ga0495589_0000525 Ga0495589_0000525_1138_2151 326
155 3300046810 Ga0495660_0001216 Ga0495660_0001216_15167_16180 326
156 3300047323 Ga0495683_0001332 Ga0495683_0001332_6173_7186 326
157 3300047446 Ga0495679_001561 Ga0495679_001561_8875_9888 326
158 3300047469 Ga0495673_0030642 Ga0495673_0030642_1004_2017 326
159 3300047470 Ga0495681_0004815 Ga0495681_0004815_7133_8146 326
160 3300048091 Ga0495626_0044618 Ga0495626_0044618_652_1674 326
161 3300048920 Ga0496117_0116414 Ga0496117_0116414_614_1627 326
162 3300048925 Ga0496122_0022901 Ga0496122_0022901_990_2003 326
163 3300048926 Ga0496123_0016191 Ga0496123_0016191_207_1220 326
164 3300049459 Ga0495678_000073 Ga0495678_000073_114796_115809 326
165 3300053125 Ga0500618_002755 Ga0500618_002755_4130_5143 326
166 iso_pu_bacteria 2511231020 2511349710 326
167 iso_pu_bacteria 2511231022 2511362934 326
168 iso_pu_bacteria 2511231023 2511368074 326
169 iso_pu_bacteria 2599185292 2599904364 326
170 iso_pu_bacteria 2643221554 2643791835 326
171 iso_pu_bacteria 2784132063 2784263268 326
172 iso_pu_bacteria 2816332133 2816475871 326
173 iso_pu_bacteria 2919385768 2919388043 326
174 iso_pu_bacteria 639633007 639788760 326
175 iso_pu_bacteria 8055266321 8055266561 326
176 iso_pu_bacteria 8056155041 8056155074 326
177 iso_pu_bacteria 8056161164 8056164914 326
178 3300005288 Ga0065714_10066213 Ga0065714_100662137 327
179 3300009011 Ga0105251_10000893 Ga0105251_1000089314 327
180 3300009036 Ga0105244_10000638 Ga0105244_1000063825 327
181 3300014497 Ga0182008_10009213 Ga0182008_100092135 327
182 3300015262 Ga0182007_10000636 Ga0182007_1000063615 327
183 3300025728 Ga0207655_1000857 Ga0207655_10008572 327
184 3300025735 Ga0207713_1000614 Ga0207713_100061421 327
185 3300031548 Ga0307408_100002453 Ga0307408_1000024535 327
186 3300046460 Ga0495638_0000583 Ga0495638_0000583_30223_31239 327
187 3300048925 Ga0496122_0024345 Ga0496122_0024345_925_1941 327
188 3300048927 Ga0496124_0011728 Ga0496124_0011728_6629_7645 327
189 3300048928 Ga0496125_0001710 Ga0496125_0001710_1197_2219 327
190 3300005288 Ga0065714_10005092 Ga0065714_100050924 328
191 3300005353 Ga0070669_100030754 Ga0070669_1000307543 328
192 3300014497 Ga0182008_10000650 Ga0182008_100006503 328
193 3300015265 Ga0182005_1000970 Ga0182005_100097010 328
194 3300025923 Ga0207681_10065901 Ga0207681_100659012 328
195 3300028800 Ga0265338_10132433 Ga0265338_101324332 328
196 3300042142 Ga0450905_000007 Ga0450905_000007_5143_6162 328
197 3300046463 Ga0495653_0000603 Ga0495653_0000603_3259_4278 328
198 3300048091 Ga0495626_0000703 Ga0495626_0000703_7540_8559 328
199 3300048920 Ga0496117_0003251 Ga0496117_0003251_18019_19038 328
200 3300048921 Ga0496118_0010986 Ga0496118_0010986_4294_5313 328
201 3300048924 Ga0496121_0002454 Ga0496121_0002454_22134_23153 328
202 3300048927 Ga0496124_0003860 Ga0496124_0003860_13606_14625 328
203 3300002773 JGI25152J39213_1010825 JGI25152J39213_10108251 329
204 3300002774 JGI25150J39212_1000274 JGI25150J39212_100027426 329
205 3300003771 Ga0055526_1000496 Ga0055526_10004962 329
206 3300003773 Ga0055537_1000806 Ga0055537_100080616 329
