F451538

General Info

Members Datasets Scaffolds Average Seq Length
476 178 476 247

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_10088568|Ga0207711_100885682
Length 287
Sequence MMKWMLAPIALLFATVGAAQPTQSTMTTTVQPMPAVAQPAPWDPAAPYITAGQDEPGYRSWYVAAPWRAAQVKQFNDYLRGADVGGIVPTWQLLRTATSWKDCGQQPFEIPPTSEWPHMVQTLRYIRDYVVPAVGPVEPVSVYRNPALNACAGGAPESAHKLDSAVDLVPLKPIDRITLMRTLCAGHSEHGAPYNAGLGFYAYLRFHIDSTKYRRWNMDPAVAAECPPLIHPEDIASVGQPLPTASVTAPNASGPAXAAGPVCHGRASGCSGGKQTGTRPTALGLKP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.35
Rhizosphere 92.23
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010350 3300001979 Bacteria 3601
2 JGI24739J22299_10051984 3300001989 Bacteria 1319
3 JGI24737J22298_10005431 3300001990 Bacteria 4401
4 JGI24735J21928_10017310 3300002067 Bacteria 2230
5 JGI24745J21846_1004912 3300002073 Bacteria 1444
6 JGI24738J21930_10007870 3300002075 Bacteria 2441
7 JGI24744J21845_10001038 3300002077 Bacteria 5344
8 Ga0065715_10113151 3300005293 Bacteria 2501
9 Ga0070658_10010999 3300005327 Bacteria 7253
10 Ga0070658_10049401 3300005327 Bacteria 3407
11 Ga0070658_10085977 3300005327 Bacteria 2586
12 Ga0070658_10162665 3300005327 Bacteria 1873
13 Ga0070658_10381335 3300005327 Bacteria 1209
14 Ga0070658_10402784 3300005327 Bacteria 1175
15 Ga0070658_10505593 3300005327 Unclassified 1044
16 Ga0070676_10009070 3300005328 Bacteria 5382
17 Ga0070683_100065398 3300005329 Bacteria 3386
18 Ga0070683_100432062 3300005329 Bacteria 1256
19 Ga0070690_100017691 3300005330 Bacteria 4292
20 Ga0070690_100037331 3300005330 Bacteria 3061
21 Ga0070670_100018663 3300005331 Bacteria 5944
22 Ga0070670_100028376 3300005331 Bacteria 4816
23 Ga0070670_100078428 3300005331 Bacteria 2837
24 Ga0070666_10000175 3300005335 Bacteria 43927
25 Ga0070666_10044867 3300005335 Bacteria 2963
26 Ga0070666_10048254 3300005335 Bacteria 2861
27 Ga0070680_100004504 3300005336 Bacteria 10494
28 Ga0070680_100070158 3300005336 Bacteria 2878
29 Ga0070680_100086601 3300005336 Bacteria 2589
30 Ga0070680_100150638 3300005336 Bacteria 1953
31 Ga0070680_100371522 3300005336 Bacteria 1217
32 Ga0070682_100033548 3300005337 Bacteria 3120
33 Ga0068868_100005026 3300005338 Bacteria 9288
34 Ga0068868_100392255 3300005338 Bacteria 1196
35 Ga0070660_100004849 3300005339 Bacteria 9291
36 Ga0070660_100012989 3300005339 Bacteria 5960
37 Ga0070660_100069281 3300005339 Bacteria 2750
38 Ga0070660_100079524 3300005339 Bacteria 2572
39 Ga0070691_10007681 3300005341 Bacteria 4943
40 Ga0070687_100078455 3300005343 Bacteria 1795
41 Ga0070661_100007917 3300005344 Bacteria 7340
42 Ga0070661_100025857 3300005344 Bacteria 4219
43 Ga0070661_100031729 3300005344 Bacteria 3821
44 Ga0070661_100042821 3300005344 Bacteria 3306
45 Ga0070661_100110185 3300005344 Bacteria 2055
46 Ga0070661_100340125 3300005344 Bacteria 1175
47 Ga0070692_10001877 3300005345 Bacteria 7910
48 Ga0070692_10198600 3300005345 Bacteria 1173
49 Ga0070668_100011379 3300005347 Bacteria 6628
50 Ga0070668_100154730 3300005347 Bacteria 1857
51 Ga0070668_100416129 3300005347 Bacteria 1150
52 Ga0070675_100029277 3300005354 Bacteria 4440
53 Ga0070675_100060523 3300005354 Bacteria 3126
54 Ga0070675_100609740 3300005354 Bacteria 990
55 Ga0070671_100002350 3300005355 Bacteria 14596
56 Ga0070671_100061904 3300005355 Bacteria 3116
57 Ga0070671_100079204 3300005355 Bacteria 2746
58 Ga0070671_100082985 3300005355 Bacteria 2680
59 Ga0070674_100001005 3300005356 Bacteria 14717
60 Ga0070674_100002384 3300005356 Bacteria 10386
61 Ga0070674_100003417 3300005356 Bacteria 8907
62 Ga0070674_100107705 3300005356 Bacteria 2041
63 Ga0070674_100162767 3300005356 Bacteria 1694
64 Ga0070674_100225580 3300005356 Bacteria 1460
65 Ga0070673_100018889 3300005364 Bacteria 4940
66 Ga0070673_100136180 3300005364 Bacteria 2067
67 Ga0070673_100167938 3300005364 Bacteria 1871
68 Ga0070659_100000992 3300005366 Bacteria 20821
69 Ga0070659_100065109 3300005366 Bacteria 2886
70 Ga0070659_100084273 3300005366 Bacteria 2542
71 Ga0070659_100132528 3300005366 Bacteria 2025
72 Ga0070667_100001408 3300005367 Bacteria 21504
73 Ga0070667_100003855 3300005367 Bacteria 12735
74 Ga0070667_100058269 3300005367 Bacteria 3266
75 Ga0070667_100273991 3300005367 Bacteria 1514
76 Ga0070667_100453832 3300005367 Bacteria 1171
77 Ga0070713_100261689 3300005436 Bacteria 1581
78 Ga0070663_100005666 3300005455 Bacteria 7441
79 Ga0070663_100053126 3300005455 Bacteria 2891
80 Ga0070663_100259599 3300005455 Bacteria 1378
81 Ga0070678_100010289 3300005456 Bacteria 5706
82 Ga0070678_100016637 3300005456 Bacteria 4711
83 Ga0070678_100026069 3300005456 Bacteria 3946
84 Ga0070678_100026663 3300005456 Bacteria 3911
85 Ga0070678_100100922 3300005456 Bacteria 2236
86 Ga0070678_100280196 3300005456 Unclassified 1409
87 Ga0070662_100011388 3300005457 Bacteria 5870
88 Ga0070662_100014199 3300005457 Bacteria 5315
89 Ga0070662_100015039 3300005457 Bacteria 5176
90 Ga0070662_100054163 3300005457 Bacteria 2907
91 Ga0070662_100060258 3300005457 Bacteria 2767
92 Ga0070662_100070560 3300005457 Bacteria 2574
93 Ga0070662_100301228 3300005457 Bacteria 1302
94 Ga0070681_10100772 3300005458 Bacteria 2834
95 Ga0068867_100051586 3300005459 Bacteria 3034
96 Ga0068867_100097657 3300005459 Bacteria 2238
97 Ga0068867_100135803 3300005459 Bacteria 1917
98 Ga0070679_100002835 3300005530 Bacteria 15761
99 Ga0070679_100254282 3300005530 Bacteria 1712
100 Ga0070684_100001026 3300005535 Bacteria 19914
101 Ga0070684_100283093 3300005535 Bacteria 1519
102 Ga0068853_100221215 3300005539 Bacteria 1729
103 Ga0068853_100224956 3300005539 Bacteria 1715
104 Ga0070672_100034084 3300005543 Bacteria 3861
105 Ga0070672_100074979 3300005543 Bacteria 2700
106 Ga0070672_100087333 3300005543 Bacteria 2509
107 Ga0070672_100144325 3300005543 Bacteria 1966
108 Ga0070672_100482418 3300005543 Unclassified 1071
109 Ga0070686_100048833 3300005544 Bacteria 2683
110 Ga0070693_100291170 3300005547 Bacteria 1097
111 Ga0070665_100016180 3300005548 Bacteria 7484
112 Ga0070665_100017108 3300005548 Bacteria 7273
113 Ga0070665_100090739 3300005548 Bacteria 3061
114 Ga0068855_100002695 3300005563 Bacteria 21894
115 Ga0068855_100006137 3300005563 Bacteria 14646
116 Ga0068855_100259419 3300005563 Bacteria 1937
117 Ga0068855_100583724 3300005563 Bacteria 1207
118 Ga0070664_100001303 3300005564 Bacteria 19939
119 Ga0070664_100004154 3300005564 Bacteria 11633
120 Ga0070664_100007167 3300005564 Bacteria 8988
121 Ga0070664_100101010 3300005564 Bacteria 2508
122 Ga0070664_100105231 3300005564 Bacteria 2457
123 Ga0070664_100168428 3300005564 Bacteria 1942
124 Ga0068857_100026887 3300005577 Bacteria 5073
125 Ga0068857_100056859 3300005577 Bacteria 3472
126 Ga0068857_100076385 3300005577 Bacteria 2987
127 Ga0068857_100147825 3300005577 Bacteria 2127
