F451373

General Info

Members Datasets Scaffolds Average Seq Length
475 197 950 100

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10115153|Ga0265328_101151532
Length 116
Sequence MGCYAKAAPKPVAGPSMPELPELNPLIHGKLRLALLSLLITAEEAEFTWLRTKTGSTDGNLGAQLAKLEEAGYVSVEKKFVQRKPQTLYRMTETGRQALTEYVQALKQLLGSSINV

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.21
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 27.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10115153 3300031239 Unclassified 1000
2 LJNas_1000701 3300000546 Bacteria 5642
3 LJNas_1033318 3300000546 Unclassified 555
4 JGI24743J22301_10037775 3300001991 Bacteria 963
5 rootH1_10188349 3300003316 Bacteria 1169
6 rootH2_10089616 3300003320 Bacteria 8005
7 rootH2_10098672 3300003320 Bacteria 4958
8 rootH2_10204530 3300003320 Bacteria 1793
9 Ga0070658_10037254 3300005327 Bacteria 3920
10 Ga0070658_10745101 3300005327 Unclassified 851
11 Ga0070658_10792804 3300005327 Bacteria 823
12 Ga0070658_11062288 3300005327 Unclassified 704
13 Ga0070683_100016273 3300005329 Bacteria 6556
14 Ga0070683_100530108 3300005329 Unclassified 1125
15 Ga0070670_100002315 3300005331 Bacteria 15705
16 Ga0068869_100009850 3300005334 Bacteria 6206
17 Ga0070666_10585455 3300005335 Bacteria 813
18 Ga0070680_100752538 3300005336 Bacteria 839
19 Ga0070682_100352970 3300005337 Unclassified 1097
20 Ga0068868_100002365 3300005338 Bacteria 13055
21 Ga0068868_100096820 3300005338 Bacteria 2384
22 Ga0068868_100118075 3300005338 Bacteria 2161
23 Ga0070661_100178908 3300005344 Bacteria 1613
24 Ga0070661_100859547 3300005344 Bacteria 747
25 Ga0070661_100980681 3300005344 Bacteria 700
26 Ga0070668_100608503 3300005347 Bacteria 957
27 Ga0070675_100190964 3300005354 Bacteria 1775
28 Ga0070671_100014158 3300005355 Bacteria 6440
29 Ga0070671_100026352 3300005355 Bacteria 4777
30 Ga0070673_100453754 3300005364 Bacteria 1153
31 Ga0070659_101763983 3300005366 Bacteria 554
32 Ga0070667_100005505 3300005367 Bacteria 10575
33 Ga0070667_100857468 3300005367 Bacteria 844
34 Ga0070714_100172289 3300005435 Bacteria 1965
35 Ga0070713_100017590 3300005436 Bacteria 5410
36 Ga0070713_100226826 3300005436 Unclassified 1697
37 Ga0070713_100885840 3300005436 Bacteria 858
38 Ga0070713_100947597 3300005436 Bacteria 829
39 Ga0070711_101195990 3300005439 Unclassified 657
40 Ga0070711_101464888 3300005439 Unclassified 595
41 Ga0070711_101570679 3300005439 Bacteria 575
42 Ga0070708_101009193 3300005445 Unclassified 780
43 Ga0070708_101182753 3300005445 Unclassified 715
44 Ga0070663_100821366 3300005455 Unclassified 798
45 Ga0070678_100266236 3300005456 Bacteria 1443
46 Ga0070662_100007091 3300005457 Bacteria 7252
47 Ga0070707_100817102 3300005468 Viruses 896
48 Ga0070679_100297018 3300005530 Bacteria 1566
49 Ga0070679_101405231 3300005530 Unclassified 644
50 Ga0070684_100066092 3300005535 Bacteria 3174
51 Ga0070684_100578793 3300005535 Bacteria 1043
52 Ga0070684_100672997 3300005535 Bacteria 964
53 Ga0070684_100703662 3300005535 Unclassified 942
54 Ga0070684_101144836 3300005535 Unclassified 731
55 Ga0068853_100303257 3300005539 Bacteria 1477
56 Ga0068853_100475519 3300005539 Bacteria 1177
57 Ga0068853_100645644 3300005539 Unclassified 1007
58 Ga0068853_100896366 3300005539 Unclassified 852
59 Ga0070672_100136857 3300005543 Bacteria 2018
60 Ga0070695_100608726 3300005545 Bacteria 858
61 Ga0070665_100375176 3300005548 Bacteria 1429
62 Ga0070665_100434693 3300005548 Bacteria 1322
63 Ga0068855_100014451 3300005563 Bacteria 9506
64 Ga0068855_100114167 3300005563 Unclassified 3097
65 Ga0068855_100310466 3300005563 Bacteria 1745
66 Ga0068855_100414846 3300005563 Bacteria 1474
67 Ga0068855_100452120 3300005563 Unclassified 1401
68 Ga0068855_100480278 3300005563 Bacteria 1353
69 Ga0068855_100775963 3300005563 Unclassified 1020
70 Ga0068855_101882699 3300005563 Unclassified 606
71 Ga0070664_100190165 3300005564 Bacteria 1829
72 Ga0068857_100001442 3300005577 Bacteria 18866
73 Ga0068857_100021631 3300005577 Bacteria 5660
74 Ga0068854_100297221 3300005578 Bacteria 1305
75 Ga0068856_100005873 3300005614 Bacteria 12104
76 Ga0068856_100009567 3300005614 Bacteria 9414
77 Ga0068856_100057858 3300005614 Bacteria 3828
78 Ga0068856_100175914 3300005614 Unclassified 2152
79 Ga0068856_100213382 3300005614 Bacteria 1945
80 Ga0068856_100872852 3300005614 Bacteria 919
81 Ga0068852_100009146 3300005616 Bacteria 7339
82 Ga0068852_100110043 3300005616 Bacteria 2503
83 Ga0068852_100188584 3300005616 Bacteria 1944
