F451370

General Info

Members Datasets Scaffolds Average Seq Length
475 280 950 128

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10952902|Ga0268266_109529021
Length 149
Sequence MMRAAAGSKRWQLEQTRPGRLVDNAVEVDDEPDVEALFRQQFRRDLRAQRFVMDFAASAADALSRIADPIEQTLILILSDINMPGMSGLEMLPKVRTMRPEVPIIMITAYGDPETRRKAMEGGATGLLTKPIDFTLLREEIDARLDQVN

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
128 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
129 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
163 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
164 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
271 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
272 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
273 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
274 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
275 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
276 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
277 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
278 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
279 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
280 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 0
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 1.68
Rhizoplane 7.16
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10952902 3300028379 Bacteria 830
2 JGI24749J21850_1072042 3300002076 Bacteria 535
3 JGI25153J46596_10000760 3300003215 Bacteria 19717
4 Ga0070658_10605187 3300005327 Bacteria 950
5 Ga0070676_10381924 3300005328 Bacteria 976
6 Ga0070683_100150315 3300005329 Bacteria 2208
7 Ga0070683_102048987 3300005329 Bacteria 550
8 Ga0070690_100131486 3300005330 Bacteria 1691
9 Ga0070690_101480620 3300005330 Bacteria 548
10 Ga0068869_101174498 3300005334 Bacteria 674
11 Ga0070666_10551184 3300005335 Bacteria 839
12 Ga0070682_101818778 3300005337 Bacteria 532
13 Ga0068868_100082769 3300005338 Bacteria 2575
14 Ga0068868_100178658 3300005338 Bacteria 1760
15 Ga0068868_100793258 3300005338 Bacteria 854
16 Ga0068868_101682673 3300005338 Bacteria 597
17 Ga0070660_101047565 3300005339 Bacteria 690
18 Ga0070689_101285387 3300005340 Bacteria 659
19 Ga0070687_100402587 3300005343 Bacteria 898
20 Ga0070668_100019814 3300005347 Bacteria 5068
21 Ga0070668_100077854 3300005347 Bacteria 2592
22 Ga0070668_100942357 3300005347 Bacteria 773
23 Ga0070675_100151007 3300005354 Bacteria 1992
24 Ga0070671_101539486 3300005355 Bacteria 589
25 Ga0070674_101576367 3300005356 Bacteria 592
26 Ga0070673_100665306 3300005364 Bacteria 954
27 Ga0070667_100129943 3300005367 Bacteria 2197
28 Ga0070700_100119183 3300005441 Bacteria 1766
29 Ga0070700_100842028 3300005441 Bacteria 742
30 Ga0070663_100052547 3300005455 Bacteria 2906
31 Ga0070678_100015637 3300005456 Bacteria 4829
32 Ga0070678_100178007 3300005456 Bacteria 1738
33 Ga0070678_101175574 3300005456 Bacteria 710
34 Ga0070678_101435787 3300005456 Unclassified 645
35 Ga0070678_102144245 3300005456 Bacteria 530
36 Ga0070662_100094451 3300005457 Bacteria 2252
37 Ga0068867_100077081 3300005459 Bacteria 2504
38 Ga0068867_100471007 3300005459 Bacteria 1074
39 Ga0070685_10386270 3300005466 Bacteria 966