128 Ga0068854_100010218 3300005578 Bacteria 6082
129 Ga0068854_100078770 3300005578 Bacteria 2428
130 Ga0068856_100008516 3300005614 Bacteria 9973
131 Ga0068856_100087037 3300005614 Bacteria 3105
132 Ga0068852_100062470 3300005616 Bacteria 3240
133 Ga0068852_100080237 3300005616 Bacteria 2892
134 Ga0068852_100084067 3300005616 Bacteria 2831
135 Ga0068852_100097361 3300005616 Bacteria 2647
136 Ga0068852_100114799 3300005616 Bacteria 2454
137 Ga0068852_100186681 3300005616 Bacteria 1953
138 Ga0068859_100056567 3300005617 Bacteria 3949
139 Ga0068859_100075737 3300005617 Bacteria 3405
140 Ga0068859_100376317 3300005617 Bacteria 1516
141 Ga0068859_100457861 3300005617 Bacteria 1372
142 Ga0068864_100007190 3300005618 Bacteria 9145
143 Ga0068864_100050044 3300005618 Bacteria 3595
144 Ga0068851_10074982 3300005834 Bacteria 1757
145 Ga0068851_10139309 3300005834 Unclassified 1318
146 Ga0068863_100037591 3300005841 Bacteria 4609
147 Ga0068863_100068106 3300005841 Bacteria 3367
148 Ga0068863_100083929 3300005841 Bacteria 3019
149 Ga0068863_100167900 3300005841 Bacteria 2104
150 Ga0068858_100001465 3300005842 Bacteria 24278
151 Ga0068858_100013766 3300005842 Bacteria 7636
152 Ga0068858_100591507 3300005842 Bacteria 1076
153 Ga0068860_100232633 3300005843 Unclassified 1791
154 Ga0068860_100370246 3300005843 Bacteria 1413
155 Ga0097621_100135679 3300006237 Bacteria 2099
156 Ga0097621_100221346 3300006237 Bacteria 1649
157 Ga0097621_100235097 3300006237 Archaea 1601
158 Ga0068871_100172437 3300006358 Bacteria 1855
159 Ga0068865_100010238 3300006881 Bacteria 5831
160 Ga0068865_100016591 3300006881 Bacteria 4716
161 Ga0097620_100056566 3300006931 Bacteria 3949
162 Ga0097620_100075737 3300006931 Bacteria 3405
163 Ga0097620_100376327 3300006931 Bacteria 1516
164 Ga0097620_100457863 3300006931 Bacteria 1372
165 Ga0105251_10068088 3300009011 Bacteria 1662
166 Ga0105240_10210606 3300009093 Bacteria 2272
167 Ga0105240_10262723 3300009093 Bacteria 1991
168 Ga0105240_10301887 3300009093 Bacteria 1831
169 Ga0105245_10073009 3300009098 Bacteria 3118
170 Ga0105243_10111137 3300009148 Bacteria 2293
171 Ga0105241_10446969 3300009174 Unclassified 1143
172 Ga0105241_10574735 3300009174 Bacteria 1015
173 Ga0105242_10079951 3300009176 Bacteria 2731
174 Ga0105248_10000818 3300009177 Bacteria 34897
175 Ga0105248_10008738 3300009177 Bacteria 11126
176 Ga0105248_10015579 3300009177 Bacteria 8381
177 Ga0105248_10108753 3300009177 Bacteria 3126
178 Ga0105248_10170905 3300009177 Bacteria 2450
179 Ga0105248_10179809 3300009177 Bacteria 2383
180 Ga0105248_10535569 3300009177 Bacteria 1321
181 Ga0105248_10594905 3300009177 Bacteria 1248
182 Ga0105237_10047618 3300009545 Bacteria 4309
183 Ga0105237_10058748 3300009545 Bacteria 3849
184 Ga0105238_10006724 3300009551 Bacteria 11478
185 Ga0105238_10012329 3300009551 Bacteria 8621
186 Ga0105239_10135243 3300010375 Bacteria 2744
187 Ga0105246_10096885 3300011119 Bacteria 2139
188 Ga0105246_10151728 3300011119 Bacteria 1755
189 Ga0157373_10062455 3300013100 Bacteria 2638
190 Ga0157373_10111875 3300013100 Bacteria 1920
191 Ga0157371_10008803 3300013102 Bacteria 7996
192 Ga0157371_10052947 3300013102 Bacteria 2882
193 Ga0157371_10067992 3300013102 Bacteria 2521
194 Ga0157371_10118533 3300013102 Bacteria 1882
195 Ga0157371_10132001 3300013102 Bacteria 1777
196 Ga0157371_10229451 3300013102 Unclassified 1334
197 Ga0157371_10322407 3300013102 Unclassified 1121
198 Ga0157370_10146994 3300013104 Bacteria 2194
199 Ga0157370_10147498 3300013104 Bacteria 2190
200 Ga0157369_10000207 3300013105 Bacteria 81678
201 Ga0157369_10072149 3300013105 Bacteria 3706
202 Ga0157369_10168231 3300013105 Bacteria 2311
203 Ga0157369_10197598 3300013105 Bacteria 2111
204 Ga0157369_10198459 3300013105 Bacteria 2106
205 Ga0157369_10653244 3300013105 Bacteria 1084
206 Ga0157374_10123807 3300013296 Bacteria 2498
207 Ga0157374_10249225 3300013296 Bacteria 1747
208 Ga0157378_10085141 3300013297 Bacteria 2864
209 Ga0163162_10017617 3300013306 Bacteria 6989
210 Ga0163162_10370189 3300013306 Bacteria 1566
211 Ga0163162_10702172 3300013306 Bacteria 1133
212 Ga0157372_10131090 3300013307 Bacteria 2884
213 Ga0157372_10193340 3300013307 Bacteria 2357
214 Ga0157375_10040943 3300013308 Bacteria 4470
215 Ga0157375_10077378 3300013308 Bacteria 3356
216 Ga0157375_10173056 3300013308 Bacteria 2308
217 Ga0157375_10216120 3300013308 Bacteria 2075
218 Ga0157375_10232399 3300013308 Bacteria 2003
219 Ga0157375_10465657 3300013308 Bacteria 1429
220 Ga0163163_10017377 3300014325 Bacteria 6707
221 Ga0163163_10319923 3300014325 Bacteria 1605
222 Ga0157380_10375797 3300014326 Bacteria 1339
223 Ga0182008_10217994 3300014497 Bacteria 976
224 Ga0157379_10009768 3300014968 Bacteria 8360
225 Ga0157379_10197261 3300014968 Bacteria 1819
226 Ga0163161_10057282 3300017792 Bacteria 2831
227 Ga0213875_10009496 3300021388 Bacteria 4926
228 Ga0207697_10017711 3300025315 Bacteria 2926
229 Ga0207656_10033926 3300025321 Bacteria 2128
230 Ga0207656_10049836 3300025321 Bacteria 1807
231 Ga0207656_10123085 3300025321 Unclassified 1209
232 Ga0207656_10186844 3300025321 Unclassified 996
233 Ga0207682_10027136 3300025893 Bacteria 2279
234 Ga0207688_10030565 3300025901 Bacteria 2971
235 Ga0207680_10003241 3300025903 Bacteria 7661
236 Ga0207680_10017057 3300025903 Bacteria 3828
237 Ga0207680_10062848 3300025903 Bacteria 2270
238 Ga0207680_10067342 3300025903 Bacteria 2206
239 Ga0207647_10003773 3300025904 Bacteria 11329
240 Ga0207647_10004965 3300025904 Bacteria 9807
241 Ga0207647_10006911 3300025904 Bacteria 8227
242 Ga0207647_10065458 3300025904 Bacteria 2206
243 Ga0207645_10046979 3300025907 Bacteria 2757
244 Ga0207645_10130583 3300025907 Bacteria 1635
245 Ga0207643_10106019 3300025908 Bacteria 1652
246 Ga0207705_10000382 3300025909 Bacteria 39603
247 Ga0207705_10000942 3300025909 Bacteria 23772
248 Ga0207705_10021892 3300025909 Bacteria 4560
249 Ga0207705_10023301 3300025909 Bacteria 4417
250 Ga0207705_10023836 3300025909 Bacteria 4366
251 Ga0207705_10066922 3300025909 Bacteria 2599
252 Ga0207705_10139185 3300025909 Bacteria 1811
253 Ga0207705_10191763 3300025909 Bacteria 1546
254 Ga0207654_10140053 3300025911 Unclassified 1541
255 Ga0207654_10194868 3300025911 Bacteria 1330
256 Ga0207707_10016093 3300025912 Bacteria 6523
257 Ga0207707_10062121 3300025912 Bacteria 3250
258 Ga0207695_10055479 3300025913 Bacteria 4129
259 Ga0207671_10049834 3300025914 Bacteria 3101
260 Ga0207660_10007465 3300025917 Bacteria 7071
261 Ga0207662_10128810 3300025918 Bacteria 1594
262 Ga0207657_10000966 3300025919 Bacteria 30468
263 Ga0207657_10001753 3300025919 Bacteria 23414
264 Ga0207657_10003169 3300025919 Bacteria 17602
265 Ga0207657_10005126 3300025919 Bacteria 13730