207 3300003773 Ga0055537_1006338 Ga0055537_10063382 329
208 3300003775 Ga0055524_1001544 Ga0055524_100154414 329
209 3300003775 Ga0055524_1009722 Ga0055524_10097222 329
210 3300003781 Ga0055536_1000536 Ga0055536_100053626 329
211 3300003784 Ga0055534_1000329 Ga0055534_10003292 329
212 3300003791 Ga0055530_10000266 Ga0055530_1000026644 329
213 3300003791 Ga0055530_10000283 Ga0055530_1000028337 329
214 3300003792 Ga0055540_1000606 Ga0055540_100060626 329
215 3300005289 Ga0065704_10095085 Ga0065704_100950852 329
216 3300009011 Ga0105251_10000011 Ga0105251_10000011106 329
217 3300009036 Ga0105244_10090188 Ga0105244_100901881 329
218 3300015265 Ga0182005_1007304 Ga0182005_10073042 329
219 3300025226 Ga0209674_100005 Ga0209674_1000051229 329
220 3300025245 Ga0207425_1000050 Ga0207425_100005090 329
221 3300025258 Ga0209129_1001335 Ga0209129_10013356 329
222 3300025261 Ga0209233_1000016 Ga0209233_1000016591 329
223 3300025263 Ga0209565_1000348 Ga0209565_100034817 329
224 3300025263 Ga0209565_1000421 Ga0209565_10004216 329
225 3300025263 Ga0209565_1001005 Ga0209565_10010056 329
226 3300025291 Ga0209675_1000418 Ga0209675_10004186 329
227 3300025292 Ga0209676_1000255 Ga0209676_100025534 329
228 3300025295 Ga0209564_1001027 Ga0209564_10010276 329
229 3300025295 Ga0209564_1024870 Ga0209564_10248702 329
230 3300025298 Ga0209050_1000271 Ga0209050_100027174 329
231 3300025298 Ga0209050_1000420 Ga0209050_100042071 329
232 3300025299 Ga0209256_1000757 Ga0209256_10007576 329
233 3300025299 Ga0209256_1005349 Ga0209256_10053496 329
234 3300025303 Ga0209051_1000250 Ga0209051_100025014 329
235 3300025728 Ga0207655_1001579 Ga0207655_100157911 329
236 3300025735 Ga0207713_1000073 Ga0207713_1000073106 329
237 3300028794 Ga0307515_10192988 Ga0307515_101929882 329
238 3300031251 Ga0265327_10001446 Ga0265327_100014464 329
239 3300042006 Ga0439432_000099 Ga0439432_000099_23460_24494 329
240 3300042016 Ga0439463_000475 Ga0439463_000475_5643_6668 329
241 3300042115 Ga0450911_000103 Ga0450911_000103_27967_29001 329
242 3300046452 Ga0495617_000086 Ga0495617_000086_52603_53625 329
243 3300046452 Ga0495617_010961 Ga0495617_010961_348_1373 329
244 3300046458 Ga0495591_006900 Ga0495591_006900_1138_2166 329
245 3300046471 Ga0495650_0000311 Ga0495650_0000311_37076_38101 329
246 3300046474 Ga0495605_0000484 Ga0495605_0000484_13248_14306 329
247 3300046474 Ga0495605_0009278 Ga0495605_0009278_500_1522 329
248 3300046474 Ga0495605_0009532 Ga0495605_0009532_1674_2699 329
249 3300046474 Ga0495605_0012955 Ga0495605_0012955_66_1088 329
250 3300046491 Ga0495584_0019325 Ga0495584_0019325_2045_3070 329
251 3300046492 Ga0495585_0000992 Ga0495585_0000992_13167_14189 329
252 3300046492 Ga0495585_0001976 Ga0495585_0001976_6193_7218 329
253 3300046492 Ga0495585_0004263 Ga0495585_0004263_1070_2095 329
254 3300046500 Ga0495596_0000283 Ga0495596_0000283_21481_22506 329
255 3300046501 Ga0495607_0002158 Ga0495607_0002158_803_1825 329
256 3300046506 Ga0495583_0000867 Ga0495583_0000867_14158_15216 329
257 3300046506 Ga0495583_0001402 Ga0495583_0001402_7028_8053 329