40 Ga0070685_10644525 3300005466 Bacteria 767
41 Ga0070706_101136052 3300005467 Bacteria 719
42 Ga0070684_100145881 3300005535 Bacteria 2142
43 Ga0070697_101070972 3300005536 Bacteria 717
44 Ga0068853_100258246 3300005539 Bacteria 1601
45 Ga0068853_100748985 3300005539 Bacteria 933
46 Ga0070672_100052461 3300005543 Bacteria 3184
47 Ga0070672_100827188 3300005543 Bacteria 816
48 Ga0070672_101562118 3300005543 Bacteria 592
49 Ga0070686_100362883 3300005544 Bacteria 1092
50 Ga0070665_100093305 3300005548 Bacteria 3015
51 Ga0070665_101537238 3300005548 Bacteria 674
52 Ga0070664_100268888 3300005564 Bacteria 1535
53 Ga0070664_100610904 3300005564 Bacteria 1012
54 Ga0068854_100893030 3300005578 Bacteria 781
55 Ga0068854_101163027 3300005578 Bacteria 690
56 Ga0068852_100169412 3300005616 Bacteria 2046
57 Ga0068852_100644333 3300005616 Bacteria 1066
58 Ga0068852_101788741 3300005616 Bacteria 637
59 Ga0068864_100068222 3300005618 Bacteria 3089
60 Ga0068864_100915185 3300005618 Bacteria 866
61 Ga0068864_102340041 3300005618 Bacteria 541
62 Ga0068861_100141575 3300005719 Bacteria 1963
63 Ga0068861_100243260 3300005719 Bacteria 1531
64 Ga0068851_10035808 3300005834 Bacteria 2483
65 Ga0068860_100461522 3300005843 Bacteria 1264
66 Ga0068862_100423143 3300005844 Bacteria 1250
67 Ga0075365_10847125 3300006038 Bacteria 645
68 Ga0075363_101026201 3300006048 Bacteria 509
69 Ga0070716_100893273 3300006173 Bacteria 695
70 Ga0070712_100729199 3300006175 Bacteria 847
71 Ga0075367_10485881 3300006178 Bacteria 783
72 Ga0075366_10120799 3300006195 Bacteria 1579
73 Ga0097621_100050242 3300006237 Bacteria 3390
74 Ga0097621_101060923 3300006237 Bacteria 759
75 Ga0097621_101242069 3300006237 Bacteria 703
76 Ga0097621_101304873 3300006237 Bacteria 686
77 Ga0075370_10105371 3300006353 Bacteria 1634
78 Ga0068871_100074900 3300006358 Bacteria 2794
79 Ga0075428_102203503 3300006844 Bacteria 568
80 Ga0068865_100029175 3300006881 Bacteria 3658
81 Ga0068865_100443756 3300006881 Bacteria 1071
82 Ga0068865_100993223 3300006881 Bacteria 735
83 Ga0068865_101114459 3300006881 Bacteria 696
84 Ga0099823_1013382 3300006944 Bacteria 8253
85 Ga0075435_100970879 3300007076 Bacteria 742
86 Ga0105250_10313023 3300009092 Bacteria 681
87 Ga0105240_10223670 3300009093 Bacteria 2191
88 Ga0105245_10254963 3300009098 Bacteria 1706
89 Ga0105245_10311479 3300009098 Bacteria 1548
90 Ga0105245_10556862 3300009098 Bacteria 1169
91 Ga0105245_12488013 3300009098 Bacteria 571
92 Ga0105247_10248422 3300009101 Bacteria 1215
93 Ga0105247_10274565 3300009101 Bacteria 1161
94 Ga0105247_11572732 3300009101 Bacteria 539
95 Ga0105243_10366980 3300009148 Bacteria 1327
96 Ga0105243_10533560 3300009148 Bacteria 1118
97 Ga0105241_10445187 3300009174 Bacteria 1145
98 Ga0105241_11754565 3300009174 Bacteria 604
99 Ga0105242_10047362 3300009176 Bacteria 3490
100 Ga0105242_10058738 3300009176 Bacteria 3155
101 Ga0105242_11215576 3300009176 Bacteria 773
102 Ga0105248_11497643 3300009177 Bacteria 764
103 Ga0105248_13201411 3300009177 Bacteria 521
104 Ga0105237_10192973 3300009545 Bacteria 2036
105 Ga0105237_10242902 3300009545 Bacteria 1802
106 Ga0105237_10687904 3300009545 Bacteria 1029
107 Ga0105237_10709567 3300009545 Bacteria 1012