266 Ga0207657_10005658 3300025919 Bacteria 13043
267 Ga0207657_10056516 3300025919 Bacteria 3386
268 Ga0207657_10064185 3300025919 Bacteria 3135
269 Ga0207657_10316395 3300025919 Unclassified 1235
270 Ga0207649_10015663 3300025920 Bacteria 4260
271 Ga0207649_10064319 3300025920 Bacteria 2319
272 Ga0207649_10087397 3300025920 Bacteria 2034
273 Ga0207652_10000875 3300025921 Bacteria 28516
274 Ga0207681_10008711 3300025923 Bacteria 6195
275 Ga0207694_10069885 3300025924 Bacteria 2744
276 Ga0207694_10103012 3300025924 Bacteria 2263
277 Ga0207650_10008672 3300025925 Bacteria 6947
278 Ga0207659_10113155 3300025926 Bacteria 2066
279 Ga0207659_10531605 3300025926 Bacteria 998
280 Ga0207687_10141118 3300025927 Bacteria 1828
281 Ga0207644_10065503 3300025931 Bacteria 2642
282 Ga0207644_10073001 3300025931 Bacteria 2515
283 Ga0207644_10103907 3300025931 Bacteria 2138
284 Ga0207690_10001341 3300025932 Bacteria 15473
285 Ga0207690_10014947 3300025932 Bacteria 4700
286 Ga0207690_10019577 3300025932 Bacteria 4171
287 Ga0207690_10131092 3300025932 Bacteria 1835
288 Ga0207690_10143711 3300025932 Bacteria 1761
289 Ga0207706_10012690 3300025933 Bacteria 7669
290 Ga0207706_10013653 3300025933 Bacteria 7376
291 Ga0207706_10046516 3300025933 Bacteria 3841
292 Ga0207706_10068047 3300025933 Bacteria 3134
293 Ga0207706_10070485 3300025933 Bacteria 3075
294 Ga0207706_10147537 3300025933 Bacteria 2069
295 Ga0207686_10107153 3300025934 Bacteria 1877
296 Ga0207670_10187491 3300025936 Bacteria 1563
297 Ga0207669_10002310 3300025937 Bacteria 8110
298 Ga0207669_10041154 3300025937 Bacteria 2687
299 Ga0207669_10110868 3300025937 Bacteria 1838
300 Ga0207704_10070817 3300025938 Bacteria 2210
301 Ga0207704_10083513 3300025938 Bacteria 2073
302 Ga0207704_10128412 3300025938 Bacteria 1750
303 Ga0207704_10129087 3300025938 Bacteria 1746
304 Ga0207691_10003204 3300025940 Bacteria 15961
305 Ga0207691_10011977 3300025940 Bacteria 8319
306 Ga0207691_10026686 3300025940 Bacteria 5420
307 Ga0207691_10029479 3300025940 Bacteria 5134
308 Ga0207691_10070205 3300025940 Bacteria 3163
309 Ga0207691_10112990 3300025940 Bacteria 2414
310 Ga0207691_10244712 3300025940 Bacteria 1550
311 Ga0207691_10326701 3300025940 Bacteria 1315
312 Ga0207711_10000193 3300025941 Bacteria 65165
313 Ga0207711_10014767 3300025941 Bacteria 6490
314 Ga0207711_10016440 3300025941 Bacteria 6149
315 Ga0207711_10043780 3300025941 Bacteria 3820
316 Ga0207711_10078656 3300025941 Bacteria 2877
317 Ga0207711_10088568 3300025941 Bacteria 2718
318 Ga0207689_10097848 3300025942 Bacteria 2410
319 Ga0207661_10052755 3300025944 Bacteria 3250
320 Ga0207661_10110049 3300025944 Bacteria 2328
321 Ga0207661_10235351 3300025944 Bacteria 1623
322 Ga0207679_10020212 3300025945 Bacteria 4490
323 Ga0207679_10053806 3300025945 Bacteria 2960
324 Ga0207679_10107501 3300025945 Bacteria 2195
325 Ga0207679_10178545 3300025945 Bacteria 1754
326 Ga0207667_10002493 3300025949 Bacteria 22937
327 Ga0207667_10002562 3300025949 Bacteria 22613
328 Ga0207667_10036587 3300025949 Bacteria 5259
329 Ga0207667_10677638 3300025949 Bacteria 1035
330 Ga0207651_10024497 3300025960 Bacteria 3734
331 Ga0207651_10071587 3300025960 Bacteria 2458
332 Ga0207651_10330889 3300025960 Bacteria 1276
333 Ga0207668_10000101 3300025972 Bacteria 60529
334 Ga0207640_10006207 3300025981 Bacteria 6544
335 Ga0207640_10099629 3300025981 Bacteria 2034
336 Ga0207658_10006832 3300025986 Bacteria 7777
337 Ga0207658_10016010 3300025986 Bacteria 5151
338 Ga0207658_10117779 3300025986 Bacteria 2112
339 Ga0207658_10233212 3300025986 Bacteria 1555
340 Ga0207703_10001723 3300026035 Bacteria 19664
341 Ga0207703_10241751 3300026035 Bacteria 1623
342 Ga0207639_10004341 3300026041 Bacteria 9559
343 Ga0207678_10006058 3300026067 Bacteria 10756
344 Ga0207678_10062017 3300026067 Bacteria 3215
345 Ga0207678_10083319 3300026067 Bacteria 2735
346 Ga0207678_10167582 3300026067 Bacteria 1875
347 Ga0207702_10028532 3300026078 Bacteria 4639
348 Ga0207702_10041570 3300026078 Bacteria 3855
349 Ga0207702_10095301 3300026078 Bacteria 2614
350 Ga0207641_10026245 3300026088 Bacteria 4807
351 Ga0207641_10042335 3300026088 Bacteria 3820
352 Ga0207641_10151651 3300026088 Bacteria 2099
353 Ga0207641_10716344 3300026088 Bacteria 986
354 Ga0207648_10003513 3300026089 Bacteria 16421
355 Ga0207648_10008369 3300026089 Bacteria 10027
356 Ga0207648_10173025 3300026089 Bacteria 1909
357 Ga0207676_10030608 3300026095 Bacteria 4041
358 Ga0207676_10082736 3300026095 Bacteria 2612
359 Ga0207676_10181541 3300026095 Bacteria 1843
360 Ga0207674_10001888 3300026116 Bacteria 26661
361 Ga0207674_10008585 3300026116 Bacteria 11776
362 Ga0207674_10066040 3300026116 Bacteria 3645
363 Ga0207674_10367946 3300026116 Unclassified 1390
364 Ga0207675_100359406 3300026118 Bacteria 1428
365 Ga0207683_10004291 3300026121 Bacteria 12313
366 Ga0207683_10015098 3300026121 Bacteria 6573
367 Ga0207683_10022524 3300026121 Bacteria 5407
368 Ga0207683_10056383 3300026121 Bacteria 3446
369 Ga0207683_10185286 3300026121 Bacteria 1888
370 Ga0207683_10378588 3300026121 Bacteria 1301
371 Ga0207698_10008371 3300026142 Bacteria 6538
372 Ga0207698_10093926 3300026142 Bacteria 2464
373 Ga0207698_10114411 3300026142 Bacteria 2269
374 Ga0207698_10239852 3300026142 Bacteria 1651
375 Ga0268266_10081457 3300028379 Bacteria 2822
376 Ga0268264_10247393 3300028381 Bacteria 1655
377 Ga0307408_100206471 3300031548 Bacteria 1594
378 Ga0307405_10037513 3300031731 Bacteria 2913
379 Ga0307416_100407673 3300032002 Bacteria 1399
380 Ga0307415_100013096 3300032126 Bacteria 4826
381 Ga0373955_0095801 3300035172 Bacteria 1698
382 Ga0373937_0404133 3300036401 Bacteria 1296
383 Ga0395899_0001715 3300037312 Bacteria 18225
384 Ga0395899_0013958 3300037312 Bacteria 6134
385 Ga0395899_0018912 3300037312 Bacteria 5235
386 Ga0395899_0028620 3300037312 Bacteria 4194
387 Ga0395899_0033684 3300037312 Bacteria 3846
388 Ga0395899_0041491 3300037312 Bacteria 3438
389 Ga0395899_0052464 3300037312 Bacteria 3022
390 Ga0395899_0056609 3300037312 Bacteria 2897
391 Ga0395900_0000289 3300037418 Bacteria 75525
392 Ga0395900_0000840 3300037418 Bacteria 40454
393 Ga0395900_0046298 3300037418 Bacteria 4479
394 Ga0395900_0110557 3300037418 Bacteria 2823
395 Ga0395900_0124425 3300037418 Bacteria 2644
396 Ga0395900_0160655 3300037418 Bacteria 2292
397 Ga0395900_0214540 3300037418 Bacteria 1942
398 Ga0395900_0220396 3300037418 Bacteria 1912
399 Ga0395900_0243348 3300037418 Bacteria 1804
400 Ga0395900_0250628 3300037418 Bacteria 1772
401 Ga0395900_0459920 3300037418 Bacteria 1227
402 Ga0395898_0006021 3300037466 Bacteria 13028
403 Ga0395898_0017933 3300037466 Bacteria 7223
404 Ga0395898_0018903 3300037466 Bacteria 7020
405 Ga0395898_0037462 3300037466 Bacteria 4810