258 3300046507 Ga0495606_0000722 Ga0495606_0000722_19154_20179 329
259 3300046518 Ga0495631_0000299 Ga0495631_0000299_15370_16392 329
260 3300046519 Ga0495632_0019963 Ga0495632_0019963_1043_2068 329
261 3300046520 Ga0495637_0000064 Ga0495637_0000064_37893_38918 329
262 3300046522 Ga0495643_0012465 Ga0495643_0012465_1885_2910 329
263 3300046523 Ga0495644_0019921 Ga0495644_0019921_1404_2429 329
264 3300046530 Ga0495654_0062234 Ga0495654_0062234_102_1127 329
265 3300046530 Ga0495654_0064099 Ga0495654_0064099_102_1127 329
266 3300046538 Ga0495609_0000161 Ga0495609_0000161_55645_56670 329
267 3300046538 Ga0495609_0000262 Ga0495609_0000262_5238_6260 329
268 3300046557 Ga0495622_0000253 Ga0495622_0000253_13303_14328 329
269 3300046557 Ga0495622_0003490 Ga0495622_0003490_5780_6805 329
270 3300046558 Ga0495633_0001202 Ga0495633_0001202_10130_11152 329
271 3300046616 Ga0495668_0011388 Ga0495668_0011388_3744_4769 329
272 3300046616 Ga0495668_0030964 Ga0495668_0030964_1226_2248 329
273 3300046616 Ga0495668_0078655 Ga0495668_0078655_200_1225 329
274 3300046648 Ga0495611_0001808 Ga0495611_0001808_2443_3468 329
275 3300046660 Ga0495625_0000194 Ga0495625_0000194_40290_41315 329
276 3300046665 Ga0495661_0000233 Ga0495661_0000233_57363_58388 329
277 3300046665 Ga0495661_0009390 Ga0495661_0009390_1341_2399 329
278 3300046691 Ga0495670_0000159 Ga0495670_0000159_21615_22640 329
279 3300046692 Ga0495671_0001364 Ga0495671_0001364_5739_6761 329
280 3300046810 Ga0495660_0000049 Ga0495660_0000049_101656_102678 329
281 3300046810 Ga0495660_0086722 Ga0495660_0086722_125_1150 329
282 3300047320 Ga0495672_0059687 Ga0495672_0059687_436_1458 329
283 3300047321 Ga0495676_0000052 Ga0495676_0000052_55720_56745 329
284 3300047321 Ga0495676_0059802 Ga0495676_0059802_33_1058 329
285 3300047323 Ga0495683_0101700 Ga0495683_0101700_109_1131 329
286 3300047446 Ga0495679_000136 Ga0495679_000136_20671_21696 329
287 3300047469 Ga0495673_0000903 Ga0495673_0000903_14505_15539 329
288 3300047469 Ga0495673_0010769 Ga0495673_0010769_2323_3348 329
289 3300047470 Ga0495681_0005391 Ga0495681_0005391_3015_4040 329
290 3300048091 Ga0495626_0000126 Ga0495626_0000126_55682_56785 329
291 3300048905 Ga0496102_0136230 Ga0496102_0136230_1171_2196 329
292 3300048913 Ga0496110_0176954 Ga0496110_0176954_425_1450 329
293 3300048915 Ga0496112_0128140 Ga0496112_0128140_630_1655 329
294 3300048919 Ga0496116_0148193 Ga0496116_0148193_85_1188 329
295 3300048920 Ga0496117_0018252 Ga0496117_0018252_2893_3921 329
296 3300048921 Ga0496118_0083103 Ga0496118_0083103_802_1830 329
297 3300048924 Ga0496121_0002045 Ga0496121_0002045_10841_11866 329
298 3300048924 Ga0496121_0004065 Ga0496121_0004065_8018_9046 329
299 3300048925 Ga0496122_0000434 Ga0496122_0000434_31439_32467 329
300 3300048925 Ga0496122_0024953 Ga0496122_0024953_1702_2727 329
301 3300048926 Ga0496123_0000318 Ga0496123_0000318_55070_56098 329
302 3300048927 Ga0496124_0007001 Ga0496124_0007001_5597_6622 329
303 3300048927 Ga0496124_0032847 Ga0496124_0032847_407_1429 329
304 3300049130 Ga0501310_000805 Ga0501310_000805_32_1057 329