84 Ga0068852_100739277 3300005616 Bacteria 995
85 Ga0068852_101007280 3300005616 Bacteria 852
86 Ga0068852_102812242 3300005616 Unclassified 505
87 Ga0068859_100009938 3300005617 Bacteria 9601
88 Ga0068864_100018058 3300005618 Bacteria 5887
89 Ga0068864_100480764 3300005618 Bacteria 1192
90 Ga0068866_11016485 3300005718 Unclassified 590
91 Ga0068851_10015702 3300005834 Bacteria 3612
92 Ga0068851_10066437 3300005834 Bacteria 1858
93 Ga0068851_10273265 3300005834 Bacteria 964
94 Ga0068863_100004286 3300005841 Bacteria 14048
95 Ga0068863_100804954 3300005841 Unclassified 937
96 Ga0068863_101608224 3300005841 Unclassified 659
97 Ga0068858_100015356 3300005842 Bacteria 7201
98 Ga0068858_100022357 3300005842 Bacteria 5904
99 Ga0068858_100066244 3300005842 Bacteria 3343
100 Ga0068860_100000671 3300005843 Bacteria 39557
101 Ga0068862_100245599 3300005844 Bacteria 1629
102 Ga0070717_11063704 3300006028 Bacteria 737
103 Ga0070712_100497532 3300006175 Bacteria 1021
104 Ga0070712_100865459 3300006175 Bacteria 778
105 Ga0097621_100006233 3300006237 Bacteria 8460
106 Ga0097621_100436562 3300006237 Bacteria 1177
107 Ga0068871_100004287 3300006358 Bacteria 9898
108 Ga0068865_100333452 3300006881 Bacteria 1224
109 Ga0097620_100009938 3300006931 Bacteria 9601
110 Ga0105240_10006322 3300009093 Bacteria 17434
111 Ga0105240_10015471 3300009093 Bacteria 10373
112 Ga0105240_10030669 3300009093 Bacteria 6985
113 Ga0105240_10108867 3300009093 Bacteria 3356
114 Ga0105240_10129491 3300009093 Unclassified 3028
115 Ga0105240_10140667 3300009093 Bacteria 2886
116 Ga0105240_10253033 3300009093 Bacteria 2036
117 Ga0105240_10558861 3300009093 Bacteria 1265
118 Ga0105240_10830074 3300009093 Bacteria 999
119 Ga0105245_10002113 3300009098 Bacteria 17986
120 Ga0105245_10036065 3300009098 Bacteria 4391
121 Ga0105245_10291479 3300009098 Bacteria 1598
122 Ga0105247_10018457 3300009101 Bacteria 4184
123 Ga0105247_11511405 3300009101 Bacteria 548
124 Ga0105243_10192039 3300009148 Bacteria 1784
125 Ga0105241_10000141 3300009174 Bacteria 50990
126 Ga0105241_10157268 3300009174 Bacteria 1865
127 Ga0105241_10337592 3300009174 Bacteria 1304
128 Ga0105241_10554641 3300009174 Bacteria 1032
129 Ga0105241_11294653 3300009174 Bacteria 694
130 Ga0105242_10244416 3300009176 Unclassified 1615
131 Ga0105248_10007636 3300009177 Bacteria 11880
132 Ga0105248_11005960 3300009177 Bacteria 942
133 Ga0105248_11198994 3300009177 Bacteria 858
134 Ga0105237_10005310 3300009545 Bacteria 14574
135 Ga0105237_10020595 3300009545 Bacteria 6796
136 Ga0105237_10108313 3300009545 Unclassified 2770
137 Ga0105237_10217874 3300009545 Unclassified 1909
138 Ga0105237_10286087 3300009545 Bacteria 1651
139 Ga0105237_10812665 3300009545 Unclassified 942
140 Ga0105237_10862982 3300009545 Bacteria 912
141 Ga0105238_10001461 3300009551 Bacteria 23726
142 Ga0105238_10129997 3300009551 Bacteria 2496
143 Ga0105238_10148187 3300009551 Unclassified 2323
144 Ga0105238_10299410 3300009551 Bacteria 1592
145 Ga0105238_10980579 3300009551 Bacteria 866
146 Ga0105238_11226923 3300009551 Unclassified 775
147 Ga0105238_12121277 3300009551 Unclassified 596
148 Ga0105249_10093055 3300009553 Bacteria 2823
149 Ga0105249_10237887 3300009553 Unclassified 1799
150 Ga0105239_10019431 3300010375 Bacteria 7500
151 Ga0105239_10487233 3300010375 Bacteria 1401
152 Ga0105239_10841021 3300010375 Unclassified 1052
153 Ga0105239_10994642 3300010375 Bacteria 964
154 Ga0105239_11926982 3300010375 Unclassified 685
155 Ga0105239_12018715 3300010375 Unclassified 670
156 Ga0105239_12042707 3300010375 Unclassified 666
157 Ga0105246_10000892 3300011119 Bacteria 17162
158 Ga0105246_10466124 3300011119 Bacteria 1065
159 Ga0157370_10119693 3300013104 Bacteria 2458
160 Ga0157370_10340144 3300013104 Bacteria 1383
161 Ga0157370_10488881 3300013104 Unclassified 1131
162 Ga0157370_10749610 3300013104 Bacteria 890
163 Ga0157370_10999392 3300013104 Unclassified 757
164 Ga0157369_10025883 3300013105 Bacteria 6509
165 Ga0157369_10036805 3300013105 Bacteria 5360
166 Ga0157369_10058131 3300013105 Bacteria 4172
167 Ga0157369_10075431 3300013105 Bacteria 3616
168 Ga0157369_10084384 3300013105 Unclassified 3395
169 Ga0157369_10132184 3300013105 Unclassified 2644
170 Ga0157369_10222906 3300013105 Bacteria 1973
171 Ga0157369_10420867 3300013105 Bacteria 1385
172 Ga0157369_10717482 3300013105 Bacteria 1029
173 Ga0157374_10005442 3300013296 Bacteria 10696
174 Ga0157374_10108611 3300013296 Bacteria 2667