406 Ga0395898_0065239 3300037466 Bacteria 3530
407 Ga0395898_0084938 3300037466 Bacteria 3051
408 Ga0395898_0384478 3300037466 Bacteria 1338
409 Ga0395905_0010406 3300037471 Bacteria 9055
410 Ga0395905_0010642 3300037471 Bacteria 8924
411 Ga0395905_0011321 3300037471 Bacteria 8626
412 Ga0395905_0013361 3300037471 Bacteria 7868
413 Ga0395905_0047957 3300037471 Bacteria 4003
414 Ga0395905_0063978 3300037471 Bacteria 3442
415 Ga0395905_0086904 3300037471 Bacteria 2931
416 Ga0395905_0230853 3300037471 Bacteria 1730
417 Ga0395905_0307360 3300037471 Bacteria 1474
418 Ga0436364_1159415 3300037853 Bacteria 4926
419 Ga0395901_0000783 3300038443 Bacteria 35511
420 Ga0395901_0000876 3300038443 Bacteria 33203
421 Ga0395901_0064180 3300038443 Bacteria 3822
422 Ga0395901_0071430 3300038443 Bacteria 3617
423 Ga0395901_0095809 3300038443 Bacteria 3110
424 Ga0395901_0120861 3300038443 Bacteria 2752
425 Ga0395901_0350247 3300038443 Bacteria 1524
426 Ga0439432_014057 3300042006 Bacteria 2712
427 Ga0466969_0147157 3300044656 Bacteria 1086
428 Ga0466966_0036316 3300044684 Bacteria 3182
429 Ga0466963_0109356 3300044694 Bacteria 1896
430 Ga0466971_0016023 3300044719 Bacteria 3304
431 Ga0466957_0075879 3300044842 Bacteria 2086
432 Ga0466958_0004199 3300045836 Bacteria 7574
433 Ga0495598_0001042 3300046537 Bacteria 5327
434 Ga0495621_0000147 3300046539 Bacteria 15233
435 Ga0495621_0074057 3300046539 Bacteria 1259
436 Ga0495633_0039345 3300046558 Bacteria 2257
437 Ga0495669_0039499 3300046684 Bacteria 2090
438 Ga0495670_0000192 3300046691 Bacteria 27204
439 Ga0495677_0076027 3300047445 Unclassified 1255
440 Ga0496100_0011228 3300048903 Bacteria 5094
441 Ga0496100_0014810 3300048903 Bacteria 4537
442 Ga0496101_0009177 3300048904 Bacteria 6491
443 Ga0496101_0012548 3300048904 Bacteria 5657
444 Ga0496103_0015783 3300048906 Bacteria 4502
445 Ga0496103_0066432 3300048906 Bacteria 2251
446 Ga0496103_0157264 3300048906 Bacteria 1457
447 Ga0496104_0098857 3300048907 Bacteria 2793
448 Ga0496104_0160077 3300048907 Bacteria 2160
449 Ga0496105_0075364 3300048908 Bacteria 2786
450 Ga0496106_0100069 3300048909 Bacteria 2248
451 Ga0496106_0112090 3300048909 Bacteria 2125
452 Ga0496106_0158362 3300048909 Bacteria 1790
453 Ga0496106_0199554 3300048909 Bacteria 1592
454 Ga0496107_0144210 3300048910 Bacteria 1760
455 Ga0496108_0032108 3300048911 Bacteria 4359
456 Ga0496108_0034504 3300048911 Bacteria 4204
457 Ga0496109_0003077 3300048912 Bacteria 13911
458 Ga0496109_0104842 3300048912 Bacteria 2625
459 Ga0496109_0413137 3300048912 Bacteria 1275
460 Ga0496110_0034694 3300048913 Bacteria 4372
461 Ga0496110_0271981 3300048913 Bacteria 1542
462 Ga0496111_0024374 3300048914 Bacteria 4259
463 Ga0496111_0054622 3300048914 Bacteria 2887
464 Ga0496112_0018169 3300048915 Bacteria 6617
465 Ga0496112_0028192 3300048915 Bacteria 5417
466 Ga0496112_0051599 3300048915 Bacteria 4034
467 Ga0496112_0055936 3300048915 Bacteria 3882
468 Ga0496112_0099954 3300048915 Bacteria 2871
469 Ga0496113_0024059 3300048916 Bacteria 4324
470 Ga0496113_0033465 3300048916 Bacteria 3742
471 Ga0496113_0595189 3300048916 Bacteria 886
472 Ga0496114_0000029 3300048917 Bacteria 175132
473 Ga0496114_0049302 3300048917 Bacteria 3503
474 Ga0496115_0014491 3300048918 Bacteria 5969
475 Ga0466962_0010032 3300061719 Bacteria 4546
476 Ga0466962_0115307 3300061719 Bacteria 1294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0160655 Ga0395900_0160655_338_1216 211
2 3300037471 Ga0395905_0010406 Ga0395905_0010406_1450_2328 212
3 3300044684 Ga0466966_0036316 Ga0466966_0036316_130_1023 212
4 3300044694 Ga0466963_0109356 Ga0466963_0109356_428_1321 212
5 3300044842 Ga0466957_0075879 Ga0466957_0075879_81_974 212
6 3300045836 Ga0466958_0004199 Ga0466958_0004199_4956_5849 212
7 3300061719 Ga0466962_0115307 Ga0466962_0115307_98_991 212
8 3300013306 Ga0163162_10370189 Ga0163162_103701892 214
9 3300005436 Ga0070713_100261689 Ga0070713_1002616892 215
10 3300037312 Ga0395899_0018912 Ga0395899_0018912_2186_3079 215
11 3300005539 Ga0068853_100221215 Ga0068853_1002212153 216
12 3300009177 Ga0105248_10594905 Ga0105248_105949052 216
13 3300048909 Ga0496106_0112090 Ga0496106_0112090_892_1746 216
14 3300005547 Ga0070693_100291170 Ga0070693_1002911701 217
15 3300013102 Ga0157371_10229451 Ga0157371_102294512 217
16 3300025981 Ga0207640_10099629 Ga0207640_100996293 217
17 3300005367 Ga0070667_100453832 Ga0070667_1004538322 218
18 3300005843 Ga0068860_100232633 Ga0068860_1002326333 218
19 3300025942 Ga0207689_10097848 Ga0207689_100978482 218
20 3300037418 Ga0395900_0250628 Ga0395900_0250628_79_975 218
21 3300037471 Ga0395905_0307360 Ga0395905_0307360_528_1424 218
22 3300048907 Ga0496104_0160077 Ga0496104_0160077_920_1774 218
23 3300048914 Ga0496111_0024374 Ga0496111_0024374_1263_2117 218
24 3300005339 Ga0070660_100004849 Ga0070660_1000048499 219
25 3300005616 Ga0068852_100084067 Ga0068852_1000840671 219
26 3300005834 Ga0068851_10139309 Ga0068851_101393092 219
27 3300025321 Ga0207656_10123085 Ga0207656_101230852 219
28 3300025919 Ga0207657_10064185 Ga0207657_100641852 219
29 3300026142 Ga0207698_10114411 Ga0207698_101144113 219
30 3300005344 Ga0070661_100031729 Ga0070661_1000317292 220
31 3300005366 Ga0070659_100065109 Ga0070659_1000651093 220
32 3300005457 Ga0070662_100054163 Ga0070662_1000541632 220
33 3300005564 Ga0070664_100105231 Ga0070664_1001052313 220
34 3300005577 Ga0068857_100026887 Ga0068857_1000268875 220
35 3300005577 Ga0068857_100147825 Ga0068857_1001478253 220
36 3300005617 Ga0068859_100075737 Ga0068859_1000757375 220
37 3300005618 Ga0068864_100007190 Ga0068864_1000071908 220
38 3300005841 Ga0068863_100037591 Ga0068863_1000375913 220
39 3300005841 Ga0068863_100068106 Ga0068863_1000681065 220
40 3300005842 Ga0068858_100591507 Ga0068858_1005915072 220
41 3300006237 Ga0097621_100135679 Ga0097621_1001356793 220
42 3300006931 Ga0097620_100075737 Ga0097620_1000757372 220
43 3300009011 Ga0105251_10068088 Ga0105251_100680881 220
44 3300009177 Ga0105248_10108753 Ga0105248_101087533 220
45 3300009545 Ga0105237_10047618 Ga0105237_100476185 220
46 3300013102 Ga0157371_10052947 Ga0157371_100529473 220
47 3300014968 Ga0157379_10009768 Ga0157379_100097686 220
48 3300025321 Ga0207656_10049836 Ga0207656_100498362 220
49 3300025932 Ga0207690_10019577 Ga0207690_100195772 220
50 3300025933 Ga0207706_10147537 Ga0207706_101475372 220
51 3300025941 Ga0207711_10016440 Ga0207711_100164402 220
52 3300025945 Ga0207679_10107501 Ga0207679_101075012 220
53 3300025945 Ga0207679_10178545 Ga0207679_101785453 220
54 3300025986 Ga0207658_10016010 Ga0207658_100160102 220
55 3300026088 Ga0207641_10026245 Ga0207641_100262455 220
56 3300026088 Ga0207641_10151651 Ga0207641_101516513 220
57 3300026116 Ga0207674_10001888 Ga0207674_1000188821 220
