F451499

General Info

Members Datasets Scaffolds Average Seq Length
476 236 952 124

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100383808|Ga0070697_1003838082
Length 140
Sequence MYPPRSEVIFVFSESKYTETHEWVHNVNGNKVRVGITDHAQKELGDVVYVELPEIGRELKAGSPFGVVESVKAVSDLVSPVSGKVVEVNATLKDKPELVNQSAHQDAWMVVVELPDIGELAKLLTPDAYEQFVARSAGKH

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.99
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100383808 3300005536 Bacteria 1217
2 JGI24751J29686_10129576 3300002459 Bacteria 532
3 Ga0065712_10150129 3300005290 Bacteria 1376
4 Ga0065715_10684068 3300005293 Bacteria 661
5 Ga0065707_10260024 3300005295 Bacteria 1100
6 Ga0065707_10312974 3300005295 Bacteria 981
7 Ga0070658_10063667 3300005327 Bacteria 3007
8 Ga0070676_10108979 3300005328 Bacteria 1722
9 Ga0070683_100773390 3300005329 Bacteria 920
10 Ga0070690_100659595 3300005330 Bacteria 800
11 Ga0070690_100664472 3300005330 Bacteria 797
12 Ga0070670_100078754 3300005331 Bacteria 2831
13 Ga0070670_100359813 3300005331 Bacteria 1279
14 Ga0068869_100085943 3300005334 Bacteria 2357
15 Ga0068869_101066616 3300005334 Bacteria 706
16 Ga0070666_10044751 3300005335 Bacteria 2967
17 Ga0070666_10290817 3300005335 Bacteria 1162
18 Ga0070666_10381059 3300005335 Bacteria 1012
19 Ga0070666_10482217 3300005335 Bacteria 898
20 Ga0070666_10500708 3300005335 Bacteria 881
21 Ga0070680_100095045 3300005336 Bacteria 2470
22 Ga0070680_100580294 3300005336 Bacteria 962
23 Ga0070682_100473718 3300005337 Bacteria 964
24 Ga0068868_100203092 3300005338 Bacteria 1653
25 Ga0068868_100996895 3300005338 Bacteria 766
26 Ga0070660_100051620 3300005339 Bacteria 3168
27 Ga0070660_100424166 3300005339 Bacteria 1102
28 Ga0070689_100824272 3300005340 Bacteria 817
29 Ga0070689_100979796 3300005340 Bacteria 751
30 Ga0070689_101468093 3300005340 Bacteria 617
31 Ga0070691_10005442 3300005341 Bacteria 5794
32 Ga0070687_100115430 3300005343 Bacteria 1527
33 Ga0070687_100434034 3300005343 Bacteria 870
34 Ga0070661_100181608 3300005344 Bacteria 1601
35 Ga0070692_10687689 3300005345 Bacteria 687
36 Ga0070668_100249963 3300005347 Bacteria 1471
37 Ga0070668_100451930 3300005347 Bacteria 1105
38 Ga0070669_100074371 3300005353 Bacteria 2519
39 Ga0070669_100219281 3300005353 Bacteria 1503
40 Ga0070669_100601910 3300005353 Bacteria 921
41 Ga0070675_100000509 3300005354 Bacteria 26573
42 Ga0070675_100082735 3300005354 Bacteria 2678
43 Ga0070674_100049201 3300005356 Bacteria 2897
44 Ga0070674_100678277 3300005356 Bacteria 879
45 Ga0070673_100914141 3300005364 Unclassified 814
46 Ga0070659_100497495 3300005366 Bacteria 1039
47 Ga0070667_101525627 3300005367 Bacteria 628
48 Ga0070709_10093843 3300005434 Bacteria 1984
49 Ga0070713_101974986 3300005436 Bacteria 566
50 Ga0070710_10338763 3300005437 Bacteria 992
51 Ga0070705_100023105 3300005440 Bacteria 3334
52 Ga0070705_100027196 3300005440 Bacteria 3122
53 Ga0070705_100579399 3300005440 Bacteria 865
54 Ga0070705_100642758 3300005440 Bacteria 826
55 Ga0070700_100020748 3300005441 Bacteria 3812
56 Ga0070700_100024980 3300005441 Bacteria 3515
57 Ga0070700_100428121 3300005441 Bacteria 1002
58 Ga0070694_100005613 3300005444 Bacteria 7604
59 Ga0070694_100050090 3300005444 Bacteria 2814
60 Ga0070708_100270992 3300005445 Bacteria 1597
61 Ga0070678_100107645 3300005456 Bacteria 2175
62 Ga0070678_100523960 3300005456 Bacteria 1049
63 Ga0070662_100376398 3300005457 Bacteria 1168
64 Ga0070681_10194459 3300005458 Bacteria 1948
65 Ga0068867_100166383 3300005459 Bacteria 1743
66 Ga0068867_100222520 3300005459 Bacteria 1522
67 Ga0068867_100232872 3300005459 Bacteria 1490
68 Ga0068867_100471354 3300005459 Bacteria 1074
69 Ga0070685_10242671 3300005466 Bacteria 1190
70 Ga0070685_11535376 3300005466 Unclassified 514
71 Ga0070706_100793840 3300005467 Bacteria 876
72 Ga0070707_100139869 3300005468 Bacteria 2356
73 Ga0070707_100864044 3300005468 Bacteria 869
74 Ga0070698_100028678 3300005471 Bacteria 5779
75 Ga0070698_100050664 3300005471 Bacteria 4232
76 Ga0070698_100101180 3300005471 Bacteria 2853
77 Ga0070698_100753900 3300005471 Bacteria 917
78 Ga0070698_101006422 3300005471 Bacteria 781
79 Ga0070699_100081274 3300005518 Bacteria 2825
80 Ga0070679_100064425 3300005530 Bacteria 3653
81 Ga0070679_100887483 3300005530 Bacteria 835
82 Ga0070679_101398600 3300005530 Bacteria 646
83 Ga0070684_100715291 3300005535 Bacteria 934
84 Ga0070684_101520000 3300005535 Bacteria 631