175 Ga0157374_10225862 3300013296 Unclassified 1838
176 Ga0157374_10293719 3300013296 Unclassified 1607
177 Ga0157374_10613902 3300013296 Bacteria 1098
178 Ga0157374_10771505 3300013296 Unclassified 977
179 Ga0157374_11325181 3300013296 Bacteria 742
180 Ga0157374_12972842 3300013296 Unclassified 501
181 Ga0157378_10305499 3300013297 Bacteria 1541
182 Ga0157378_10377302 3300013297 Unclassified 1392
183 Ga0157378_11310265 3300013297 Bacteria 766
184 Ga0163162_10352883 3300013306 Bacteria 1603
185 Ga0163162_10908474 3300013306 Bacteria 993
186 Ga0163162_11476680 3300013306 Unclassified 774
187 Ga0157372_10012419 3300013307 Bacteria 9077
188 Ga0157372_10040208 3300013307 Bacteria 5164
189 Ga0157372_10052362 3300013307 Bacteria 4545
190 Ga0157372_10113243 3300013307 Bacteria 3109
191 Ga0157372_10192202 3300013307 Bacteria 2364
192 Ga0157372_10605646 3300013307 Unclassified 1277
193 Ga0157372_10719158 3300013307 Unclassified 1161
194 Ga0157372_12414158 3300013307 Bacteria 604
195 Ga0157375_10002511 3300013308 Bacteria 15913
196 Ga0157375_10171100 3300013308 Bacteria 2320
197 Ga0157375_10577163 3300013308 Bacteria 1285
198 Ga0157375_10913996 3300013308 Bacteria 1021
199 Ga0157375_12420726 3300013308 Unclassified 627
200 Ga0163163_10164837 3300014325 Bacteria 2262
201 Ga0163163_10203882 3300014325 Bacteria 2026
202 Ga0163163_10326786 3300014325 Bacteria 1588
203 Ga0182008_10095150 3300014497 Bacteria 1470
204 Ga0157377_10195551 3300014745 Bacteria 1281
205 Ga0157377_10324402 3300014745 Bacteria 1024
206 Ga0157379_10002017 3300014968 Bacteria 16819
207 Ga0157379_10027029 3300014968 Bacteria 5107
208 Ga0157379_10160153 3300014968 Bacteria 2032
209 Ga0157379_10978961 3300014968 Unclassified 806
210 Ga0157376_10001213 3300014969 Bacteria 17003
211 Ga0157376_10180698 3300014969 Bacteria 1928
212 Ga0157376_10306023 3300014969 Bacteria 1506
213 Ga0157376_10412287 3300014969 Bacteria 1309
214 Ga0157376_10430190 3300014969 Bacteria 1283
215 Ga0163161_10156066 3300017792 Bacteria 1738
216 Ga0224572_1074870 3300024225 Unclassified 625
217 Ga0228598_1053234 3300024227 Unclassified 803
218 Ga0207697_10561707 3300025315 Unclassified 501
219 Ga0207656_10103745 3300025321 Unclassified 1306
220 Ga0207656_10103834 3300025321 Unclassified 1306
221 Ga0207656_10150234 3300025321 Bacteria 1103
222 Ga0207710_10013222 3300025900 Bacteria 3478
223 Ga0207680_10637729 3300025903 Bacteria 762
224 Ga0207647_10019899 3300025904 Unclassified 4506
225 Ga0207645_10026543 3300025907 Bacteria 3743
226 Ga0207654_10000023 3300025911 Bacteria 161401
227 Ga0207654_10000626 3300025911 Bacteria 19965
228 Ga0207707_10638738 3300025912 Bacteria 898
229 Ga0207695_10003596 3300025913 Bacteria 21699
230 Ga0207695_10008464 3300025913 Bacteria 12879
231 Ga0207695_10192981 3300025913 Unclassified 1954
232 Ga0207695_10311017 3300025913 Bacteria 1465
233 Ga0207695_10439506 3300025913 Bacteria 1188
234 Ga0207695_10478011 3300025913 Bacteria 1128
235 Ga0207695_10721969 3300025913 Bacteria 877
236 Ga0207695_10808368 3300025913 Bacteria 818
237 Ga0207671_10000460 3300025914 Bacteria 55816
238 Ga0207671_10040154 3300025914 Unclassified 3464
239 Ga0207671_10521335 3300025914 Unclassified 948
240 Ga0207671_10678759 3300025914 Bacteria 820
241 Ga0207693_10418074 3300025915 Bacteria 1048
242 Ga0207663_10469925 3300025916 Bacteria 973
243 Ga0207663_10784319 3300025916 Bacteria 758
244 Ga0207663_11199562 3300025916 Bacteria 611
245 Ga0207663_11462178 3300025916 Unclassified 550
246 Ga0207649_10553400 3300025920 Bacteria 880
247 Ga0207652_10374034 3300025921 Bacteria 1286
248 Ga0207652_11066175 3300025921 Unclassified 708
249 Ga0207646_10952797 3300025922 Viruses 760
250 Ga0207681_10878062 3300025923 Bacteria 751
251 Ga0207694_10000314 3300025924 Bacteria 45578
252 Ga0207694_10085658 3300025924 Unclassified 2481
253 Ga0207694_10108473 3300025924 Unclassified 2206
254 Ga0207694_10149489 3300025924 Bacteria 1881
255 Ga0207650_10008523 3300025925 Bacteria 6998
256 Ga0207650_10165889 3300025925 Unclassified 1753
257 Ga0207659_10313491 3300025926 Bacteria 1292
258 Ga0207687_10066897 3300025927 Bacteria 2555
259 Ga0207687_10201505 3300025927 Bacteria 1556
260 Ga0207700_10058471 3300025928 Bacteria 2912
261 Ga0207700_10307223 3300025928 Unclassified 1371
262 Ga0207700_10448007 3300025928 Bacteria 1137
263 Ga0207700_10526181 3300025928 Bacteria 1048
264 Ga0207664_11026575 3300025929 Bacteria 739
265 Ga0207664_11067811 3300025929 Unclassified 722