58 3300026116 Ga0207674_10367946 Ga0207674_103679462 220
59 3300037312 Ga0395899_0041491 Ga0395899_0041491_1131_1943 220
60 3300037418 Ga0395900_0124425 Ga0395900_0124425_1261_2073 220
61 3300037466 Ga0395898_0018903 Ga0395898_0018903_1548_2360 220
62 3300037471 Ga0395905_0013361 Ga0395905_0013361_6423_7235 220
63 3300038443 Ga0395901_0071430 Ga0395901_0071430_1737_2549 220
64 3300048906 Ga0496103_0015783 Ga0496103_0015783_220_1074 220
65 3300048912 Ga0496109_0003077 Ga0496109_0003077_128_997 220
66 3300048915 Ga0496112_0018169 Ga0496112_0018169_3684_4553 220
67 3300048916 Ga0496113_0024059 Ga0496113_0024059_181_1050 220
68 3300005327 Ga0070658_10049401 Ga0070658_100494012 222
69 3300005339 Ga0070660_100079524 Ga0070660_1000795243 222
70 3300005367 Ga0070667_100058269 Ga0070667_1000582693 222
71 3300005843 Ga0068860_100370246 Ga0068860_1003702462 222
72 3300025934 Ga0207686_10107153 Ga0207686_101071531 222
73 3300025909 Ga0207705_10191763 Ga0207705_101917632 223
74 3300025919 Ga0207657_10000966 Ga0207657_100009669 223
75 3300037312 Ga0395899_0028620 Ga0395899_0028620_1522_2319 223
76 3300037418 Ga0395900_0220396 Ga0395900_0220396_761_1558 223
77 3300037466 Ga0395898_0065239 Ga0395898_0065239_2303_3100 223
78 3300005327 Ga0070658_10010999 Ga0070658_100109996 224
79 3300005339 Ga0070660_100012989 Ga0070660_1000129893 224
80 3300005564 Ga0070664_100001303 Ga0070664_1000013034 224
81 3300013100 Ga0157373_10062455 Ga0157373_100624552 224
82 3300013105 Ga0157369_10000207 Ga0157369_1000020718 224
83 3300025945 Ga0207679_10020212 Ga0207679_100202123 224
84 3300037312 Ga0395899_0013958 Ga0395899_0013958_2448_3341 224
85 3300048917 Ga0496114_0000029 Ga0496114_0000029_146019_146846 224
86 3300005330 Ga0070690_100037331 Ga0070690_1000373313 225
87 3300005335 Ga0070666_10000175 Ga0070666_1000017524 225
88 3300005338 Ga0068868_100005026 Ga0068868_1000050268 225
89 3300005355 Ga0070671_100061904 Ga0070671_1000619044 225
90 3300005356 Ga0070674_100001005 Ga0070674_1000010059 225
91 3300005364 Ga0070673_100167938 Ga0070673_1001679382 225
92 3300005367 Ga0070667_100001408 Ga0070667_1000014087 225
93 3300005459 Ga0068867_100135803 Ga0068867_1001358033 225
94 3300005543 Ga0070672_100144325 Ga0070672_1001443252 225
95 3300005616 Ga0068852_100062470 Ga0068852_1000624703 225
96 3300005616 Ga0068852_100097361 Ga0068852_1000973613 225
97 3300005617 Ga0068859_100457861 Ga0068859_1004578611 225
98 3300005842 Ga0068858_100001465 Ga0068858_1000014656 225
99 3300006881 Ga0068865_100010238 Ga0068865_1000102385 225
100 3300006931 Ga0097620_100457863 Ga0097620_1004578631 225
101 3300009177 Ga0105248_10000818 Ga0105248_100008183 225
102 3300013105 Ga0157369_10072149 Ga0157369_100721495 225
103 3300013308 Ga0157375_10465657 Ga0157375_104656571 225
104 3300025903 Ga0207680_10003241 Ga0207680_100032416 225
105 3300025904 Ga0207647_10004965 Ga0207647_100049652 225
106 3300025919 Ga0207657_10316395 Ga0207657_103163951 225
107 3300025931 Ga0207644_10103907 Ga0207644_101039073 225
108 3300025936 Ga0207670_10187491 Ga0207670_101874911 225
109 3300025937 Ga0207669_10002310 Ga0207669_100023106 225
110 3300025940 Ga0207691_10112990 Ga0207691_101129902 225
111 3300025941 Ga0207711_10000193 Ga0207711_1000019325 225
112 3300025960 Ga0207651_10071587 Ga0207651_100715872 225
113 3300026035 Ga0207703_10001723 Ga0207703_1000172312 225
114 3300026142 Ga0207698_10239852 Ga0207698_102398523 225
115 3300044656 Ga0466969_0147157 Ga0466969_0147157_10_789 225
116 3300048912 Ga0496109_0413137 Ga0496109_0413137_328_1170 225
117 3300048915 Ga0496112_0099954 Ga0496112_0099954_679_1557 225
118 3300001990 JGI24737J22298_10005431 JGI24737J22298_100054315 226
119 3300005327 Ga0070658_10402784 Ga0070658_104027842 226
120 3300005330 Ga0070690_100017691 Ga0070690_1000176915 226
121 3300005356 Ga0070674_100002384 Ga0070674_1000023845 226
122 3300005366 Ga0070659_100000992 Ga0070659_1000009924 226
123 3300005366 Ga0070659_100132528 Ga0070659_1001325282 226
124 3300005457 Ga0070662_100011388 Ga0070662_1000113885 226
125 3300005457 Ga0070662_100014199 Ga0070662_1000141991 226
126 3300005543 Ga0070672_100034084 Ga0070672_1000340843 226
127 3300005548 Ga0070665_100090739 Ga0070665_1000907392 226
128 3300005563 Ga0068855_100006137 Ga0068855_10000613711 226
129 3300005577 Ga0068857_100056859 Ga0068857_1000568592 226
130 3300005614 Ga0068856_100087037 Ga0068856_1000870373 226
131 3300005616 Ga0068852_100080237 Ga0068852_1000802372 226
132 3300005616 Ga0068852_100114799 Ga0068852_1001147992 226
133 3300005834 Ga0068851_10074982 Ga0068851_100749823 226
134 3300005841 Ga0068863_100083929 Ga0068863_1000839292 226
135 3300006237 Ga0097621_100221346 Ga0097621_1002213461 226
136 3300006237 Ga0097621_100235097 Ga0097621_1002350972 226
137 3300009093 Ga0105240_10301887 Ga0105240_103018871 226
138 3300009177 Ga0105248_10015579 Ga0105248_100155792 226
139 3300009177 Ga0105248_10179809 Ga0105248_101798092 226
140 3300009551 Ga0105238_10012329 Ga0105238_100123292 226
141 3300011119 Ga0105246_10151728 Ga0105246_101517283 226
142 3300013102 Ga0157371_10008803 Ga0157371_100088033 226
143 3300013102 Ga0157371_10067992 Ga0157371_100679922 226
144 3300013296 Ga0157374_10249225 Ga0157374_102492252 226
145 3300014325 Ga0163163_10017377 Ga0163163_100173772 226
146 3300025321 Ga0207656_10186844 Ga0207656_101868441 226
147 3300025909 Ga0207705_10000382 Ga0207705_1000038230 226
148 3300025919 Ga0207657_10003169 Ga0207657_100031697 226
149 3300025932 Ga0207690_10001341 Ga0207690_100013414 226
150 3300025932 Ga0207690_10131092 Ga0207690_101310922 226
151 3300025933 Ga0207706_10012690 Ga0207706_100126901 226
152 3300025938 Ga0207704_10129087 Ga0207704_101290872 226
153 3300025940 Ga0207691_10003204 Ga0207691_100032047 226
154 3300025949 Ga0207667_10002562 Ga0207667_1000256218 226
155 3300026078 Ga0207702_10041570 Ga0207702_100415705 226
156 3300026088 Ga0207641_10042335 Ga0207641_100423352 226
157 3300026116 Ga0207674_10008585 Ga0207674_100085856 226
158 3300026142 Ga0207698_10093926 Ga0207698_100939263 226
159 3300037418 Ga0395900_0110557 Ga0395900_0110557_1675_2541 226
160 3300037471 Ga0395905_0063978 Ga0395905_0063978_152_964 226
161 3300037471 Ga0395905_0086904 Ga0395905_0086904_1453_2307 226
162 3300038443 Ga0395901_0350247 Ga0395901_0350247_438_1250 226
163 3300048903 Ga0496100_0011228 Ga0496100_0011228_783_1589 226
164 3300048904 Ga0496101_0012548 Ga0496101_0012548_798_1604 226
165 3300048906 Ga0496103_0066432 Ga0496103_0066432_173_976 226
166 3300048908 Ga0496105_0075364 Ga0496105_0075364_1349_2152 226
167 3300048913 Ga0496110_0034694 Ga0496110_0034694_2000_2803 226
168 3300048915 Ga0496112_0028192 Ga0496112_0028192_567_1370 226
169 3300048916 Ga0496113_0033465 Ga0496113_0033465_1042_1845 226