85 Ga0070697_100429619 3300005536 Bacteria 1148
86 Ga0070697_100848771 3300005536 Bacteria 809
87 Ga0068853_100195106 3300005539 Bacteria 1841
88 Ga0070686_100002747 3300005544 Bacteria 9690
89 Ga0070686_100925315 3300005544 Bacteria 711
90 Ga0070695_101457242 3300005545 Bacteria 569
91 Ga0070696_100163613 3300005546 Bacteria 1641
92 Ga0070696_100256280 3300005546 Bacteria 1325
93 Ga0070696_100444658 3300005546 Bacteria 1022
94 Ga0070696_100588046 3300005546 Bacteria 896
95 Ga0070693_100211104 3300005547 Bacteria 1267
96 Ga0070665_100002497 3300005548 Bacteria 20241
97 Ga0070665_100003475 3300005548 Bacteria 16783
98 Ga0070665_101053889 3300005548 Bacteria 825
99 Ga0070704_100080179 3300005549 Bacteria 2400
100 Ga0070704_100200199 3300005549 Bacteria 1612
101 Ga0070704_100685173 3300005549 Bacteria 908
102 Ga0070704_100769030 3300005549 Bacteria 859
103 Ga0070704_100817537 3300005549 Bacteria 834
104 Ga0068855_100029520 3300005563 Bacteria 6553
105 Ga0068855_100962121 3300005563 Bacteria 899
106 Ga0068857_101779937 3300005577 Bacteria 603
107 Ga0068857_101798255 3300005577 Bacteria 600
108 Ga0068854_100153055 3300005578 Bacteria 1780
109 Ga0070702_100014595 3300005615 Bacteria 3988
110 Ga0070702_100701838 3300005615 Bacteria 771
111 Ga0068859_100138773 3300005617 Bacteria 2505
112 Ga0068859_100407318 3300005617 Bacteria 1456
113 Ga0068859_100688953 3300005617 Bacteria 1113
114 Ga0068859_100858363 3300005617 Bacteria 994
115 Ga0068864_100007760 3300005618 Bacteria 8842
116 Ga0068864_100022243 3300005618 Bacteria 5315
117 Ga0068864_100073478 3300005618 Bacteria 2981
118 Ga0068866_10308550 3300005718 Bacteria 991
119 Ga0068866_10475802 3300005718 Bacteria 822
120 Ga0068861_100165552 3300005719 Bacteria 1828
121 Ga0068861_100389666 3300005719 Bacteria 1233
122 Ga0068861_100760996 3300005719 Bacteria 906
123 Ga0068861_101092529 3300005719 Bacteria 766
124 Ga0068851_10192197 3300005834 Bacteria 1135
125 Ga0068851_10348634 3300005834 Bacteria 861
126 Ga0068863_100386129 3300005841 Bacteria 1368
127 Ga0068863_100657133 3300005841 Bacteria 1040
128 Ga0068863_101965345 3300005841 Bacteria 595
129 Ga0068858_100004215 3300005842 Bacteria 14158
130 Ga0068858_100161360 3300005842 Bacteria 2110
131 Ga0068858_100430312 3300005842 Bacteria 1270
132 Ga0068860_100417815 3300005843 Bacteria 1329
133 Ga0068862_100155112 3300005844 Bacteria 2041
134 Ga0068862_100299640 3300005844 Bacteria 1479
135 Ga0068862_100311266 3300005844 Bacteria 1451
136 Ga0068862_100627163 3300005844 Bacteria 1035
137 Ga0068862_100802877 3300005844 Unclassified 919
138 Ga0070716_100658478 3300006173 Bacteria 795
139 Ga0097621_100035529 3300006237 Bacteria 3983
140 Ga0097621_100038025 3300006237 Bacteria 3861
141 Ga0097621_100098387 3300006237 Bacteria 2458
142 Ga0068871_100006929 3300006358 Bacteria 8075
143 Ga0068871_100145583 3300006358 Bacteria 2017
144 Ga0068871_100376068 3300006358 Bacteria 1261
145 Ga0068871_100488782 3300006358 Bacteria 1108
146 Ga0068871_101543361 3300006358 Bacteria 628
147 Ga0068871_102239832 3300006358 Bacteria 521
148 Ga0075433_10067073 3300006852 Bacteria 3149
149 Ga0075433_10476440 3300006852 Bacteria 1100
150 Ga0075434_100007687 3300006871 Bacteria 9979
151 Ga0075434_100019014 3300006871 Bacteria 6640
152 Ga0075434_100137288 3300006871 Bacteria 2465
153 Ga0075434_100401323 3300006871 Bacteria 1392
154 Ga0075434_100458947 3300006871 Bacteria 1295
155 Ga0075434_100472186 3300006871 Bacteria 1276
156 Ga0068865_100004400 3300006881 Bacteria 8488
157 Ga0068865_100140726 3300006881 Bacteria 1819
158 Ga0075436_100123464 3300006914 Bacteria 1813
159 Ga0075436_100144261 3300006914 Bacteria 1674
160 Ga0075436_100817484 3300006914 Bacteria 694
161 Ga0097620_100138765 3300006931 Bacteria 2505
162 Ga0097620_100407301 3300006931 Bacteria 1456
163 Ga0097620_100689052 3300006931 Bacteria 1113
164 Ga0097620_100858395 3300006931 Bacteria 994
165 Ga0075435_100000623 3300007076 Bacteria 21789
166 Ga0075435_100001801 3300007076 Bacteria 13935
167 Ga0075435_100029332 3300007076 Bacteria 4317
168 Ga0075435_101254816 3300007076 Bacteria 649
169 Ga0105240_10392254 3300009093 Bacteria 1565
170 Ga0105240_10833620 3300009093 Bacteria 997
171 Ga0105240_12518749 3300009093 Bacteria 532
172 Ga0111539_10066872 3300009094 Bacteria 4245
173 Ga0105245_10054120 3300009098 Bacteria 3604
174 Ga0105245_11035497 3300009098 Bacteria 866
175 Ga0105245_11169654 3300009098 Bacteria 817
176 Ga0105245_11247298 3300009098 Bacteria 792