266 Ga0207644_10003840 3300025931 Bacteria 9734
267 Ga0207644_10036836 3300025931 Bacteria 3437
268 Ga0207644_11512708 3300025931 Unclassified 563
269 Ga0207706_10007010 3300025933 Bacteria 10419
270 Ga0207669_10988453 3300025937 Bacteria 707
271 Ga0207704_10703939 3300025938 Bacteria 836
272 Ga0207665_10853052 3300025939 Bacteria 721
273 Ga0207691_10007373 3300025940 Bacteria 10599
274 Ga0207711_10248221 3300025941 Bacteria 1633
275 Ga0207711_10790028 3300025941 Bacteria 884
276 Ga0207689_10002137 3300025942 Bacteria 18591
277 Ga0207689_10005306 3300025942 Bacteria 11547
278 Ga0207661_10003693 3300025944 Bacteria 10670
279 Ga0207679_10267722 3300025945 Bacteria 1460
280 Ga0207667_10075688 3300025949 Bacteria 3494
281 Ga0207667_10399177 3300025949 Bacteria 1400
282 Ga0207667_10649464 3300025949 Unclassified 1061
283 Ga0207667_10707816 3300025949 Bacteria 1009
284 Ga0207667_11617686 3300025949 Unclassified 616
285 Ga0207712_10428006 3300025961 Bacteria 1118
286 Ga0207640_10319969 3300025981 Bacteria 1235
287 Ga0207658_10089190 3300025986 Bacteria 2386
288 Ga0207658_10353664 3300025986 Bacteria 1280
289 Ga0207677_10000709 3300026023 Bacteria 19710
290 Ga0207677_10154449 3300026023 Bacteria 1775
291 Ga0207703_10015906 3300026035 Bacteria 5868
292 Ga0207703_10057750 3300026035 Bacteria 3165
293 Ga0207703_10262283 3300026035 Bacteria 1562
294 Ga0207639_10015125 3300026041 Bacteria 5437
295 Ga0207639_10218937 3300026041 Unclassified 1643
296 Ga0207639_10271887 3300026041 Bacteria 1487
297 Ga0207639_10424711 3300026041 Bacteria 1202
298 Ga0207639_10507027 3300026041 Unclassified 1103
299 Ga0207702_10003557 3300026078 Bacteria 14181
300 Ga0207702_10017546 3300026078 Bacteria 5921
301 Ga0207702_10026618 3300026078 Bacteria 4802
302 Ga0207702_10528754 3300026078 Bacteria 1152
303 Ga0207702_10702574 3300026078 Bacteria 996
304 Ga0207702_10851914 3300026078 Unclassified 902
305 Ga0207641_10002087 3300026088 Bacteria 18931
306 Ga0207641_12287588 3300026088 Unclassified 540
307 Ga0207648_10258881 3300026089 Unclassified 1552
308 Ga0207676_10238981 3300026095 Bacteria 1628
309 Ga0207676_10740563 3300026095 Bacteria 955
310 Ga0207674_10001660 3300026116 Bacteria 28638
311 Ga0207674_10003725 3300026116 Bacteria 18610
312 Ga0207683_10000613 3300026121 Bacteria 32920
313 Ga0207698_10013690 3300026142 Bacteria 5362
314 Ga0207698_10023173 3300026142 Unclassified 4332
315 Ga0207698_10043630 3300026142 Unclassified 3362
316 Ga0207698_11026347 3300026142 Unclassified 836
317 Ga0207698_11362481 3300026142 Unclassified 724
318 Ga0265357_1019399 3300028023 Unclassified 738
319 Ga0268266_10157162 3300028379 Bacteria 2055
320 Ga0268266_10616154 3300028379 Bacteria 1043
321 Ga0268265_10261283 3300028380 Bacteria 1539
322 Ga0268264_10001376 3300028381 Bacteria 22762
323 Ga0265318_10034583 3300028577 Bacteria 1947
324 Ga0265336_10003881 3300028666 Bacteria 5742
325 Ga0265336_10055700 3300028666 Unclassified 1188
326 Ga0265338_10003453 3300028800 Bacteria 22250
327 Ga0265338_10003987 3300028800 Bacteria 20307
328 Ga0265338_10099505 3300028800 Bacteria 2374
329 Ga0265338_10409176 3300028800 Bacteria 966
330 Ga0265338_10584073 3300028800 Bacteria 779
331 Ga0265338_10589148 3300028800 Unclassified 775
332 Ga0265338_10793567 3300028800 Unclassified 649
333 Ga0265324_10275845 3300029957 Unclassified 571
334 Ga0265770_1015344 3300030878 Bacteria 1165
335 Ga0265770_1159327 3300030878 Unclassified 501
336 Ga0265760_10000892 3300031090 Bacteria 8631
337 Ga0265760_10013450 3300031090 Unclassified 2342
338 Ga0265760_10055941 3300031090 Unclassified 1193
339 Ga0265760_10089722 3300031090 Unclassified 961
340 Ga0265760_10322306 3300031090 Unclassified 550
341 Ga0265330_10000183 3300031235 Bacteria 48463
342 Ga0265330_10004427 3300031235 Bacteria 7132
343 Ga0265330_10008971 3300031235 Bacteria 4773
344 Ga0265330_10064648 3300031235 Unclassified 1589
345 Ga0265330_10082804 3300031235 Bacteria 1381
346 Ga0265330_10309474 3300031235 Unclassified 666
347 Ga0265332_10006857 3300031238 Bacteria 5164
348 Ga0265328_10000803 3300031239 Bacteria 14535
349 Ga0265328_10027135 3300031239 Bacteria 2148
350 Ga0265328_10066020 3300031239 Bacteria 1329
351 Ga0265320_10022530 3300031240 Bacteria 3368
352 Ga0265325_10001037 3300031241 Bacteria 20042
353 Ga0265325_10042884 3300031241 Bacteria 2363
354 Ga0265325_10057186 3300031241 Bacteria 1990
355 Ga0265325_10357466 3300031241 Bacteria 644
356 Ga0265325_10429425 3300031241 Unclassified 577
357 Ga0265329_10008094 3300031242 Bacteria 4017