305 3300049459 Ga0495678_012790 Ga0495678_012790_2601_3626 329
306 3300049460 Ga0495682_0000080 Ga0495682_0000080_70461_71483 329
307 3300049460 Ga0495682_0000466 Ga0495682_0000466_20101_21126 329
308 3300049665 Ga0501227_003287 Ga0501227_003287_1645_2676 329
309 3300049823 Ga0501044_0034034 Ga0501044_0034034_3779_4804 329
310 2124908027 MRS2a_Contig_237 MRS2a_00139430 330
311 2162886007 SwRhRL2b_contig_190046 SwRhRL2b_0480.00004820 330
312 2162886011 MRS1b_contig_8356243 MRS1b_0668.00000680 330
313 3300002738 JGI25154J39366_1000190 JGI25154J39366_100019023 330
314 3300002739 JGI25158J39367_1000031 JGI25158J39367_100003114 330
315 3300002987 JGI25159J45721_1000129 JGI25159J45721_100012914 330
316 3300003323 rootH1_10174005 rootH1_101740052 330
317 3300003354 JGI25160J50197_1000286 JGI25160J50197_100028614 330
318 3300003374 JGI25161J50226_1000217 JGI25161J50226_100021714 330
319 3300003771 Ga0055526_1000287 Ga0055526_10002875 330
320 3300003771 Ga0055526_1005613 Ga0055526_10056138 330
321 3300003773 Ga0055537_1000342 Ga0055537_10003425 330
322 3300003773 Ga0055537_1005214 Ga0055537_10052144 330
323 3300003775 Ga0055524_1002975 Ga0055524_10029755 330
324 3300003784 Ga0055534_1000589 Ga0055534_10005898 330
325 3300004625 Ga0055543_1000267 Ga0055543_100026716 330
326 3300005262 Ga0065165_1000898 Ga0065165_100089816 330
327 3300005288 Ga0065714_10002270 Ga0065714_1000227012 330
328 3300005289 Ga0065704_10070851 Ga0065704_100708518 330
329 3300005290 Ga0065712_10068142 Ga0065712_100681421 330
330 3300009011 Ga0105251_10004073 Ga0105251_1000407310 330
331 3300009092 Ga0105250_10000746 Ga0105250_1000074618 330
332 3300011119 Ga0105246_10000232 Ga0105246_1000023213 330
333 3300013100 Ga0157373_10000529 Ga0157373_1000052918 330
334 3300013100 Ga0157373_10000759 Ga0157373_1000075910 330
335 3300013100 Ga0157373_10038354 Ga0157373_100383543 330
336 3300013102 Ga0157371_10001343 Ga0157371_1000134320 330
337 3300013102 Ga0157371_10005135 Ga0157371_100051352 330
338 3300013102 Ga0157371_10011536 Ga0157371_100115364 330
339 3300013104 Ga0157370_10003020 Ga0157370_100030209 330
340 3300013104 Ga0157370_10017881 Ga0157370_100178813 330
341 3300013306 Ga0163162_10000688 Ga0163162_1000068826 330
342 3300013308 Ga0157375_10010776 Ga0157375_100107767 330
343 3300015261 Ga0182006_1006610 Ga0182006_10066104 330
344 3300015262 Ga0182007_10000296 Ga0182007_1000029621 330
345 3300015265 Ga0182005_1000319 Ga0182005_100031919 330
346 3300016635 Ga0183361_10022 Ga0183361_1002295 330
347 3300025208 Ga0209436_100116 Ga0209436_10011622 330
348 3300025225 Ga0209566_102920 Ga0209566_1029201 330
349 3300025231 Ga0207427_102292 Ga0207427_1022923 330
350 3300025246 Ga0209646_1000075 Ga0209646_100007536 330
351 3300025256 Ga0209759_1001109 Ga0209759_10011095 330
352 3300025263 Ga0209565_1000296 Ga0209565_100029624 330
353 3300025263 Ga0209565_1000367 Ga0209565_100036722 330
354 3300025263 Ga0209565_1000379 Ga0209565_100037924 330
355 3300025284 Ga0209130_1000518 Ga0209130_100051816 330
356 3300025291 Ga0209675_1000268 Ga0209675_100026826 330
357 3300025291 Ga0209675_1000861 Ga0209675_100086110 330