177 Ga0105247_10008220 3300009101 Bacteria 6365
178 Ga0105247_10110476 3300009101 Bacteria 1769
179 Ga0105247_10362851 3300009101 Bacteria 1022
180 Ga0114129_10002050 3300009147 Bacteria 27658
181 Ga0114129_10002528 3300009147 Bacteria 25398
182 Ga0114129_10203462 3300009147 Bacteria 2680
183 Ga0114129_10313114 3300009147 Bacteria 2089
184 Ga0105243_10046963 3300009148 Bacteria 3398
185 Ga0105243_10213920 3300009148 Bacteria 1699
186 Ga0105243_10804877 3300009148 Bacteria 927
187 Ga0105243_11571039 3300009148 Bacteria 684
188 Ga0105241_10049566 3300009174 Bacteria 3198
189 Ga0105242_10031269 3300009176 Bacteria 4250
190 Ga0105242_10073407 3300009176 Bacteria 2844
191 Ga0105242_10440920 3300009176 Bacteria 1225
192 Ga0105248_10001685 3300009177 Bacteria 24592
193 Ga0105248_10007672 3300009177 Bacteria 11857
194 Ga0105248_10020487 3300009177 Bacteria 7328
195 Ga0105248_10035128 3300009177 Bacteria 5608
196 Ga0105248_10170003 3300009177 Bacteria 2457
197 Ga0105248_10583885 3300009177 Bacteria 1261
198 Ga0105248_11013341 3300009177 Bacteria 938
199 Ga0105248_11687415 3300009177 Bacteria 718
200 Ga0105248_11916755 3300009177 Bacteria 673
201 Ga0105237_10520975 3300009545 Bacteria 1195
202 Ga0105238_10124686 3300009551 Bacteria 2555
203 Ga0105238_10238372 3300009551 Bacteria 1796
204 Ga0105238_11189941 3300009551 Bacteria 786
205 Ga0105249_10582525 3300009553 Bacteria 1172
206 Ga0105249_10815122 3300009553 Bacteria 998
207 Ga0105249_11144239 3300009553 Bacteria 849
208 Ga0105249_12912730 3300009553 Bacteria 549
209 Ga0105239_12513724 3300010375 Bacteria 600
210 Ga0105246_11214546 3300011119 Bacteria 695
211 Ga0105246_12470414 3300011119 Bacteria 511
212 Ga0157374_10033838 3300013296 Bacteria 4665
213 Ga0157374_10705170 3300013296 Bacteria 1022
214 Ga0157374_12937503 3300013296 Bacteria 504
215 Ga0157378_13068020 3300013297 Bacteria 518
216 Ga0163162_10328158 3300013306 Bacteria 1663
217 Ga0163162_11097608 3300013306 Bacteria 901
218 Ga0163162_12823027 3300013306 Bacteria 559
219 Ga0157375_10234790 3300013308 Bacteria 1993
220 Ga0157375_10658668 3300013308 Bacteria 1203
221 Ga0157375_11186828 3300013308 Bacteria 895
222 Ga0157375_11448319 3300013308 Bacteria 810
223 Ga0157375_11939443 3300013308 Bacteria 699
224 Ga0163163_10004667 3300014325 Bacteria 11718
225 Ga0163163_10079936 3300014325 Bacteria 3268
226 Ga0163163_10200520 3300014325 Bacteria 2044
227 Ga0157380_10140479 3300014326 Bacteria 2074
228 Ga0157380_10345980 3300014326 Bacteria 1389
229 Ga0157377_10094860 3300014745 Bacteria 1768
230 Ga0157379_10088912 3300014968 Bacteria 2770
231 Ga0157379_10108643 3300014968 Bacteria 2491
232 Ga0157379_10703114 3300014968 Bacteria 949
233 Ga0157379_11694563 3300014968 Bacteria 619
234 Ga0157376_10019539 3300014969 Bacteria 5225
235 Ga0157376_10818822 3300014969 Bacteria 945
236 Ga0157376_13010826 3300014969 Bacteria 510
237 Ga0163161_11193292 3300017792 Unclassified 658
238 Ga0163161_11316342 3300017792 Bacteria 628
239 Ga0207656_10416240 3300025321 Bacteria 677
240 Ga0207682_10053771 3300025893 Bacteria 1671
241 Ga0207642_10153375 3300025899 Bacteria 1229
242 Ga0207710_10018074 3300025900 Bacteria 2996
243 Ga0207710_10566351 3300025900 Bacteria 592
244 Ga0207688_10834767 3300025901 Bacteria 584
245 Ga0207680_10270434 3300025903 Bacteria 1179
246 Ga0207680_10424329 3300025903 Bacteria 942
247 Ga0207680_10517578 3300025903 Bacteria 850
248 Ga0207685_10779307 3300025905 Bacteria 525
249 Ga0207645_10031795 3300025907 Bacteria 3393
250 Ga0207645_10178174 3300025907 Bacteria 1394
251 Ga0207643_10838973 3300025908 Bacteria 596
252 Ga0207695_10285559 3300025913 Bacteria 1543
253 Ga0207695_10797935 3300025913 Bacteria 824
254 Ga0207671_11197505 3300025914 Bacteria 594
255 Ga0207660_10534066 3300025917 Bacteria 953
256 Ga0207662_10063887 3300025918 Bacteria 2214
257 Ga0207657_10011250 3300025919 Bacteria 8892
258 Ga0207652_10102182 3300025921 Bacteria 2533
259 Ga0207646_10486414 3300025922 Bacteria 1112
260 Ga0207681_10205844 3300025923 Bacteria 1513
261 Ga0207681_10293372 3300025923 Bacteria 1284
262 Ga0207694_10113670 3300025924 Bacteria 2156
263 Ga0207694_10710772 3300025924 Bacteria 847
264 Ga0207694_10769920 3300025924 Bacteria 813
265 Ga0207650_10055757 3300025925 Bacteria 2934
266 Ga0207650_10098667 3300025925 Bacteria 2245
267 Ga0207650_10612858 3300025925 Bacteria 916
268 Ga0207650_10698102 3300025925 Bacteria 857
269 Ga0207650_11123452 3300025925 Bacteria 669