358 Ga0265340_10004955 3300031247 Bacteria 7402
359 Ga0265340_10022788 3300031247 Bacteria 3199
360 Ga0265340_10030564 3300031247 Unclassified 2699
361 Ga0265340_10034465 3300031247 Unclassified 2518
362 Ga0265340_10105036 3300031247 Bacteria 1310
363 Ga0265340_10434705 3300031247 Unclassified 578
364 Ga0265339_10000177 3300031249 Bacteria 54136
365 Ga0265339_10000196 3300031249 Bacteria 49860
366 Ga0265339_10001134 3300031249 Bacteria 20115
367 Ga0265339_10010383 3300031249 Bacteria 5788
368 Ga0265339_10021798 3300031249 Bacteria 3721
369 Ga0265339_10094357 3300031249 Unclassified 1564
370 Ga0265339_10220605 3300031249 Unclassified 927
371 Ga0265331_10131949 3300031250 Unclassified 1139
372 Ga0265331_10570095 3300031250 Bacteria 511
373 Ga0265316_10002281 3300031344 Bacteria 20077
374 Ga0265316_10005169 3300031344 Bacteria 12776
375 Ga0265316_10013600 3300031344 Bacteria 7220
376 Ga0265316_10019547 3300031344 Bacteria 5787
377 Ga0265316_10057041 3300031344 Bacteria 3047
378 Ga0265316_10094635 3300031344 Bacteria 2276
379 Ga0265316_10198578 3300031344 Bacteria 1488
380 Ga0265316_10313718 3300031344 Bacteria 1140
381 Ga0265316_10389491 3300031344 Bacteria 1005
382 Ga0265316_10464693 3300031344 Bacteria 907
383 Ga0265316_10499063 3300031344 Unclassified 869
384 Ga0265316_10539823 3300031344 Bacteria 831
385 Ga0265313_10002779 3300031595 Bacteria 14758
386 Ga0265313_10040126 3300031595 Bacteria 2317
387 Ga0265313_10160712 3300031595 Unclassified 954
388 Ga0265314_10000162 3300031711 Bacteria 101818
389 Ga0265314_10003191 3300031711 Bacteria 16055
390 Ga0265314_10003600 3300031711 Bacteria 14908
391 Ga0265314_10072040 3300031711 Bacteria 2310
392 Ga0265314_10099489 3300031711 Unclassified 1873
393 Ga0265314_10302073 3300031711 Bacteria 898
394 Ga0265342_10001134 3300031712 Bacteria 25443
395 Ga0265342_10001500 3300031712 Bacteria 21620
396 Ga0265342_10001732 3300031712 Bacteria 19912
397 Ga0265342_10002100 3300031712 Bacteria 17589
398 Ga0265342_10039036 3300031712 Bacteria 2887
399 Ga0265342_10064270 3300031712 Unclassified 2154
400 Ga0265342_10182974 3300031712 Bacteria 1147
401 Ga0265342_10209896 3300031712 Bacteria 1053
402 Ga0265342_10210255 3300031712 Bacteria 1052
403 Ga0265342_10385984 3300031712 Unclassified 725
404 Ga0373934_0190853 3300035086 Bacteria 843
405 Ga0373956_0437483 3300035119 Unclassified 624
406 Ga0373931_0867592 3300035691 Unclassified 605
407 Ga0373937_0621392 3300036401 Bacteria 1025
408 Ga0373937_1204732 3300036401 Bacteria 706
409 Ga0373937_2006968 3300036401 Unclassified 525
410 Ga0395900_1301401 3300037418 Bacteria 641
411 Ga0436360_0365181 3300039438 Unclassified 758
412 Ga0466966_0034443 3300044684 Bacteria 3274
413 Ga0466966_0636156 3300044684 Unclassified 642
414 Ga0466961_0214946 3300044693 Bacteria 1186
415 Ga0466961_0321437 3300044693 Unclassified 944
416 Ga0466961_0966518 3300044693 Unclassified 506
417 Ga0466963_0078144 3300044694 Unclassified 2237
418 Ga0466963_0182962 3300044694 Bacteria 1463
419 Ga0466959_0223046 3300045049 Bacteria 1307
420 Ga0466959_0279436 3300045049 Unclassified 1146
421 Ga0466959_0933715 3300045049 Unclassified 578
422 Ga0451576_1005824 3300045051 Bacteria 874
423 Ga0466958_0109762 3300045836 Bacteria 1722
424 Ga0466967_0075994 3300045976 Bacteria 3020
425 Ga0466967_1016524 3300045976 Bacteria 825
426 Ga0466967_1301277 3300045976 Bacteria 724
427 Ga0495580_0276498 3300046472 Bacteria 1146
428 Ga0495662_0647749 3300046476 Bacteria 516
429 Ga0495606_0523473 3300046507 Unclassified 595
430 Ga0495628_0184337 3300046516 Bacteria 1578
431 Ga0495652_0162550 3300046529 Bacteria 1732
432 Ga0495665_0421077 3300046531 Bacteria 676
433 Ga0495665_0594595 3300046531 Bacteria 553
434 Ga0495586_0348083 3300046535 Unclassified 851
435 Ga0495645_0092052 3300046543 Bacteria 2165
436 Ga0495634_0446343 3300046642 Unclassified 764
437 Ga0495625_0115467 3300046660 Bacteria 1832
438 Ga0495599_0326333 3300046678 Bacteria 923
439 Ga0495599_0637462 3300046678 Bacteria 618
440 Ga0495623_0175745 3300046679 Bacteria 1248
441 Ga0495646_0506426 3300046680 Unclassified 620
442 Ga0495613_0516943 3300046689 Unclassified 802
443 Ga0495670_0834609 3300046691 Bacteria 503
444 Ga0495600_0118257 3300046809 Bacteria 1724
445 Ga0495604_0948784 3300047317 Unclassified 535
446 Ga0495676_0354721 3300047321 Bacteria 980
447 Ga0495684_0297013 3300047471 Bacteria 1161
448 Ga0495684_0474104 3300047471 Bacteria 865
449 Ga0495684_0634133 3300047471 Unclassified 717