358 3300025292 Ga0209676_1002912 Ga0209676_10029126 330
359 3300025295 Ga0209564_1000063 Ga0209564_100006374 330
360 3300025295 Ga0209564_1000908 Ga0209564_100090816 330
361 3300025295 Ga0209564_1001288 Ga0209564_100128811 330
362 3300025298 Ga0209050_1000904 Ga0209050_100090433 330
363 3300025299 Ga0209256_1000227 Ga0209256_100022746 330
364 3300025299 Ga0209256_1000638 Ga0209256_100063832 330
365 3300025299 Ga0209256_1001485 Ga0209256_100148510 330
366 3300025302 Ga0207426_1000506 Ga0207426_100050616 330
367 3300027312 Ga0209371_1018514 Ga0209371_10185142 330
368 3300030500 Ga0268256_1020706 Ga0268256_10207061 330
369 3300037471 Ga0395905_0003906 Ga0395905_0003906_9231_10292 330
370 3300041405 Ga0439438_000275 Ga0439438_000275_18993_20018 330
371 3300041407 Ga0439447_000209 Ga0439447_000209_17684_18709 330
372 3300041411 Ga0439466_0001149 Ga0439466_0001149_2101_3126 330
373 3300042009 Ga0439451_000343 Ga0439451_000343_6922_7947 330
374 3300042010 Ga0439452_001021 Ga0439452_001021_9443_10468 330
375 3300042013 Ga0439456_008307 Ga0439456_008307_90_1115 330
376 3300042016 Ga0439463_002335 Ga0439463_002335_1597_2622 330
377 3300042461 Ga0439460_0000071 Ga0439460_0000071_10812_11837 330
378 3300046452 Ga0495617_000200 Ga0495617_000200_26149_27174 330
379 3300046455 Ga0495603_0000224 Ga0495603_0000224_2850_4007 330
380 3300046457 Ga0495590_0006315 Ga0495590_0006315_2252_3280 330
381 3300046458 Ga0495591_000430 Ga0495591_000430_27875_28900 330
382 3300046459 Ga0495629_0009792 Ga0495629_0009792_5863_6969 330
383 3300046459 Ga0495629_0061657 Ga0495629_0061657_1308_2465 330
384 3300046460 Ga0495638_0000868 Ga0495638_0000868_17067_18092 330
385 3300046462 Ga0495651_0002753 Ga0495651_0002753_10196_11302 330
386 3300046463 Ga0495653_0007878 Ga0495653_0007878_1460_2617 330
387 3300046471 Ga0495650_0000015 Ga0495650_0000015_496231_497289 330
388 3300046471 Ga0495650_0001217 Ga0495650_0001217_3621_4646 330
389 3300046472 Ga0495580_0003355 Ga0495580_0003355_8895_10052 330
390 3300046474 Ga0495605_0000672 Ga0495605_0000672_2387_3412 330
391 3300046477 Ga0495664_0023716 Ga0495664_0023716_1135_2292 330
392 3300046500 Ga0495596_0002336 Ga0495596_0002336_549_1655 330
393 3300046501 Ga0495607_0000639 Ga0495607_0000639_26134_27159 330
394 3300046501 Ga0495607_0073643 Ga0495607_0073643_194_1219 330
395 3300046507 Ga0495606_0001551 Ga0495606_0001551_5286_6311 330
396 3300046516 Ga0495628_0002727 Ga0495628_0002727_11914_13071 330
397 3300046516 Ga0495628_0026149 Ga0495628_0026149_2943_4049 330
398 3300046516 Ga0495628_0047189 Ga0495628_0047189_999_2027 330
399 3300046517 Ga0495630_0006132 Ga0495630_0006132_610_1716 330
400 3300046517 Ga0495630_0048351 Ga0495630_0048351_16_1173 330
401 3300046522 Ga0495643_0001100 Ga0495643_0001100_22818_23843 330
402 3300046524 Ga0495648_0000742 Ga0495648_0000742_4862_5899 330
403 3300046524 Ga0495648_0000821 Ga0495648_0000821_5203_6228 330
404 3300046524 Ga0495648_0112721 Ga0495648_0112721_242_1348 330
405 3300046526 Ga0495666_0000650 Ga0495666_0000650_8463_9620 330