270 Ga0207659_10002625 3300025926 Bacteria 10704
271 Ga0207659_10738171 3300025926 Bacteria 844
272 Ga0207659_11345830 3300025926 Bacteria 613
273 Ga0207687_10040995 3300025927 Bacteria 3177
274 Ga0207687_10576848 3300025927 Bacteria 946
275 Ga0207687_11252704 3300025927 Bacteria 637
276 Ga0207644_10859554 3300025931 Bacteria 760
277 Ga0207706_10197378 3300025933 Bacteria 1765
278 Ga0207686_10023443 3300025934 Bacteria 3565
279 Ga0207686_10042615 3300025934 Bacteria 2776
280 Ga0207686_10196615 3300025934 Bacteria 1441
281 Ga0207709_10216731 3300025935 Bacteria 1378
282 Ga0207709_10226839 3300025935 Bacteria 1351
283 Ga0207670_10932666 3300025936 Bacteria 728
284 Ga0207669_10217023 3300025937 Bacteria 1401
285 Ga0207669_11367095 3300025937 Bacteria 602
286 Ga0207704_10107629 3300025938 Bacteria 1876
287 Ga0207704_11371351 3300025938 Bacteria 605
288 Ga0207704_11714426 3300025938 Bacteria 540
289 Ga0207665_10200045 3300025939 Bacteria 1455
290 Ga0207665_10264674 3300025939 Bacteria 1275
291 Ga0207665_10894687 3300025939 Bacteria 704
292 Ga0207665_10985179 3300025939 Bacteria 670
293 Ga0207691_10242389 3300025940 Bacteria 1558
294 Ga0207691_10531490 3300025940 Bacteria 998
295 Ga0207711_10002785 3300025941 Bacteria 15377
296 Ga0207711_10178259 3300025941 Bacteria 1931
297 Ga0207711_10199781 3300025941 Bacteria 1824
298 Ga0207711_10904732 3300025941 Bacteria 820
299 Ga0207711_10926538 3300025941 Bacteria 810
300 Ga0207711_11027290 3300025941 Bacteria 764
301 Ga0207711_11859040 3300025941 Bacteria 545
302 Ga0207689_10136953 3300025942 Bacteria 2016
303 Ga0207679_10310170 3300025945 Bacteria 1363
304 Ga0207667_10176245 3300025949 Bacteria 2196
305 Ga0207651_10556958 3300025960 Bacteria 998
306 Ga0207651_10596505 3300025960 Bacteria 965
307 Ga0207651_10768843 3300025960 Bacteria 852
308 Ga0207712_10814812 3300025961 Bacteria 821
309 Ga0207712_10833064 3300025961 Bacteria 812
310 Ga0207712_11417994 3300025961 Bacteria 622
311 Ga0207668_10711382 3300025972 Bacteria 883
312 Ga0207640_10380025 3300025981 Bacteria 1144
313 Ga0207640_10721248 3300025981 Bacteria 857
314 Ga0207677_10095694 3300026023 Bacteria 2171
315 Ga0207677_10291986 3300026023 Bacteria 1343
316 Ga0207703_10044412 3300026035 Bacteria 3571
317 Ga0207703_11613754 3300026035 Bacteria 624
318 Ga0207639_11010619 3300026041 Bacteria 779
319 Ga0207708_10009931 3300026075 Bacteria 7066
320 Ga0207708_10039682 3300026075 Bacteria 3588
321 Ga0207708_10120158 3300026075 Bacteria 2047
322 Ga0207708_10130705 3300026075 Bacteria 1963
323 Ga0207641_10366448 3300026088 Bacteria 1377
324 Ga0207641_10511765 3300026088 Bacteria 1167
325 Ga0207648_10052480 3300026089 Bacteria 3565
326 Ga0207648_10059380 3300026089 Bacteria 3335
327 Ga0207648_10219556 3300026089 Bacteria 1689
328 Ga0207648_10335411 3300026089 Bacteria 1361
329 Ga0207648_10632347 3300026089 Bacteria 988
330 Ga0207676_10017226 3300026095 Bacteria 5236
331 Ga0207676_10066169 3300026095 Bacteria 2881
332 Ga0207676_10073059 3300026095 Bacteria 2759
333 Ga0207676_10255827 3300026095 Bacteria 1578
334 Ga0207674_10106811 3300026116 Bacteria 2776
335 Ga0207674_10189628 3300026116 Bacteria 2006
336 Ga0207674_11687133 3300026116 Bacteria 602
337 Ga0207675_100040086 3300026118 Bacteria 4371
338 Ga0207675_100073390 3300026118 Bacteria 3202
339 Ga0207675_100468955 3300026118 Bacteria 1250
340 Ga0207675_100787402 3300026118 Bacteria 964
341 Ga0207675_100907153 3300026118 Bacteria 898
342 Ga0207683_10121911 3300026121 Bacteria 2341
343 Ga0207683_10378550 3300026121 Bacteria 1301
344 Ga0207698_10408842 3300026142 Bacteria 1299
345 Ga0209983_1023318 3300027665 Bacteria 1299
346 Ga0207428_10012558 3300027907 Bacteria 7436
347 Ga0268266_10001066 3300028379 Bacteria 34388
348 Ga0268266_10365791 3300028379 Bacteria 1358
349 Ga0268265_10050414 3300028380 Bacteria 3136
350 Ga0268265_10183173 3300028380 Bacteria 1801
351 Ga0268265_10193935 3300028380 Bacteria 1756
352 Ga0268264_10208377 3300028381 Bacteria 1793
353 Ga0268264_10877844 3300028381 Bacteria 899
354 Ga0268264_11682292 3300028381 Bacteria 645
355 Ga0307416_100395287 3300032002 Bacteria 1418
356 Ga0307414_10264642 3300032004 Bacteria 1437
357 Ga0373948_0001538 3300034817 Bacteria 3229
358 Ga0373950_0005139 3300034818 Bacteria 1944
359 Ga0373959_0014104 3300034820 Bacteria 1450
360 Ga0373938_0000602 3300034957 Bacteria 5809
361 Ga0373928_0000582 3300035084 Bacteria 7177
362 Ga0373929_0000608 3300035085 Bacteria 6923