450 Ga0495593_0171477 3300047673 Unclassified 1094
451 Ga0495602_0190543 3300048088 Bacteria 1573
452 Ga0495602_0796783 3300048088 Bacteria 635
453 Ga0496100_0044817 3300048903 Bacteria 2835
454 Ga0496101_0078276 3300048904 Bacteria 2438
455 Ga0496102_0694287 3300048905 Unclassified 941
456 Ga0496104_0084981 3300048907 Unclassified 3020
457 Ga0496104_0114797 3300048907 Bacteria 2583
458 Ga0496104_1464415 3300048907 Bacteria 586
459 Ga0496105_0027903 3300048908 Bacteria 4616
460 Ga0496106_0263927 3300048909 Unclassified 1378
461 Ga0496106_0680705 3300048909 Bacteria 821
462 Ga0496107_0019059 3300048910 Bacteria 4839
463 Ga0496108_0771222 3300048911 Bacteria 831
464 Ga0496112_0105459 3300048915 Bacteria 2788
465 Ga0496113_0064809 3300048916 Unclassified 2764
466 Ga0496114_0004896 3300048917 Bacteria 10431
467 Ga0496114_0730463 3300048917 Bacteria 867
468 Ga0496114_1641763 3300048917 Bacteria 531
469 Ga0496115_0010114 3300048918 Bacteria 7036
470 Ga0496115_0224996 3300048918 Bacteria 1548
471 Ga0496115_0628215 3300048918 Bacteria 851
472 Ga0496115_0879980 3300048918 Unclassified 692
473 Ga0495601_0141075 3300053077 Unclassified 1572
474 Ga0495619_0204305 3300053085 Bacteria 1368
475 Ga0495619_0252830 3300053085 Bacteria 1221
476 Ga0265328_10115153
477 LJNas_1000701
478 LJNas_1033318
479 JGI24743J22301_10037775
480 rootH1_10188349
481 rootH2_10089616
482 rootH2_10098672
483 rootH2_10204530
484 Ga0070658_10037254
485 Ga0070658_10745101
486 Ga0070658_10792804
487 Ga0070658_11062288
488 Ga0070683_100016273
489 Ga0070683_100530108
490 Ga0070670_100002315
491 Ga0068869_100009850
492 Ga0070666_10585455
493 Ga0070680_100752538
494 Ga0070682_100352970
495 Ga0068868_100002365
496 Ga0068868_100096820
497 Ga0068868_100118075
498 Ga0070661_100178908
499 Ga0070661_100859547
500 Ga0070661_100980681
501 Ga0070668_100608503
502 Ga0070675_100190964
503 Ga0070671_100014158
504 Ga0070671_100026352
505 Ga0070673_100453754
506 Ga0070659_101763983
507 Ga0070667_100005505
508 Ga0070667_100857468
509 Ga0070714_100172289
510 Ga0070713_100017590
511 Ga0070713_100226826
512 Ga0070713_100885840
513 Ga0070713_100947597
514 Ga0070711_101195990
515 Ga0070711_101464888
516 Ga0070711_101570679
517 Ga0070708_101009193
518 Ga0070708_101182753
519 Ga0070663_100821366
520 Ga0070678_100266236
521 Ga0070662_100007091
522 Ga0070707_100817102
523 Ga0070679_100297018
524 Ga0070679_101405231
525 Ga0070684_100066092
526 Ga0070684_100578793
527 Ga0070684_100672997
528 Ga0070684_100703662
529 Ga0070684_101144836
530 Ga0068853_100303257
531 Ga0068853_100475519
532 Ga0068853_100645644
533 Ga0068853_100896366
534 Ga0070672_100136857
535 Ga0070695_100608726
536 Ga0070665_100375176
537 Ga0070665_100434693
538 Ga0068855_100014451
539 Ga0068855_100114167
540 Ga0068855_100310466
541 Ga0068855_100414846
542 Ga0068855_100452120
543 Ga0068855_100480278
544 Ga0068855_100775963
545 Ga0068855_101882699
546 Ga0070664_100190165
547 Ga0068857_100001442
548 Ga0068857_100021631
549 Ga0068854_100297221
550 Ga0068856_100005873
551 Ga0068856_100009567
552 Ga0068856_100057858
553 Ga0068856_100175914
554 Ga0068856_100213382
555 Ga0068856_100872852
556 Ga0068852_100009146
557 Ga0068852_100110043
558 Ga0068852_100188584
559 Ga0068852_100739277
560 Ga0068852_101007280
561 Ga0068852_102812242
562 Ga0068859_100009938
563 Ga0068864_100018058
564 Ga0068864_100480764
565 Ga0068866_11016485
566 Ga0068851_10015702
567 Ga0068851_10066437
568 Ga0068851_10273265
569 Ga0068863_100004286
570 Ga0068863_100804954
571 Ga0068863_101608224
572 Ga0068858_100015356
573 Ga0068858_100022357
574 Ga0068858_100066244
575 Ga0068860_100000671
576 Ga0068862_100245599
577 Ga0070717_11063704
578 Ga0070712_100497532
579 Ga0070712_100865459
580 Ga0097621_100006233
581 Ga0097621_100436562
582 Ga0068871_100004287
583 Ga0068865_100333452
584 Ga0097620_100009938
585 Ga0105240_10006322
586 Ga0105240_10015471
587 Ga0105240_10030669
588 Ga0105240_10108867
589 Ga0105240_10129491
590 Ga0105240_10140667
591 Ga0105240_10253033
592 Ga0105240_10558861
593 Ga0105240_10830074
594 Ga0105245_10002113
595 Ga0105245_10036065
596 Ga0105245_10291479
597 Ga0105247_10018457
598 Ga0105247_11511405
599 Ga0105243_10192039
600 Ga0105241_10000141
601 Ga0105241_10157268
602 Ga0105241_10337592
603 Ga0105241_10554641
604 Ga0105241_11294653
605 Ga0105242_10244416
606 Ga0105248_10007636
607 Ga0105248_11005960
608 Ga0105248_11198994
609 Ga0105237_10005310
610 Ga0105237_10020595
611 Ga0105237_10108313