108 Ga0105237_11231330 3300009545 Bacteria 755
109 Ga0105238_10036110 3300009551 Bacteria 5024
110 Ga0105238_10859559 3300009551 Bacteria 924
111 Ga0105249_10332247 3300009553 Bacteria 1534
112 Ga0105249_10355344 3300009553 Bacteria 1485
113 Ga0099796_10023331 3300010159 Bacteria 1931
114 Ga0105239_10021077 3300010375 Bacteria 7192
115 Ga0105239_10162123 3300010375 Bacteria 2499
116 Ga0105239_10209143 3300010375 Bacteria 2187
117 Ga0105239_11047762 3300010375 Bacteria 938
118 Ga0105239_11524670 3300010375 Bacteria 772
119 Ga0105239_12117912 3300010375 Bacteria 654
120 Ga0105246_10021489 3300011119 Bacteria 4153
121 Ga0105246_10101661 3300011119 Bacteria 2094
122 Ga0157313_1018770 3300012503 Bacteria 684
123 Ga0157371_10354549 3300013102 Bacteria 1068
124 Ga0157369_10430935 3300013105 Bacteria 1367
125 Ga0157374_10026445 3300013296 Bacteria 5222
126 Ga0157374_10531062 3300013296 Bacteria 1183
127 Ga0157374_12916583 3300013296 Bacteria 505
128 Ga0157378_10129543 3300013297 Bacteria 2334
129 Ga0157378_11213114 3300013297 Bacteria 794
130 Ga0157378_11281146 3300013297 Bacteria 774
131 Ga0163162_10014160 3300013306 Bacteria 7795
132 Ga0163162_11014964 3300013306 Bacteria 938
133 Ga0163162_11185764 3300013306 Bacteria 866
134 Ga0163162_11213377 3300013306 Bacteria 856
135 Ga0163162_11313536 3300013306 Bacteria 822
136 Ga0163162_11392231 3300013306 Bacteria 798
137 Ga0157372_10441029 3300013307 Bacteria 1518
138 Ga0157372_11671187 3300013307 Bacteria 733
139 Ga0157375_10169482 3300013308 Bacteria 2330
140 Ga0157375_10202769 3300013308 Bacteria 2140
141 Ga0157375_10755075 3300013308 Bacteria 1124
142 Ga0157375_10949412 3300013308 Bacteria 1002
143 Ga0157375_12330044 3300013308 Bacteria 638
144 Ga0157375_13748354 3300013308 Bacteria 505
145 Ga0163163_10009084 3300014325 Bacteria 8857
146 Ga0163163_10104577 3300014325 Bacteria 2857
147 Ga0163163_11439608 3300014325 Bacteria 751
148 Ga0157380_10065280 3300014326 Bacteria 2925
149 Ga0157380_10134947 3300014326 Bacteria 2111
150 Ga0157380_11063714 3300014326 Bacteria 846
151 Ga0157380_11932949 3300014326 Bacteria 651
152 Ga0157380_12399836 3300014326 Bacteria 593
153 Ga0157380_13082146 3300014326 Bacteria 531
154 Ga0157377_10139768 3300014745 Bacteria 1487
155 Ga0157377_10426553 3300014745 Bacteria 909
156 Ga0157379_10325136 3300014968 Bacteria 1404
157 Ga0157379_10852148 3300014968 Bacteria 862
158 Ga0157379_11144415 3300014968 Bacteria 747
159 Ga0157376_10001208 3300014969 Bacteria 17024
160 Ga0157376_10945537 3300014969 Bacteria 882
161 Ga0163161_10078730 3300017792 Bacteria 2423
162 Ga0163161_11106623 3300017792 Bacteria 681
163 Ga0213874_10016413 3300021377 Bacteria 1971
164 Ga0213876_10581920 3300021384 Bacteria 596
165 Ga0213875_10098020 3300021388 Bacteria 1368
166 Ga0209148_1000347 3300025254 Bacteria 60370
167 Ga0209455_1007537 3300025272 Bacteria 3062
168 Ga0209758_1000133 3300025297 Bacteria 182442
169 Ga0209758_1000845 3300025297 Bacteria 42737
170 Ga0207682_10517847 3300025893 Bacteria 564
171 Ga0207642_10051109 3300025899 Bacteria 1868
172 Ga0207688_10531591 3300025901 Bacteria 738
173 Ga0207647_10411508 3300025904 Bacteria 761
174 Ga0207647_10495432 3300025904 Bacteria 682