363 Ga0373934_0355564 3300035086 Bacteria 610
364 Ga0373940_0000552 3300035088 Bacteria 5913
365 Ga0373949_0005098 3300035090 Bacteria 2952
366 Ga0373951_0003261 3300035091 Bacteria 3969
367 Ga0373941_0018103 3300035115 Bacteria 1941
368 Ga0373945_0495863 3300035116 Bacteria 544
369 Ga0373953_0145785 3300035117 Bacteria 1014
370 Ga0373960_0000397 3300035121 Bacteria 8500
371 Ga0373946_0569586 3300035171 Bacteria 585
372 Ga0373955_0273213 3300035172 Bacteria 1016
373 Ga0373955_0616903 3300035172 Unclassified 665
374 Ga0373942_0001953 3300035207 Bacteria 5156
375 Ga0373961_0007541 3300035241 Bacteria 2634
376 Ga0373962_0005085 3300035242 Bacteria 3177
377 Ga0373931_0049543 3300035691 Bacteria 2231
378 Ga0373931_0787045 3300035691 Bacteria 633
379 Ga0373935_0069391 3300035692 Bacteria 2270
380 Ga0373935_0602320 3300035692 Bacteria 804
381 Ga0373927_0162974 3300035695 Bacteria 1461
382 Ga0373933_0719594 3300035724 Unclassified 657
383 Ga0373947_0296566 3300035725 Bacteria 1077
384 Ga0373937_0024194 3300036401 Bacteria 5475
385 Ga0373937_0160057 3300036401 Bacteria 2111
386 Ga0373937_1893785 3300036401 Bacteria 543
387 Ga0373925_0331560 3300037068 Bacteria 1233
388 Ga0373925_0903311 3300037068 Bacteria 728
389 Ga0451853_0999534 3300041512 Bacteria 605
390 Ga0439433_0016672 3300041999 Bacteria 1629
391 Ga0439462_0079944 3300042015 Bacteria 892
392 Ga0439446_0063057 3300042156 Bacteria 1123
393 Ga0439435_0024534 3300042436 Bacteria 1592
394 Ga0439444_0098171 3300042437 Bacteria 661
395 Ga0453683_1230150 3300044673 Bacteria 502
396 Ga0466963_0300075 3300044694 Bacteria 1130
397 Ga0451576_0026335 3300045051 Bacteria 6256
398 Ga0451576_0255963 3300045051 Bacteria 1830
399 Ga0451576_0351738 3300045051 Bacteria 1543
400 Ga0495592_0273174 3300046454 Bacteria 1108
401 Ga0495629_0530093 3300046459 Bacteria 792
402 Ga0495653_0885861 3300046463 Bacteria 532
403 Ga0495582_0149278 3300046473 Bacteria 1327
404 Ga0495582_0664989 3300046473 Bacteria 603
405 Ga0495664_0052556 3300046477 Bacteria 2422
406 Ga0495628_0184325 3300046516 Bacteria 1578
407 Ga0495652_0955387 3300046529 Bacteria 563
408 Ga0495645_0010938 3300046543 Bacteria 6374
409 Ga0495667_0278211 3300046559 Bacteria 1062
410 Ga0495667_0871245 3300046559 Bacteria 553
411 Ga0495634_0267710 3300046642 Bacteria 1041
412 Ga0495634_0601579 3300046642 Bacteria 638
413 Ga0495635_0910164 3300046663 Bacteria 563
414 Ga0495599_0286929 3300046678 Bacteria 996
415 Ga0495647_0230350 3300046681 Bacteria 820
416 Ga0495658_0028022 3300046683 Bacteria 3037
417 Ga0495658_0740780 3300046683 Bacteria 630
418 Ga0495669_0196423 3300046684 Bacteria 964
419 Ga0495669_0204856 3300046684 Bacteria 943
420 Ga0495613_0209684 3300046689 Bacteria 1371
421 Ga0495600_0138572 3300046809 Bacteria 1579
422 Ga0495672_0330812 3300047320 Bacteria 713
423 Ga0495676_0229200 3300047321 Bacteria 1277
424 Ga0495680_0353870 3300047322 Bacteria 1022
425 Ga0495680_0512470 3300047322 Bacteria 813
426 Ga0495675_0735018 3300047444 Bacteria 550
427 Ga0496101_0418518 3300048904 Bacteria 1056
428 Ga0496102_0080846 3300048905 Bacteria 2995
429 Ga0496102_0464406 3300048905 Bacteria 1187
430 Ga0496104_0109919 3300048907 Bacteria 2642
431 Ga0496104_0295606 3300048907 Bacteria 1532
432 Ga0496104_1399015 3300048907 Bacteria 603
433 Ga0496106_0235656 3300048909 Bacteria 1462
434 Ga0496106_0388251 3300048909 Bacteria 1122
435 Ga0496107_0640628 3300048910 Bacteria 784
436 Ga0496108_0004939 3300048911 Bacteria 10774
437 Ga0496111_0097458 3300048914 Bacteria 2158
438 Ga0496112_0010486 3300048915 Bacteria 8406
439 Ga0496112_0189510 3300048915 Bacteria 2019
440 Ga0496112_0230384 3300048915 Bacteria 1807
441 Ga0496112_0633572 3300048915 Bacteria 1000
442 Ga0496113_0027825 3300048916 Bacteria 4058
443 Ga0496114_0053546 3300048917 Bacteria 3364
444 Ga0496114_0162714 3300048917 Bacteria 1941
445 Ga0496115_0182181 3300048918 Bacteria 1736
446 Ga0501042_1319682 3300049578 Bacteria 526
447 Ga0501067_0324755 3300049583 Bacteria 857
448 nmdc:mga07m45_296177_c1 3300050496 Bacteria 941
449 nmdc:mga05p37_108787_c1 3300050507 Bacteria 3410
450 nmdc:mga05p37_307547_c1 3300050507 Bacteria 1880
451 nmdc:mga05p37_3312_c1 3300050507 Bacteria 18799
452 nmdc:mga05p37_777387_c1 3300050507 Bacteria 1051
453 nmdc:mga08y16_9368_c1 3300050511 Bacteria 10270
454 nmdc:mga0n895_134421_c1 3300050512 Bacteria 2499
455 nmdc:mga0n895_140326_c1 3300050512 Bacteria 2445
456 nmdc:mga0n895_245232_c1 3300050512 Bacteria 1818