612 Ga0105237_10217874
613 Ga0105237_10286087
614 Ga0105237_10812665
615 Ga0105237_10862982
616 Ga0105238_10001461
617 Ga0105238_10129997
618 Ga0105238_10148187
619 Ga0105238_10299410
620 Ga0105238_10980579
621 Ga0105238_11226923
622 Ga0105238_12121277
623 Ga0105249_10093055
624 Ga0105249_10237887
625 Ga0105239_10019431
626 Ga0105239_10487233
627 Ga0105239_10841021
628 Ga0105239_10994642
629 Ga0105239_11926982
630 Ga0105239_12018715
631 Ga0105239_12042707
632 Ga0105246_10000892
633 Ga0105246_10466124
634 Ga0157370_10119693
635 Ga0157370_10340144
636 Ga0157370_10488881
637 Ga0157370_10749610
638 Ga0157370_10999392
639 Ga0157369_10025883
640 Ga0157369_10036805
641 Ga0157369_10058131
642 Ga0157369_10075431
643 Ga0157369_10084384
644 Ga0157369_10132184
645 Ga0157369_10222906
646 Ga0157369_10420867
647 Ga0157369_10717482
648 Ga0157374_10005442
649 Ga0157374_10108611
650 Ga0157374_10225862
651 Ga0157374_10293719
652 Ga0157374_10613902
653 Ga0157374_10771505
654 Ga0157374_11325181
655 Ga0157374_12972842
656 Ga0157378_10305499
657 Ga0157378_10377302
658 Ga0157378_11310265
659 Ga0163162_10352883
660 Ga0163162_10908474
661 Ga0163162_11476680
662 Ga0157372_10012419
663 Ga0157372_10040208
664 Ga0157372_10052362
665 Ga0157372_10113243
666 Ga0157372_10192202
667 Ga0157372_10605646
668 Ga0157372_10719158
669 Ga0157372_12414158
670 Ga0157375_10002511
671 Ga0157375_10171100
672 Ga0157375_10577163
673 Ga0157375_10913996
674 Ga0157375_12420726
675 Ga0163163_10164837
676 Ga0163163_10203882
677 Ga0163163_10326786
678 Ga0182008_10095150
679 Ga0157377_10195551
680 Ga0157377_10324402
681 Ga0157379_10002017
682 Ga0157379_10027029
683 Ga0157379_10160153
684 Ga0157379_10978961
685 Ga0157376_10001213
686 Ga0157376_10180698
687 Ga0157376_10306023
688 Ga0157376_10412287
689 Ga0157376_10430190
690 Ga0163161_10156066
691 Ga0224572_1074870
692 Ga0228598_1053234
693 Ga0207697_10561707
694 Ga0207656_10103745
695 Ga0207656_10103834
696 Ga0207656_10150234
697 Ga0207710_10013222
698 Ga0207680_10637729
699 Ga0207647_10019899
700 Ga0207645_10026543
701 Ga0207654_10000023
702 Ga0207654_10000626
703 Ga0207707_10638738
704 Ga0207695_10003596
705 Ga0207695_10008464
706 Ga0207695_10192981
707 Ga0207695_10311017
708 Ga0207695_10439506
709 Ga0207695_10478011
710 Ga0207695_10721969
711 Ga0207695_10808368
712 Ga0207671_10000460
713 Ga0207671_10040154
714 Ga0207671_10521335
715 Ga0207671_10678759
716 Ga0207693_10418074
717 Ga0207663_10469925
718 Ga0207663_10784319
719 Ga0207663_11199562
720 Ga0207663_11462178
721 Ga0207649_10553400
722 Ga0207652_10374034
723 Ga0207652_11066175
724 Ga0207646_10952797
725 Ga0207681_10878062
726 Ga0207694_10000314
727 Ga0207694_10085658
728 Ga0207694_10108473
729 Ga0207694_10149489
730 Ga0207650_10008523
731 Ga0207650_10165889
732 Ga0207659_10313491
733 Ga0207687_10066897
734 Ga0207687_10201505
735 Ga0207700_10058471
736 Ga0207700_10307223
737 Ga0207700_10448007
738 Ga0207700_10526181
739 Ga0207664_11026575
740 Ga0207664_11067811
741 Ga0207644_10003840
742 Ga0207644_10036836
743 Ga0207644_11512708
744 Ga0207706_10007010
745 Ga0207669_10988453
746 Ga0207704_10703939
747 Ga0207665_10853052
748 Ga0207691_10007373
749 Ga0207711_10248221
750 Ga0207711_10790028
751 Ga0207689_10002137
752 Ga0207689_10005306
753 Ga0207661_10003693
754 Ga0207679_10267722
755 Ga0207667_10075688
756 Ga0207667_10399177
757 Ga0207667_10649464
758 Ga0207667_10707816
759 Ga0207667_11617686
760 Ga0207712_10428006
761 Ga0207640_10319969
762 Ga0207658_10089190
763 Ga0207658_10353664
764 Ga0207677_10000709
765 Ga0207677_10154449
766 Ga0207703_10015906
767 Ga0207703_10057750
768 Ga0207703_10262283
769 Ga0207639_10015125
770 Ga0207639_10218937
771 Ga0207639_10271887
772 Ga0207639_10424711
773 Ga0207639_10507027
774 Ga0207702_10003557
775 Ga0207702_10017546
776 Ga0207702_10026618
777 Ga0207702_10528754
778 Ga0207702_10702574
779 Ga0207702_10851914
780 Ga0207641_10002087
781 Ga0207641_12287588
782 Ga0207648_10258881
783 Ga0207676_10238981
784 Ga0207676_10740563
785 Ga0207674_10001660
786 Ga0207674_10003725
787 Ga0207683_10000613
788 Ga0207698_10013690
789 Ga0207698_10023173
790 Ga0207698_10043630
791 Ga0207698_11026347
792 Ga0207698_11362481
793 Ga0265357_1019399
794 Ga0268266_10157162
795 Ga0268266_10616154
796 Ga0268265_10261283
797 Ga0268264_10001376
798 Ga0265318_10034583
799 Ga0265336_10003881
800 Ga0265336_10055700
801 Ga0265338_10003453
802 Ga0265338_10003987
803 Ga0265338_10099505
804 Ga0265338_10409176
805 Ga0265338_10584073