170 3300048917 Ga0496114_0049302 Ga0496114_0049302_2062_2868 226
171 3300048918 Ga0496115_0014491 Ga0496115_0014491_31_837 226
172 3300005336 Ga0070680_100086601 Ga0070680_1000866012 227
173 3300005336 Ga0070680_100150638 Ga0070680_1001506382 227
174 3300005343 Ga0070687_100078455 Ga0070687_1000784552 227
175 3300005456 Ga0070678_100016637 Ga0070678_1000166372 227
176 3300005530 Ga0070679_100254282 Ga0070679_1002542822 227
177 3300005544 Ga0070686_100048833 Ga0070686_1000488332 227
178 3300009174 Ga0105241_10446969 Ga0105241_104469692 227
179 3300010375 Ga0105239_10135243 Ga0105239_101352432 227
180 3300014325 Ga0163163_10319923 Ga0163163_103199233 227
181 3300025909 Ga0207705_10066922 Ga0207705_100669223 227
182 3300025912 Ga0207707_10062121 Ga0207707_100621212 227
183 3300025918 Ga0207662_10128810 Ga0207662_101288102 227
184 3300025941 Ga0207711_10043780 Ga0207711_100437805 227
185 3300026067 Ga0207678_10062017 Ga0207678_100620172 227
186 3300026089 Ga0207648_10008369 Ga0207648_100083692 227
187 3300037418 Ga0395900_0243348 Ga0395900_0243348_819_1640 227
188 3300005327 Ga0070658_10381335 Ga0070658_103813352 228
189 3300005327 Ga0070658_10505593 Ga0070658_105055931 228
190 3300005328 Ga0070676_10009070 Ga0070676_100090703 228
191 3300005331 Ga0070670_100018663 Ga0070670_1000186632 228
192 3300005335 Ga0070666_10044867 Ga0070666_100448671 228
193 3300005344 Ga0070661_100007917 Ga0070661_1000079173 228
194 3300005347 Ga0070668_100011379 Ga0070668_1000113792 228
195 3300005354 Ga0070675_100609740 Ga0070675_1006097401 228
196 3300005356 Ga0070674_100107705 Ga0070674_1001077052 228
197 3300005364 Ga0070673_100018889 Ga0070673_1000188892 228
198 3300005366 Ga0070659_100084273 Ga0070659_1000842731 228
199 3300005367 Ga0070667_100003855 Ga0070667_1000038556 228
200 3300005455 Ga0070663_100259599 Ga0070663_1002595992 228
201 3300005456 Ga0070678_100280196 Ga0070678_1002801961 228
202 3300005457 Ga0070662_100070560 Ga0070662_1000705602 228
203 3300005459 Ga0068867_100097657 Ga0068867_1000976572 228
204 3300005539 Ga0068853_100224956 Ga0068853_1002249562 228
205 3300005564 Ga0070664_100004154 Ga0070664_1000041544 228
206 3300005617 Ga0068859_100056567 Ga0068859_1000565672 228
207 3300005617 Ga0068859_100376317 Ga0068859_1003763171 228
208 3300006931 Ga0097620_100056566 Ga0097620_1000565664 228
209 3300006931 Ga0097620_100376327 Ga0097620_1003763271 228
210 3300009176 Ga0105242_10079951 Ga0105242_100799513 228
211 3300013308 Ga0157375_10077378 Ga0157375_100773781 228
212 3300014968 Ga0157379_10197261 Ga0157379_101972612 228
213 3300025907 Ga0207645_10046979 Ga0207645_100469793 228
214 3300025908 Ga0207643_10106019 Ga0207643_101060192 228
215 3300025920 Ga0207649_10015663 Ga0207649_100156632 228
216 3300025920 Ga0207649_10064319 Ga0207649_100643192 228
217 3300025923 Ga0207681_10008711 Ga0207681_100087113 228
218 3300025924 Ga0207694_10069885 Ga0207694_100698854 228
219 3300025926 Ga0207659_10531605 Ga0207659_105316051 228
220 3300025933 Ga0207706_10046516 Ga0207706_100465162 228
221 3300025937 Ga0207669_10041154 Ga0207669_100411543 228
222 3300025937 Ga0207669_10110868 Ga0207669_101108681 228
223 3300025940 Ga0207691_10326701 Ga0207691_103267011 228
224 3300025960 Ga0207651_10024497 Ga0207651_100244972 228
225 3300025960 Ga0207651_10330889 Ga0207651_103308892 228
226 3300025972 Ga0207668_10000101 Ga0207668_1000010143 228
227 3300025986 Ga0207658_10006832 Ga0207658_100068326 228
228 3300026067 Ga0207678_10167582 Ga0207678_101675822 228
229 3300026088 Ga0207641_10716344 Ga0207641_107163442 228
230 3300026089 Ga0207648_10173025 Ga0207648_101730252 228
231 3300026095 Ga0207676_10082736 Ga0207676_100827362 228
232 3300026121 Ga0207683_10004291 Ga0207683_100042912 228
233 3300026121 Ga0207683_10185286 Ga0207683_101852862 228
234 3300028381 Ga0268264_10247393 Ga0268264_102473933 228
235 3300046539 Ga0495621_0074057 Ga0495621_0074057_142_945 228
236 3300048903 Ga0496100_0014810 Ga0496100_0014810_2276_3079 228
237 3300048904 Ga0496101_0009177 Ga0496101_0009177_5002_5805 228
238 3300048907 Ga0496104_0098857 Ga0496104_0098857_1267_2070 228
239 3300048909 Ga0496106_0100069 Ga0496106_0100069_281_1084 228
240 3300048910 Ga0496107_0144210 Ga0496107_0144210_441_1244 228
241 3300048911 Ga0496108_0032108 Ga0496108_0032108_872_1675 228
242 3300048914 Ga0496111_0054622 Ga0496111_0054622_365_1168 228
243 3300005329 Ga0070683_100432062 Ga0070683_1004320622 229
244 3300005331 Ga0070670_100078428 Ga0070670_1000784283 229
245 3300005335 Ga0070666_10048254 Ga0070666_100482543 229
246 3300005347 Ga0070668_100416129 Ga0070668_1004161292 229
247 3300005355 Ga0070671_100082985 Ga0070671_1000829853 229
248 3300005356 Ga0070674_100225580 Ga0070674_1002255801 229
249 3300005457 Ga0070662_100060258 Ga0070662_1000602582 229
250 3300005548 Ga0070665_100017108 Ga0070665_1000171085 229
251 3300005564 Ga0070664_100101010 Ga0070664_1001010102 229
252 3300005841 Ga0068863_100167900 Ga0068863_1001679002 229
253 3300009093 Ga0105240_10262723 Ga0105240_102627232 229
254 3300009098 Ga0105245_10073009 Ga0105245_100730091 229
255 3300009177 Ga0105248_10535569 Ga0105248_105355692 229
256 3300013104 Ga0157370_10146994 Ga0157370_101469942 229
257 3300013105 Ga0157369_10168231 Ga0157369_101682313 229
258 3300013105 Ga0157369_10653244 Ga0157369_106532442 229
259 3300013306 Ga0163162_10017617 Ga0163162_100176175 229
260 3300013308 Ga0157375_10040943 Ga0157375_100409433 229
261 3300021388 Ga0213875_10009496 Ga0213875_100094963 229
262 3300025903 Ga0207680_10067342 Ga0207680_100673422 229
263 3300025933 Ga0207706_10013653 Ga0207706_100136536 229
264 3300025933 Ga0207706_10068047 Ga0207706_100680474 229
265 3300025940 Ga0207691_10011977 Ga0207691_100119772 229
266 3300025941 Ga0207711_10078656 Ga0207711_100786562 229
267 3300026035 Ga0207703_10241751 Ga0207703_102417512 229
268 3300026095 Ga0207676_10030608 Ga0207676_100306083 229
269 3300026118 Ga0207675_100359406 Ga0207675_1003594062 229
270 3300031548 Ga0307408_100206471 Ga0307408_1002064711 229
271 3300032002 Ga0307416_100407673 Ga0307416_1004076731 229
272 3300035172 Ga0373955_0095801 Ga0373955_0095801_466_1347 229
273 3300037466 Ga0395898_0084938 Ga0395898_0084938_76_1110 229
274 3300037471 Ga0395905_0230853 Ga0395905_0230853_233_1057 229
275 3300037853 Ga0436364_1159415 Ga0436364_1159415_915_1724 229
276 3300048911 Ga0496108_0034504 Ga0496108_0034504_1351_2172 229
277 3300048912 Ga0496109_0104842 Ga0496109_0104842_1571_2374 229
278 3300048915 Ga0496112_0051599 Ga0496112_0051599_1450_2271 229
279 3300005344 Ga0070661_100340125 Ga0070661_1003401252 230
280 3300005456 Ga0070678_100010289 Ga0070678_1000102892 230
281 3300005543 Ga0070672_100482418 Ga0070672_1004824181 230
282 3300025940 Ga0207691_10244712 Ga0207691_102447121 230