457 nmdc:mga0n895_406300_c1 3300050512 Bacteria 1377
458 nmdc:mga0n895_80296_c1 3300050512 Bacteria 3250
459 nmdc:mga0rr50_1120387_c1 3300050513 Bacteria 669
460 nmdc:mga0rr50_14496_c1 3300050513 Bacteria 5175
461 nmdc:mga0rr50_49175_c1 3300050513 Bacteria 3121
462 nmdc:mga0rr50_548014_c1 3300050513 Bacteria 985
463 nmdc:mga0rr50_614_c1 3300050513 Bacteria 19086
464 nmdc:mga08x19_10221_c1 3300050514 Bacteria 5630
465 nmdc:mga08x19_36273_c1 3300050514 Bacteria 3123
466 nmdc:mga08x19_541275_c1 3300050514 Bacteria 824
467 nmdc:mga0a205_107365_c1 3300050515 Bacteria 2689
468 nmdc:mga0a205_79923_c1 3300050515 Bacteria 3160
469 Ga0495601_0169737 3300053077 Bacteria 1426
470 Ga0495601_0372752 3300053077 Bacteria 927
471 Ga0495601_0846890 3300053077 Bacteria 579
472 Ga0495595_0693553 3300053084 Bacteria 522
473 Ga0495619_0075870 3300053085 Bacteria 2256
474 Ga0590071_025594 3300059421 Bacteria 1399
475 Ga0590071_045269 3300059421 Bacteria 1062
476 Ga0590075_050402 3300059424 Bacteria 1068
477 Ga0070697_100383808
478 JGI24751J29686_10129576
479 Ga0065712_10150129
480 Ga0065715_10684068
481 Ga0065707_10260024
482 Ga0065707_10312974
483 Ga0070658_10063667
484 Ga0070676_10108979
485 Ga0070683_100773390
486 Ga0070690_100659595
487 Ga0070690_100664472
488 Ga0070670_100078754
489 Ga0070670_100359813
490 Ga0068869_100085943
491 Ga0068869_101066616
492 Ga0070666_10044751
493 Ga0070666_10290817
494 Ga0070666_10381059
495 Ga0070666_10482217
496 Ga0070666_10500708
497 Ga0070680_100095045
498 Ga0070680_100580294
499 Ga0070682_100473718
500 Ga0068868_100203092
501 Ga0068868_100996895
502 Ga0070660_100051620
503 Ga0070660_100424166
504 Ga0070689_100824272
505 Ga0070689_100979796
506 Ga0070689_101468093
507 Ga0070691_10005442
508 Ga0070687_100115430
509 Ga0070687_100434034
510 Ga0070661_100181608
511 Ga0070692_10687689
512 Ga0070668_100249963
513 Ga0070668_100451930
514 Ga0070669_100074371
515 Ga0070669_100219281
516 Ga0070669_100601910
517 Ga0070675_100000509
518 Ga0070675_100082735
519 Ga0070674_100049201
520 Ga0070674_100678277
521 Ga0070673_100914141
522 Ga0070659_100497495
523 Ga0070667_101525627
524 Ga0070709_10093843
525 Ga0070713_101974986
526 Ga0070710_10338763
527 Ga0070705_100023105
528 Ga0070705_100027196
529 Ga0070705_100579399
530 Ga0070705_100642758
531 Ga0070700_100020748
532 Ga0070700_100024980
533 Ga0070700_100428121
534 Ga0070694_100005613
535 Ga0070694_100050090
536 Ga0070708_100270992
537 Ga0070678_100107645
538 Ga0070678_100523960
539 Ga0070662_100376398
540 Ga0070681_10194459
541 Ga0068867_100166383
542 Ga0068867_100222520
543 Ga0068867_100232872
544 Ga0068867_100471354
545 Ga0070685_10242671
546 Ga0070685_11535376
547 Ga0070706_100793840
548 Ga0070707_100139869
549 Ga0070707_100864044
550 Ga0070698_100028678
551 Ga0070698_100050664
552 Ga0070698_100101180
553 Ga0070698_100753900
554 Ga0070698_101006422
555 Ga0070699_100081274
556 Ga0070679_100064425
557 Ga0070679_100887483
558 Ga0070679_101398600
559 Ga0070684_100715291
560 Ga0070684_101520000
561 Ga0070697_100429619
562 Ga0070697_100848771
563 Ga0068853_100195106
564 Ga0070686_100002747
565 Ga0070686_100925315
566 Ga0070695_101457242
567 Ga0070696_100163613
568 Ga0070696_100256280
569 Ga0070696_100444658
570 Ga0070696_100588046
571 Ga0070693_100211104
572 Ga0070665_100002497
573 Ga0070665_100003475
574 Ga0070665_101053889
575 Ga0070704_100080179
576 Ga0070704_100200199
577 Ga0070704_100685173
578 Ga0070704_100769030
579 Ga0070704_100817537
580 Ga0068855_100029520
581 Ga0068855_100962121
582 Ga0068857_101779937
583 Ga0068857_101798255
584 Ga0068854_100153055
585 Ga0070702_100014595
586 Ga0070702_100701838
587 Ga0068859_100138773
588 Ga0068859_100407318
589 Ga0068859_100688953
590 Ga0068859_100858363
591 Ga0068864_100007760
592 Ga0068864_100022243
593 Ga0068864_100073478
594 Ga0068866_10308550
595 Ga0068866_10475802
596 Ga0068861_100165552
597 Ga0068861_100389666
598 Ga0068861_100760996
599 Ga0068861_101092529
600 Ga0068851_10192197
601 Ga0068851_10348634
602 Ga0068863_100386129
603 Ga0068863_100657133
604 Ga0068863_101965345
605 Ga0068858_100004215
606 Ga0068858_100161360
607 Ga0068858_100430312
608 Ga0068860_100417815
609 Ga0068862_100155112
610 Ga0068862_100299640
611 Ga0068862_100311266
612 Ga0068862_100627163
613 Ga0068862_100802877
614 Ga0070716_100658478
615 Ga0097621_100035529
616 Ga0097621_100038025
617 Ga0097621_100098387
618 Ga0068871_100006929
619 Ga0068871_100145583
620 Ga0068871_100376068