806 Ga0265338_10589148
807 Ga0265338_10793567
808 Ga0265324_10275845
809 Ga0265770_1015344
810 Ga0265770_1159327
811 Ga0265760_10000892
812 Ga0265760_10013450
813 Ga0265760_10055941
814 Ga0265760_10089722
815 Ga0265760_10322306
816 Ga0265330_10000183
817 Ga0265330_10004427
818 Ga0265330_10008971
819 Ga0265330_10064648
820 Ga0265330_10082804
821 Ga0265330_10309474
822 Ga0265332_10006857
823 Ga0265328_10000803
824 Ga0265328_10027135
825 Ga0265328_10066020
826 Ga0265320_10022530
827 Ga0265325_10001037
828 Ga0265325_10042884
829 Ga0265325_10057186
830 Ga0265325_10357466
831 Ga0265325_10429425
832 Ga0265329_10008094
833 Ga0265340_10004955
834 Ga0265340_10022788
835 Ga0265340_10030564
836 Ga0265340_10034465
837 Ga0265340_10105036
838 Ga0265340_10434705
839 Ga0265339_10000177
840 Ga0265339_10000196
841 Ga0265339_10001134
842 Ga0265339_10010383
843 Ga0265339_10021798
844 Ga0265339_10094357
845 Ga0265339_10220605
846 Ga0265331_10131949
847 Ga0265331_10570095
848 Ga0265316_10002281
849 Ga0265316_10005169
850 Ga0265316_10013600
851 Ga0265316_10019547
852 Ga0265316_10057041
853 Ga0265316_10094635
854 Ga0265316_10198578
855 Ga0265316_10313718
856 Ga0265316_10389491
857 Ga0265316_10464693
858 Ga0265316_10499063
859 Ga0265316_10539823
860 Ga0265313_10002779
861 Ga0265313_10040126
862 Ga0265313_10160712
863 Ga0265314_10000162
864 Ga0265314_10003191
865 Ga0265314_10003600
866 Ga0265314_10072040
867 Ga0265314_10099489
868 Ga0265314_10302073
869 Ga0265342_10001134
870 Ga0265342_10001500
871 Ga0265342_10001732
872 Ga0265342_10002100
873 Ga0265342_10039036
874 Ga0265342_10064270
875 Ga0265342_10182974
876 Ga0265342_10209896
877 Ga0265342_10210255
878 Ga0265342_10385984
879 Ga0373934_0190853
880 Ga0373956_0437483
881 Ga0373931_0867592
882 Ga0373937_0621392
883 Ga0373937_1204732
884 Ga0373937_2006968
885 Ga0395900_1301401
886 Ga0436360_0365181
887 Ga0466966_0034443
888 Ga0466966_0636156
889 Ga0466961_0214946
890 Ga0466961_0321437
891 Ga0466961_0966518
892 Ga0466963_0078144
893 Ga0466963_0182962
894 Ga0466959_0223046
895 Ga0466959_0279436
896 Ga0466959_0933715
897 Ga0451576_1005824
898 Ga0466958_0109762
899 Ga0466967_0075994
900 Ga0466967_1016524
901 Ga0466967_1301277
902 Ga0495580_0276498
903 Ga0495662_0647749
904 Ga0495606_0523473
905 Ga0495628_0184337
906 Ga0495652_0162550
907 Ga0495665_0421077
908 Ga0495665_0594595
909 Ga0495586_0348083
910 Ga0495645_0092052
911 Ga0495634_0446343
912 Ga0495625_0115467
913 Ga0495599_0326333
914 Ga0495599_0637462
915 Ga0495623_0175745
916 Ga0495646_0506426
917 Ga0495613_0516943
918 Ga0495670_0834609
919 Ga0495600_0118257
920 Ga0495604_0948784
921 Ga0495676_0354721
922 Ga0495684_0297013
923 Ga0495684_0474104
924 Ga0495684_0634133
925 Ga0495593_0171477
926 Ga0495602_0190543
927 Ga0495602_0796783
928 Ga0496100_0044817
929 Ga0496101_0078276
930 Ga0496102_0694287
931 Ga0496104_0084981
932 Ga0496104_0114797
933 Ga0496104_1464415
934 Ga0496105_0027903
935 Ga0496106_0263927
936 Ga0496106_0680705
937 Ga0496107_0019059
938 Ga0496108_0771222
939 Ga0496112_0105459
940 Ga0496113_0064809
941 Ga0496114_0004896
942 Ga0496114_0730463
943 Ga0496114_1641763
944 Ga0496115_0010114
945 Ga0496115_0224996
946 Ga0496115_0628215
947 Ga0496115_0879980
948 Ga0495601_0141075
949 Ga0495619_0204305
950 Ga0495619_0252830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

31

110

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.9108 14 80
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.9077 14 105
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.8995 19 100
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.8929 16 89
4hbl-assembly1.cif.gz_B crystal structure of abfr of staphylococcus epidermidis 0.8859 21 97
ID Description Score Start End Superfamily
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9536 14 81 1.10.10.10
af_Q57874_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9466 12 97 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9251 16 80 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9199 14 80 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9169 21 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A662DHL0-F1-model_v4 Transcriptional regulator 0.9975 11 99
AF-A0A2U3K0F6-F1-model_v4 Transcriptional regulator, ArsR family 0.996 10 96
AF-A0A1G0P965-F1-model_v4 Transcriptional regulator 0.9948 10 101 GO:0003700
AF-A0A352F663-F1-model_v4 ArsR family transcriptional regulator 0.9943 10 99 GO:0005737
AF-A0A6L7P7E2-F1-model_v4 deleted 0.9943 11 98

Map