283 3300026121 Ga0207683_10015098 Ga0207683_100150982 230
284 3300026121 Ga0207683_10378588 Ga0207683_103785882 230
285 3300031731 Ga0307405_10037513 Ga0307405_100375132 230
286 3300037418 Ga0395900_0459920 Ga0395900_0459920_352_1131 230
287 3300037471 Ga0395905_0010642 Ga0395905_0010642_2815_3675 230
288 3300044719 Ga0466971_0016023 Ga0466971_0016023_2016_2870 230
289 3300048909 Ga0496106_0158362 Ga0496106_0158362_683_1507 230
290 3300048913 Ga0496110_0271981 Ga0496110_0271981_297_1118 230
291 3300061719 Ga0466962_0010032 Ga0466962_0010032_1656_2510 230
292 3300005355 Ga0070671_100002350 Ga0070671_1000023504 231
293 3300005456 Ga0070678_100100922 Ga0070678_1001009223 231
294 3300005543 Ga0070672_100074979 Ga0070672_1000749793 231
295 3300005842 Ga0068858_100013766 Ga0068858_1000137662 231
296 3300026121 Ga0207683_10056383 Ga0207683_100563834 231
297 3300032126 Ga0307415_100013096 Ga0307415_1000130964 231
298 3300048916 Ga0496113_0595189 Ga0496113_0595189_22_837 231
299 3300005331 Ga0070670_100028376 Ga0070670_1000283762 232
300 3300005344 Ga0070661_100025857 Ga0070661_1000258573 232
301 3300005355 Ga0070671_100079204 Ga0070671_1000792042 232
302 3300005548 Ga0070665_100016180 Ga0070665_1000161808 232
303 3300005564 Ga0070664_100007167 Ga0070664_1000071674 232
304 3300025909 Ga0207705_10139185 Ga0207705_101391852 232
305 3300025924 Ga0207694_10103012 Ga0207694_101030121 232
306 3300025931 Ga0207644_10065503 Ga0207644_100655033 232
307 3300025932 Ga0207690_10143711 Ga0207690_101437112 232
308 3300025941 Ga0207711_10088568 Ga0207711_100885682 232
309 3300028379 Ga0268266_10081457 Ga0268266_100814572 232
310 3300037418 Ga0395900_0046298 Ga0395900_0046298_1850_2782 232
311 3300038443 Ga0395901_0095809 Ga0395901_0095809_1130_2062 232
312 3300005345 Ga0070692_10001877 Ga0070692_100018773 233
313 3300005563 Ga0068855_100583724 Ga0068855_1005837241 233
314 3300013102 Ga0157371_10132001 Ga0157371_101320012 233
315 3300013308 Ga0157375_10173056 Ga0157375_101730563 233
316 3300014497 Ga0182008_10217994 Ga0182008_102179941 233
317 3300025909 Ga0207705_10021892 Ga0207705_100218923 233
318 3300025919 Ga0207657_10005126 Ga0207657_100051263 233
319 3300025940 Ga0207691_10070205 Ga0207691_100702052 233
320 3300025941 Ga0207711_10014767 Ga0207711_100147678 233
321 3300025949 Ga0207667_10677638 Ga0207667_106776382 233
322 3300036401 Ga0373937_0404133 Ga0373937_0404133_178_1059 233
323 3300037312 Ga0395899_0001715 Ga0395899_0001715_1262_2044 233
324 3300037418 Ga0395900_0000840 Ga0395900_0000840_10722_11504 233
325 3300037466 Ga0395898_0006021 Ga0395898_0006021_11290_12072 233
326 3300037471 Ga0395905_0047957 Ga0395905_0047957_1882_2739 233
327 3300038443 Ga0395901_0000783 Ga0395901_0000783_24008_24790 233
328 3300042006 Ga0439432_014057 Ga0439432_014057_524_1294 233
329 3300046537 Ga0495598_0001042 Ga0495598_0001042_3622_4479 233
330 3300046539 Ga0495621_0000147 Ga0495621_0000147_2028_2885 233
331 3300046558 Ga0495633_0039345 Ga0495633_0039345_362_1219 233
332 3300046684 Ga0495669_0039499 Ga0495669_0039499_273_1130 233
333 3300046691 Ga0495670_0000192 Ga0495670_0000192_19993_20850 233
334 3300001989 JGI24739J22299_10051984 JGI24739J22299_100519842 234
335 3300002073 JGI24745J21846_1004912 JGI24745J21846_10049122 234
336 3300002075 JGI24738J21930_10007870 JGI24738J21930_100078702 234
337 3300002077 JGI24744J21845_10001038 JGI24744J21845_100010383 234
338 3300005293 Ga0065715_10113151 Ga0065715_101131511 234
339 3300005336 Ga0070680_100371522 Ga0070680_1003715222 234
340 3300005338 Ga0068868_100392255 Ga0068868_1003922551 234
341 3300005347 Ga0070668_100154730 Ga0070668_1001547303 234
342 3300005354 Ga0070675_100060523 Ga0070675_1000605234 234
343 3300005356 Ga0070674_100003417 Ga0070674_1000034177 234
344 3300005367 Ga0070667_100273991 Ga0070667_1002739912 234
345 3300005456 Ga0070678_100026069 Ga0070678_1000260693 234
346 3300005457 Ga0070662_100301228 Ga0070662_1003012282 234
347 3300005459 Ga0068867_100051586 Ga0068867_1000515862 234
348 3300005535 Ga0070684_100001026 Ga0070684_1000010263 234
349 3300005543 Ga0070672_100087333 Ga0070672_1000873333 234
350 3300005563 Ga0068855_100259419 Ga0068855_1002594192 234
351 3300005564 Ga0070664_100168428 Ga0070664_1001684282 234
352 3300005577 Ga0068857_100076385 Ga0068857_1000763853 234
353 3300005578 Ga0068854_100010218 Ga0068854_1000102182 234
354 3300005578 Ga0068854_100078770 Ga0068854_1000787703 234
355 3300005616 Ga0068852_100186681 Ga0068852_1001866812 234
356 3300005618 Ga0068864_100050044 Ga0068864_1000500442 234
357 3300006358 Ga0068871_100172437 Ga0068871_1001724372 234
358 3300009148 Ga0105243_10111137 Ga0105243_101111371 234
359 3300009174 Ga0105241_10574735 Ga0105241_105747352 234
360 3300011119 Ga0105246_10096885 Ga0105246_100968853 234
361 3300013102 Ga0157371_10118533 Ga0157371_101185333 234
362 3300013297 Ga0157378_10085141 Ga0157378_100851413 234
363 3300013306 Ga0163162_10702172 Ga0163162_107021722 234
364 3300013308 Ga0157375_10232399 Ga0157375_102323992 234
365 3300014326 Ga0157380_10375797 Ga0157380_103757972 234
366 3300025315 Ga0207697_10017711 Ga0207697_100177113 234
367 3300025893 Ga0207682_10027136 Ga0207682_100271362 234
368 3300025901 Ga0207688_10030565 Ga0207688_100305652 234
369 3300025903 Ga0207680_10062848 Ga0207680_100628482 234
370 3300025904 Ga0207647_10003773 Ga0207647_1000377311 234
371 3300025904 Ga0207647_10065458 Ga0207647_100654582 234
372 3300025907 Ga0207645_10130583 Ga0207645_101305832 234
373 3300025909 Ga0207705_10023836 Ga0207705_100238365 234
374 3300025911 Ga0207654_10194868 Ga0207654_101948682 234
375 3300025913 Ga0207695_10055479 Ga0207695_100554792 234
376 3300025914 Ga0207671_10049834 Ga0207671_100498342 234
377 3300025919 Ga0207657_10005658 Ga0207657_100056583 234
378 3300025919 Ga0207657_10056516 Ga0207657_100565162 234
379 3300025925 Ga0207650_10008672 Ga0207650_100086727 234
380 3300025926 Ga0207659_10113155 Ga0207659_101131553 234
381 3300025927 Ga0207687_10141118 Ga0207687_101411183 234
382 3300025933 Ga0207706_10070485 Ga0207706_100704852 234
383 3300025938 Ga0207704_10083513 Ga0207704_100835133 234
384 3300025940 Ga0207691_10026686 Ga0207691_100266862 234
385 3300025945 Ga0207679_10053806 Ga0207679_100538062 234
386 3300025981 Ga0207640_10006207 Ga0207640_100062077 234
387 3300025986 Ga0207658_10233212 Ga0207658_102332122 234
388 3300026041 Ga0207639_10004341 Ga0207639_100043417 234
389 3300026067 Ga0207678_10083319 Ga0207678_100833192 234
390 3300026078 Ga0207702_10028532 Ga0207702_100285322 234
391 3300026089 Ga0207648_10003513 Ga0207648_100035132 234
392 3300026095 Ga0207676_10181541 Ga0207676_101815413 234
393 3300026116 Ga0207674_10066040 Ga0207674_100660402 234
394 3300026121 Ga0207683_10022524 Ga0207683_100225243 234