621 Ga0068871_100488782
622 Ga0068871_101543361
623 Ga0068871_102239832
624 Ga0075433_10067073
625 Ga0075433_10476440
626 Ga0075434_100007687
627 Ga0075434_100019014
628 Ga0075434_100137288
629 Ga0075434_100401323
630 Ga0075434_100458947
631 Ga0075434_100472186
632 Ga0068865_100004400
633 Ga0068865_100140726
634 Ga0075436_100123464
635 Ga0075436_100144261
636 Ga0075436_100817484
637 Ga0097620_100138765
638 Ga0097620_100407301
639 Ga0097620_100689052
640 Ga0097620_100858395
641 Ga0075435_100000623
642 Ga0075435_100001801
643 Ga0075435_100029332
644 Ga0075435_101254816
645 Ga0105240_10392254
646 Ga0105240_10833620
647 Ga0105240_12518749
648 Ga0111539_10066872
649 Ga0105245_10054120
650 Ga0105245_11035497
651 Ga0105245_11169654
652 Ga0105245_11247298
653 Ga0105247_10008220
654 Ga0105247_10110476
655 Ga0105247_10362851
656 Ga0114129_10002050
657 Ga0114129_10002528
658 Ga0114129_10203462
659 Ga0114129_10313114
660 Ga0105243_10046963
661 Ga0105243_10213920
662 Ga0105243_10804877
663 Ga0105243_11571039
664 Ga0105241_10049566
665 Ga0105242_10031269
666 Ga0105242_10073407
667 Ga0105242_10440920
668 Ga0105248_10001685
669 Ga0105248_10007672
670 Ga0105248_10020487
671 Ga0105248_10035128
672 Ga0105248_10170003
673 Ga0105248_10583885
674 Ga0105248_11013341
675 Ga0105248_11687415
676 Ga0105248_11916755
677 Ga0105237_10520975
678 Ga0105238_10124686
679 Ga0105238_10238372
680 Ga0105238_11189941
681 Ga0105249_10582525
682 Ga0105249_10815122
683 Ga0105249_11144239
684 Ga0105249_12912730
685 Ga0105239_12513724
686 Ga0105246_11214546
687 Ga0105246_12470414
688 Ga0157374_10033838
689 Ga0157374_10705170
690 Ga0157374_12937503
691 Ga0157378_13068020
692 Ga0163162_10328158
693 Ga0163162_11097608
694 Ga0163162_12823027
695 Ga0157375_10234790
696 Ga0157375_10658668
697 Ga0157375_11186828
698 Ga0157375_11448319
699 Ga0157375_11939443
700 Ga0163163_10004667
701 Ga0163163_10079936
702 Ga0163163_10200520
703 Ga0157380_10140479
704 Ga0157380_10345980
705 Ga0157377_10094860
706 Ga0157379_10088912
707 Ga0157379_10108643
708 Ga0157379_10703114
709 Ga0157379_11694563
710 Ga0157376_10019539
711 Ga0157376_10818822
712 Ga0157376_13010826
713 Ga0163161_11193292
714 Ga0163161_11316342
715 Ga0207656_10416240
716 Ga0207682_10053771
717 Ga0207642_10153375
718 Ga0207710_10018074
719 Ga0207710_10566351
720 Ga0207688_10834767
721 Ga0207680_10270434
722 Ga0207680_10424329
723 Ga0207680_10517578
724 Ga0207685_10779307
725 Ga0207645_10031795
726 Ga0207645_10178174
727 Ga0207643_10838973
728 Ga0207695_10285559
729 Ga0207695_10797935
730 Ga0207671_11197505
731 Ga0207660_10534066
732 Ga0207662_10063887
733 Ga0207657_10011250
734 Ga0207652_10102182
735 Ga0207646_10486414
736 Ga0207681_10205844
737 Ga0207681_10293372
738 Ga0207694_10113670
739 Ga0207694_10710772
740 Ga0207694_10769920
741 Ga0207650_10055757
742 Ga0207650_10098667
743 Ga0207650_10612858
744 Ga0207650_10698102
745 Ga0207650_11123452
746 Ga0207659_10002625
747 Ga0207659_10738171
748 Ga0207659_11345830
749 Ga0207687_10040995
750 Ga0207687_10576848
751 Ga0207687_11252704
752 Ga0207644_10859554
753 Ga0207706_10197378
754 Ga0207686_10023443
755 Ga0207686_10042615
756 Ga0207686_10196615
757 Ga0207709_10216731
758 Ga0207709_10226839
759 Ga0207670_10932666
760 Ga0207669_10217023
761 Ga0207669_11367095
762 Ga0207704_10107629
763 Ga0207704_11371351
764 Ga0207704_11714426
765 Ga0207665_10200045
766 Ga0207665_10264674
767 Ga0207665_10894687
768 Ga0207665_10985179
769 Ga0207691_10242389
770 Ga0207691_10531490
771 Ga0207711_10002785
772 Ga0207711_10178259
773 Ga0207711_10199781
774 Ga0207711_10904732
775 Ga0207711_10926538
776 Ga0207711_11027290
777 Ga0207711_11859040
778 Ga0207689_10136953
779 Ga0207679_10310170
780 Ga0207667_10176245
781 Ga0207651_10556958
782 Ga0207651_10596505
783 Ga0207651_10768843
784 Ga0207712_10814812
785 Ga0207712_10833064
786 Ga0207712_11417994
787 Ga0207668_10711382
788 Ga0207640_10380025
789 Ga0207640_10721248
790 Ga0207677_10095694
791 Ga0207677_10291986
792 Ga0207703_10044412
793 Ga0207703_11613754
794 Ga0207639_11010619
795 Ga0207708_10009931
796 Ga0207708_10039682
797 Ga0207708_10120158
798 Ga0207708_10130705
799 Ga0207641_10366448
800 Ga0207641_10511765
801 Ga0207648_10052480
802 Ga0207648_10059380
803 Ga0207648_10219556
804 Ga0207648_10335411
805 Ga0207648_10632347
806 Ga0207676_10017226
807 Ga0207676_10066169
808 Ga0207676_10073059
809 Ga0207676_10255827
810 Ga0207674_10106811
811 Ga0207674_10189628
812 Ga0207674_11687133