406 3300046526 Ga0495666_0008816 Ga0495666_0008816_1024_2052 330
407 3300046529 Ga0495652_0002143 Ga0495652_0002143_11786_12943 330
408 3300046530 Ga0495654_0000487 Ga0495654_0000487_5219_6244 330
409 3300046530 Ga0495654_0002608 Ga0495654_0002608_5165_6190 330
410 3300046531 Ga0495665_0006505 Ga0495665_0006505_139_1167 330
411 3300046531 Ga0495665_0009603 Ga0495665_0009603_2268_3425 330
412 3300046533 Ga0495640_0010398 Ga0495640_0010398_5993_7150 330
413 3300046535 Ga0495586_0000504 Ga0495586_0000504_8381_9538 330
414 3300046538 Ga0495609_0000689 Ga0495609_0000689_22479_23504 330
415 3300046543 Ga0495645_0005249 Ga0495645_0005249_1695_2852 330
416 3300046557 Ga0495622_0003438 Ga0495622_0003438_3696_4721 330
417 3300046557 Ga0495622_0091451 Ga0495622_0091451_147_1172 330
418 3300046642 Ga0495634_0009358 Ga0495634_0009358_3706_4863 330
419 3300046642 Ga0495634_0015713 Ga0495634_0015713_4232_5338 330
420 3300046663 Ga0495635_0001553 Ga0495635_0001553_4934_6040 330
421 3300046665 Ga0495661_0002251 Ga0495661_0002251_8605_9762 330
422 3300046679 Ga0495623_0005761 Ga0495623_0005761_214_1320 330
423 3300046680 Ga0495646_0002594 Ga0495646_0002594_7180_8337 330
424 3300046689 Ga0495613_0016251 Ga0495613_0016251_3154_4311 330
425 3300046690 Ga0495624_0004754 Ga0495624_0004754_6386_7414 330
426 3300046690 Ga0495624_0037495 Ga0495624_0037495_502_1659 330
427 3300046694 Ga0495649_0008297 Ga0495649_0008297_996_2024 330
428 3300046694 Ga0495649_0034496 Ga0495649_0034496_710_1735 330
429 3300046794 Ga0495589_0000504 Ga0495589_0000504_19012_20037 330
430 3300046794 Ga0495589_0000578 Ga0495589_0000578_21833_22858 330
431 3300046794 Ga0495589_0003801 Ga0495589_0003801_6405_7511 330
432 3300047315 Ga0495581_0016877 Ga0495581_0016877_1817_2974 330
433 3300047317 Ga0495604_0000827 Ga0495604_0000827_21020_22126 330
434 3300047317 Ga0495604_0087083 Ga0495604_0087083_1035_2192 330
435 3300047318 Ga0495636_0000132 Ga0495636_0000132_3555_4580 330
436 3300047319 Ga0495674_0035708 Ga0495674_0035708_263_1369 330
437 3300047319 Ga0495674_0062213 Ga0495674_0062213_1691_2719 330
438 3300047319 Ga0495674_0086348 Ga0495674_0086348_1193_2350 330
439 3300047320 Ga0495672_0000378 Ga0495672_0000378_28027_29052 330
440 3300047321 Ga0495676_0000157 Ga0495676_0000157_39290_40420 330
441 3300047321 Ga0495676_0053990 Ga0495676_0053990_1845_2873 330
442 3300047322 Ga0495680_0003077 Ga0495680_0003077_10177_11283 330
443 3300047322 Ga0495680_0005574 Ga0495680_0005574_8306_9463 330
444 3300047323 Ga0495683_0000320 Ga0495683_0000320_16018_17148 330
445 3300047323 Ga0495683_0000991 Ga0495683_0000991_7454_8560 330
446 3300047323 Ga0495683_0002448 Ga0495683_0002448_7792_8820 330
447 3300047444 Ga0495675_0001718 Ga0495675_0001718_1142_2248 330
448 3300047446 Ga0495679_000326 Ga0495679_000326_15324_16430 330
449 3300047446 Ga0495679_000812 Ga0495679_000812_8984_10009 330
450 3300047446 Ga0495679_006450 Ga0495679_006450_683_1840 330
451 3300047469 Ga0495673_0007082 Ga0495673_0007082_5134_6159 330
452 3300047673 Ga0495593_0001237 Ga0495593_0001237_668_1774 330
453 3300047673 Ga0495593_0033303 Ga0495593_0033303_207_1235 330