395 3300037312 Ga0395899_0056609 Ga0395899_0056609_411_1430 234
396 3300038443 Ga0395901_0064180 Ga0395901_0064180_2364_3383 234
397 3300047445 Ga0495677_0076027 Ga0495677_0076027_328_1149 234
398 3300048906 Ga0496103_0157264 Ga0496103_0157264_452_1282 234
399 3300048909 Ga0496106_0199554 Ga0496106_0199554_595_1425 234
400 3300048915 Ga0496112_0055936 Ga0496112_0055936_923_1753 234
401 3300005327 Ga0070658_10085977 Ga0070658_100859773 235
402 3300005327 Ga0070658_10162665 Ga0070658_101626651 235
403 3300005336 Ga0070680_100070158 Ga0070680_1000701582 235
404 3300005337 Ga0070682_100033548 Ga0070682_1000335482 235
405 3300005341 Ga0070691_10007681 Ga0070691_100076815 235
406 3300005455 Ga0070663_100053126 Ga0070663_1000531262 235
407 3300005457 Ga0070662_100015039 Ga0070662_1000150396 235
408 3300006881 Ga0068865_100016591 Ga0068865_1000165915 235
409 3300009093 Ga0105240_10210606 Ga0105240_102106062 235
410 3300009177 Ga0105248_10008738 Ga0105248_1000873812 235
411 3300013100 Ga0157373_10111875 Ga0157373_101118753 235
412 3300013102 Ga0157371_10322407 Ga0157371_103224071 235
413 3300013104 Ga0157370_10147498 Ga0157370_101474982 235
414 3300017792 Ga0163161_10057282 Ga0163161_100572823 235
415 3300025321 Ga0207656_10033926 Ga0207656_100339262 235
416 3300025911 Ga0207654_10140053 Ga0207654_101400533 235
417 3300025931 Ga0207644_10073001 Ga0207644_100730013 235
418 3300025932 Ga0207690_10014947 Ga0207690_100149473 235
419 3300025938 Ga0207704_10128412 Ga0207704_101284122 235
420 3300025940 Ga0207691_10029479 Ga0207691_100294792 235
421 3300025944 Ga0207661_10052755 Ga0207661_100527555 235
422 3300025944 Ga0207661_10110049 Ga0207661_101100492 235
423 3300025949 Ga0207667_10036587 Ga0207667_100365872 235
424 3300025986 Ga0207658_10117779 Ga0207658_101177791 235
425 3300026142 Ga0207698_10008371 Ga0207698_100083715 235
426 3300037466 Ga0395898_0384478 Ga0395898_0384478_464_1243 235
427 3300002067 JGI24735J21928_10017310 JGI24735J21928_100173102 236
428 3300005339 Ga0070660_100069281 Ga0070660_1000692813 236
429 3300005344 Ga0070661_100042821 Ga0070661_1000428213 236
430 3300005354 Ga0070675_100029277 Ga0070675_1000292772 236
431 3300005356 Ga0070674_100162767 Ga0070674_1001627672 236
432 3300005364 Ga0070673_100136180 Ga0070673_1001361803 236
433 3300005456 Ga0070678_100026663 Ga0070678_1000266632 236
434 3300009177 Ga0105248_10170905 Ga0105248_101709053 236
435 3300009545 Ga0105237_10058748 Ga0105237_100587482 236
436 3300009551 Ga0105238_10006724 Ga0105238_100067243 236
437 3300013105 Ga0157369_10197598 Ga0157369_101975982 236
438 3300013296 Ga0157374_10123807 Ga0157374_101238073 236
439 3300013307 Ga0157372_10131090 Ga0157372_101310903 236
440 3300013308 Ga0157375_10216120 Ga0157375_102161202 236
441 3300025903 Ga0207680_10017057 Ga0207680_100170572 236
442 3300025938 Ga0207704_10070817 Ga0207704_100708172 236
443 3300037312 Ga0395899_0052464 Ga0395899_0052464_754_1626 236
444 3300037418 Ga0395900_0214540 Ga0395900_0214540_482_1354 236
445 3300037466 Ga0395898_0037462 Ga0395898_0037462_2841_3713 236
446 3300038443 Ga0395901_0120861 Ga0395901_0120861_993_1865 236
447 3300025909 Ga0207705_10023301 Ga0207705_100233012 237
448 3300037312 Ga0395899_0033684 Ga0395899_0033684_327_1151 239
449 3300037466 Ga0395898_0017933 Ga0395898_0017933_313_1137 239
450 3300037471 Ga0395905_0011321 Ga0395905_0011321_5790_6614 239
451 3300038443 Ga0395901_0000876 Ga0395901_0000876_2831_3655 239
452 3300001979 JGI24740J21852_10010350 JGI24740J21852_100103502 240
453 3300005329 Ga0070683_100065398 Ga0070683_1000653983 240
454 3300005336 Ga0070680_100004504 Ga0070680_1000045047 240
455 3300005344 Ga0070661_100110185 Ga0070661_1001101852 240
456 3300005345 Ga0070692_10198600 Ga0070692_101986002 240
457 3300005455 Ga0070663_100005666 Ga0070663_1000056664 240
458 3300005458 Ga0070681_10100772 Ga0070681_101007722 240
459 3300005530 Ga0070679_100002835 Ga0070679_10000283512 240
460 3300005535 Ga0070684_100283093 Ga0070684_1002830932 240
461 3300005563 Ga0068855_100002695 Ga0068855_1000026958 240
462 3300005614 Ga0068856_100008516 Ga0068856_1000085167 240
463 3300013105 Ga0157369_10198459 Ga0157369_101984592 240
464 3300013307 Ga0157372_10193340 Ga0157372_101933403 240
465 3300025904 Ga0207647_10006911 Ga0207647_100069116 240
466 3300025909 Ga0207705_10000942 Ga0207705_1000094220 240
467 3300025912 Ga0207707_10016093 Ga0207707_100160936 240
468 3300025917 Ga0207660_10007465 Ga0207660_100074652 240
469 3300025919 Ga0207657_10001753 Ga0207657_100017534 240
470 3300025920 Ga0207649_10087397 Ga0207649_100873973 240
471 3300025921 Ga0207652_10000875 Ga0207652_1000087514 240
472 3300025944 Ga0207661_10235351 Ga0207661_102353512 240
473 3300025949 Ga0207667_10002493 Ga0207667_1000249325 240
474 3300026067 Ga0207678_10006058 Ga0207678_1000605812 240
475 3300026078 Ga0207702_10095301 Ga0207702_100953012 240
476 3300037418 Ga0395900_0000289 Ga0395900_0000289_14824_15648 240

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dxo-assembly2.cif.gz_B structure of aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 0.594 145 192
5dxn-assembly1.cif.gz_A structure of aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 0.5879 141 192
5dxi-assembly2.cif.gz_B structure of c. albicans trehalose-6-phosphate phosphatase c-terminal domain 0.5838 146 190
5dxi-assembly1.cif.gz_A structure of c. albicans trehalose-6-phosphate phosphatase c-terminal domain 0.58 146 190
6mrs-assembly1.cif.gz_A de novo designed protein peak6 0.5695 146 189
ID Description Score Start End Superfamily
af_P9WM79_290_380_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.5973 137 193 3.10.28.10
af_P9WGJ5_127_209_3.30.110.150 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;SepF-like protein 0.5287 145 202 3.30.110.150
af_Q9C9S4_119_361_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5269 93 193 3.40.50.1000
4g0jC02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;Rotavirus NSP2 fragment, C-terminal domain 0.4726 146 206 3.30.428.20
2gu0B02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;Rotavirus NSP2 fragment, C-terminal domain 0.462 145 190 3.30.428.20
ID Description Score Start End GO Terms
AF-A0A1R1LDH2-F1-model_v4 Peptidase M15A C-terminal domain-containing protein 0.8785 39 197
AF-A0A1G9DCU2-F1-model_v4 Peptidase M15 0.8687 39 197 GO:0016020
AF-A0A2P2E6A8-F1-model_v4 Peptidase M15A C-terminal domain-containing protein 0.8593 41 197
AF-A0A3C0GIT2-F1-model_v4 Peptidase M15A C-terminal domain-containing protein 0.8584 91 197
AF-A0A7W4WA92-F1-model_v4 Peptidase M15A C-terminal domain-containing protein 0.8576 36 197 GO:0016020

Feature Viewer

pLDDT pTM Quality
68.14 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map