175 Ga0207645_10348823 3300025907 Bacteria 990
176 Ga0207654_10534766 3300025911 Bacteria 831
177 Ga0207663_10065198 3300025916 Bacteria 2327
178 Ga0207662_10146303 3300025918 Bacteria 1500
179 Ga0207681_11177012 3300025923 Bacteria 644
180 Ga0207694_10336532 3300025924 Bacteria 1248
181 Ga0207694_10609346 3300025924 Bacteria 918
182 Ga0207687_10157043 3300025927 Bacteria 1741
183 Ga0207664_10509221 3300025929 Bacteria 1078
184 Ga0207644_10299380 3300025931 Bacteria 1296
185 Ga0207644_10411338 3300025931 Bacteria 1107
186 Ga0207644_11252251 3300025931 Bacteria 624
187 Ga0207706_10087388 3300025933 Bacteria 2741
188 Ga0207686_10102134 3300025934 Bacteria 1917
189 Ga0207670_11162434 3300025936 Bacteria 653
190 Ga0207669_10017640 3300025937 Bacteria 3668
191 Ga0207704_10094574 3300025938 Bacteria 1974
192 Ga0207704_10447347 3300025938 Bacteria 1030
193 Ga0207665_10383156 3300025939 Bacteria 1067
194 Ga0207665_10497877 3300025939 Bacteria 941
195 Ga0207691_10397427 3300025940 Bacteria 1176
196 Ga0207691_10826730 3300025940 Bacteria 777
197 Ga0207711_10314555 3300025941 Bacteria 1446
198 Ga0207689_11142395 3300025942 Bacteria 656
199 Ga0207661_10001004 3300025944 Bacteria 18641
200 Ga0207661_10152747 3300025944 Bacteria 1997
201 Ga0207661_11178024 3300025944 Bacteria 705
202 Ga0207679_10494943 3300025945 Bacteria 1090
203 Ga0207651_10356215 3300025960 Bacteria 1234
204 Ga0207651_10754639 3300025960 Bacteria 860
205 Ga0207712_10691521 3300025961 Bacteria 889
206 Ga0207668_10014608 3300025972 Bacteria 4861
207 Ga0207668_10082925 3300025972 Bacteria 2331
208 Ga0207640_10850056 3300025981 Bacteria 794
209 Ga0207640_11314272 3300025981 Bacteria 646
210 Ga0207658_10204420 3300025986 Bacteria 1651
211 Ga0207677_10179006 3300026023 Bacteria 1666
212 Ga0207677_10483070 3300026023 Bacteria 1068
213 Ga0207639_10925004 3300026041 Bacteria 815
214 Ga0207678_10139627 3300026067 Bacteria 2068
215 Ga0207708_11313029 3300026075 Bacteria 634
216 Ga0207648_10312607 3300026089 Bacteria 1410
217 Ga0207676_10414940 3300026095 Bacteria 1261
218 Ga0207676_11475602 3300026095 Bacteria 677
219 Ga0207674_10613982 3300026116 Bacteria 1050
220 Ga0207675_100093709 3300026118 Bacteria 2825
221 Ga0207683_10040848 3300026121 Bacteria 4050
222 Ga0207683_10791999 3300026121 Bacteria 880
223 Ga0207683_10807786 3300026121 Bacteria 870
224 Ga0207683_10903487 3300026121 Bacteria 820
225 Ga0207683_11610551 3300026121 Bacteria 599
226 Ga0209389_1000001 3300027296 Bacteria 463799
227 Ga0209489_101114 3300027361 Bacteria 54578
228 Ga0209700_100007 3300027363 Bacteria 454608
229 Ga0268266_10153299 3300028379 Bacteria 2079
230 Ga0268266_10977792 3300028379 Bacteria 819
231 Ga0268266_11085578 3300028379 Bacteria 774
232 Ga0268266_11166984 3300028379 Bacteria 745
233 Ga0268266_11307659 3300028379 Bacteria 700
234 Ga0268266_11646922 3300028379 Bacteria 617
235 Ga0268265_10390437 3300028380 Bacteria 1283
236 Ga0268264_11070330 3300028381 Bacteria 814
237 Ga0265330_10002683 3300031235 Bacteria 9617
238 Ga0265340_10005768 3300031247 Bacteria 6847
239 Ga0265339_10217415 3300031249 Bacteria 936
240 Ga0265342_10227352 3300031712 Bacteria 1003
241 Ga0307415_100550757 3300032126 Bacteria 1018