454 3300048088 Ga0495602_0002520 Ga0495602_0002520_9549_10706 330
455 3300048089 Ga0495614_0007342 Ga0495614_0007342_1270_2427 330
456 3300048091 Ga0495626_0000621 Ga0495626_0000621_28308_29333 330
457 3300048091 Ga0495626_0032846 Ga0495626_0032846_750_1778 330
458 3300048919 Ga0496116_0001011 Ga0496116_0001011_5828_6865 330
459 3300048920 Ga0496117_0001649 Ga0496117_0001649_24831_25868 330
460 3300048921 Ga0496118_0001895 Ga0496118_0001895_23278_24315 330
461 3300048922 Ga0496119_0001204 Ga0496119_0001204_4113_5150 330
462 3300048922 Ga0496119_0001356 Ga0496119_0001356_18956_19981 330
463 3300048923 Ga0496120_0001293 Ga0496120_0001293_26141_27178 330
464 3300048923 Ga0496120_0001399 Ga0496120_0001399_9714_10739 330
465 3300048924 Ga0496121_0001685 Ga0496121_0001685_25162_26187 330
466 3300048927 Ga0496124_0000699 Ga0496124_0000699_19117_20142 330
467 3300048927 Ga0496124_0125107 Ga0496124_0125107_349_1386 330
468 3300048928 Ga0496125_0000714 Ga0496125_0000714_19016_20041 330
469 3300049460 Ga0495682_0011220 Ga0495682_0011220_441_1466 330
470 3300049460 Ga0495682_0031698 Ga0495682_0031698_246_1271 330
471 3300049758 Ga0501241_000477 Ga0501241_000477_708_1733 330
472 3300049853 Ga0501226_001491 Ga0501226_001491_940_1980 330
473 3300053121 Ga0500607_077614 Ga0500607_077614_340_1365 330
474 3300053126 Ga0500621_000036 Ga0500621_000036_19815_20840 330
475 3300053177 Ga0500636_0001254 Ga0500636_0001254_4429_5454 330
476 iso_pu_bacteria 2751185846 2753565966 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

52

217

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sjq-assembly1.cif.gz_D crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin 0.8872 219 288
3sjq-assembly1.cif.gz_C crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin 0.8787 217 288
2ic6-assembly1.cif.gz_A the coiled-coil domain (residues 1-75) structure of the sin nombre virus nucleocapsid protein 0.8545 215 287
3fd9-assembly1.cif.gz_C crystal structure of the transcriptional anti-activator exsd from pseudomonas aeruginosa 0.8524 211 286
4i9q-assembly2.cif.gz_B crystal structure of the ternary complex of the d714a mutant of rb69 dna polymerase 0.8451 214 289
ID Description Score Start End Superfamily
af_Q12462_15_232_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.8855 219 277 1.20.1420.10
2ic6A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8545 215 287 1.20.58.90
af_Q20957_1_199_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8512 223 276 1.20.140.150
2ic6A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8333 215 287 1.20.58.90
4i9qB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.8249 211 289 1.10.287.690
ID Description Score Start End GO Terms
AF-A0A519TPW0-F1-model_v4 deleted 0.985 1 89
AF-A0A519TPW0-F1-model_v4 deleted 0.9741 1 89
AF-A0A2T0HJN0-F1-model_v4 deleted 0.9654 1 131
AF-A0A4Q3NN73-F1-model_v4 deleted 0.9082 1 162
AF-A0A3M1SXJ7-F1-model_v4 Glycosyltransferase 0.8976 1 198 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
78.63 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map