813 Ga0207675_100040086
814 Ga0207675_100073390
815 Ga0207675_100468955
816 Ga0207675_100787402
817 Ga0207675_100907153
818 Ga0207683_10121911
819 Ga0207683_10378550
820 Ga0207698_10408842
821 Ga0209983_1023318
822 Ga0207428_10012558
823 Ga0268266_10001066
824 Ga0268266_10365791
825 Ga0268265_10050414
826 Ga0268265_10183173
827 Ga0268265_10193935
828 Ga0268264_10208377
829 Ga0268264_10877844
830 Ga0268264_11682292
831 Ga0307416_100395287
832 Ga0307414_10264642
833 Ga0373948_0001538
834 Ga0373950_0005139
835 Ga0373959_0014104
836 Ga0373938_0000602
837 Ga0373928_0000582
838 Ga0373929_0000608
839 Ga0373934_0355564
840 Ga0373940_0000552
841 Ga0373949_0005098
842 Ga0373951_0003261
843 Ga0373941_0018103
844 Ga0373945_0495863
845 Ga0373953_0145785
846 Ga0373960_0000397
847 Ga0373946_0569586
848 Ga0373955_0273213
849 Ga0373955_0616903
850 Ga0373942_0001953
851 Ga0373961_0007541
852 Ga0373962_0005085
853 Ga0373931_0049543
854 Ga0373931_0787045
855 Ga0373935_0069391
856 Ga0373935_0602320
857 Ga0373927_0162974
858 Ga0373933_0719594
859 Ga0373947_0296566
860 Ga0373937_0024194
861 Ga0373937_0160057
862 Ga0373937_1893785
863 Ga0373925_0331560
864 Ga0373925_0903311
865 Ga0451853_0999534
866 Ga0439433_0016672
867 Ga0439462_0079944
868 Ga0439446_0063057
869 Ga0439435_0024534
870 Ga0439444_0098171
871 Ga0453683_1230150
872 Ga0466963_0300075
873 Ga0451576_0026335
874 Ga0451576_0255963
875 Ga0451576_0351738
876 Ga0495592_0273174
877 Ga0495629_0530093
878 Ga0495653_0885861
879 Ga0495582_0149278
880 Ga0495582_0664989
881 Ga0495664_0052556
882 Ga0495628_0184325
883 Ga0495652_0955387
884 Ga0495645_0010938
885 Ga0495667_0278211
886 Ga0495667_0871245
887 Ga0495634_0267710
888 Ga0495634_0601579
889 Ga0495635_0910164
890 Ga0495599_0286929
891 Ga0495647_0230350
892 Ga0495658_0028022
893 Ga0495658_0740780
894 Ga0495669_0196423
895 Ga0495669_0204856
896 Ga0495613_0209684
897 Ga0495600_0138572
898 Ga0495672_0330812
899 Ga0495676_0229200
900 Ga0495680_0353870
901 Ga0495680_0512470
902 Ga0495675_0735018
903 Ga0496101_0418518
904 Ga0496102_0080846
905 Ga0496102_0464406
906 Ga0496104_0109919
907 Ga0496104_0295606
908 Ga0496104_1399015
909 Ga0496106_0235656
910 Ga0496106_0388251
911 Ga0496107_0640628
912 Ga0496108_0004939
913 Ga0496111_0097458
914 Ga0496112_0010486
915 Ga0496112_0189510
916 Ga0496112_0230384
917 Ga0496112_0633572
918 Ga0496113_0027825
919 Ga0496114_0053546
920 Ga0496114_0162714
921 Ga0496115_0182181
922 Ga0501042_1319682
923 Ga0501067_0324755
924 nmdc:mga07m45_296177_c1
925 nmdc:mga05p37_108787_c1
926 nmdc:mga05p37_307547_c1
927 nmdc:mga05p37_3312_c1
928 nmdc:mga05p37_777387_c1
929 nmdc:mga08y16_9368_c1
930 nmdc:mga0n895_134421_c1
931 nmdc:mga0n895_140326_c1
932 nmdc:mga0n895_245232_c1
933 nmdc:mga0n895_406300_c1
934 nmdc:mga0n895_80296_c1
935 nmdc:mga0rr50_1120387_c1
936 nmdc:mga0rr50_14496_c1
937 nmdc:mga0rr50_49175_c1
938 nmdc:mga0rr50_548014_c1
939 nmdc:mga0rr50_614_c1
940 nmdc:mga08x19_10221_c1
941 nmdc:mga08x19_36273_c1
942 nmdc:mga08x19_541275_c1
943 nmdc:mga0a205_107365_c1
944 nmdc:mga0a205_79923_c1
945 Ga0495601_0169737
946 Ga0495601_0372752
947 Ga0495601_0846890
948 Ga0495595_0693553
949 Ga0495619_0075870
950 Ga0590071_025594
951 Ga0590071_045269
952 Ga0590075_050402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

15

136

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.981 7 123
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9753 7 123
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9719 1 123
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9702 4 123
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9567 1 123
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9797 6 122 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9746 7 123 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.971 7 124 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.959 4 124 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9563 4 123 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2N3UGE6-F1-model_v4 deleted 0.9941 3 123
AF-I3ZKV0-F1-model_v4 Glycine cleavage system H protein 0.9921 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A167JUD1-F1-model_v4 Glycine cleavage system H protein 0.9913 7 123 GO:0005739
GO:0005960
GO:0019464
AF-A0A7D7XBD9-F1-model_v4 Glycine cleavage system H protein 0.9909 1 124 GO:0005829
GO:0005960
GO:0019464
AF-A0A534PDN6-F1-model_v4 Glycine cleavage system H protein 0.9909 5 123 GO:0005829
GO:0005960
GO:0019464

Map