242 Ga0373926_0025336 3300035083 Bacteria 2069
243 Ga0373934_0106603 3300035086 Bacteria 1135
244 Ga0373923_0383648 3300035111 Bacteria 674
245 Ga0373936_0016170 3300035113 Bacteria 2868
246 Ga0373936_0139343 3300035113 Bacteria 1047
247 Ga0373936_0214308 3300035113 Bacteria 853
248 Ga0373945_0018536 3300035116 Bacteria 2368
249 Ga0373945_0282266 3300035116 Bacteria 708
250 Ga0373953_0006871 3300035117 Bacteria 3777
251 Ga0373953_0073075 3300035117 Bacteria 1417
252 Ga0373954_0002773 3300035118 Bacteria 7379
253 Ga0373954_0017247 3300035118 Bacteria 3240
254 Ga0373956_0053407 3300035119 Bacteria 1819
255 Ga0373957_0010317 3300035120 Bacteria 3084
256 Ga0373943_0028257 3300035170 Bacteria 2642
257 Ga0373946_0019252 3300035171 Bacteria 2629
258 Ga0373955_0016090 3300035172 Bacteria 3676
259 Ga0373924_0003289 3300035410 Bacteria 5534
260 Ga0373935_0032399 3300035692 Bacteria 3248
261 Ga0373927_0007911 3300035695 Bacteria 7182
262 Ga0373927_0014536 3300035695 Bacteria 5208
263 Ga0373927_0318310 3300035695 Bacteria 1024
264 Ga0373933_0003493 3300035724 Bacteria 8750
265 Ga0373933_0137743 3300035724 Bacteria 1539
266 Ga0373947_0006013 3300035725 Bacteria 7077
267 Ga0373947_0017695 3300035725 Bacteria 4100
268 Ga0373947_1045170 3300035725 Bacteria 557
269 Ga0373947_1173766 3300035725 Bacteria 523
270 Ga0373937_0018454 3300036401 Bacteria 6230
271 Ga0373937_0143247 3300036401 Bacteria 2236
272 Ga0373925_0082446 3300037068 Bacteria 2447
273 Ga0395900_0140116 3300037418 Bacteria 2477
274 Ga0395905_0006970 3300037471 Bacteria 11299
275 Ga0436364_0311404 3300037853 Bacteria 3409
276 Ga0436364_1191523 3300037853 Bacteria 4358
277 Ga0395901_0300909 3300038443 Bacteria 1663
278 Ga0436365_0184478 3300039437 Bacteria 1897
279 Ga0436365_0215245 3300039437 Bacteria 784
280 Ga0436365_0460680 3300039437 Bacteria 570
281 Ga0436365_1883056 3300039437 Bacteria 739
282 Ga0436363_0557152 3300039450 Bacteria 3805
283 Ga0436363_1146060 3300039450 Bacteria 15099
284 Ga0436363_1169712 3300039450 Bacteria 1224
285 Ga0439466_0089303 3300041411 Bacteria 967
286 Ga0451804_0259862 3300041463 Bacteria 590
287 Ga0451851_0060115 3300041507 Bacteria 594
288 Ga0451853_2278326 3300041512 Bacteria 500
289 Ga0466972_0000134 3300044658 Bacteria 61802
290 Ga0466972_0388920 3300044658 Bacteria 653
291 Ga0466966_0259586 3300044684 Bacteria 1046
292 Ga0466966_0260730 3300044684 Bacteria 1044
293 Ga0466966_0401973 3300044684 Bacteria 823
294 Ga0466961_0562409 3300044693 Bacteria 686
295 Ga0466964_0107342 3300044706 Bacteria 1240
296 Ga0466964_0255084 3300044706 Bacteria 866
297 Ga0466971_0450161 3300044719 Bacteria 631
298 Ga0466968_0007204 3300044735 Bacteria 4226
299 Ga0466968_0118987 3300044735 Bacteria 1194
300 Ga0466968_0641267 3300044735 Bacteria 539
301 Ga0466960_0048070 3300044901 Bacteria 2049
302 Ga0466960_0088183 3300044901 Bacteria 1577
303 Ga0466960_0199581 3300044901 Bacteria 1092
304 Ga0466959_0215246 3300045049 Bacteria 1334
305 Ga0466958_0164499 3300045836 Bacteria 1403
306 Ga0466967_0264135 3300045976 Bacteria 1647
307 Ga0466967_0440630 3300045976 Bacteria 1272
308 Ga0466967_0656403 3300045976 Bacteria 1037
309 Ga0466967_1091223 3300045976 Bacteria 795
310 Ga0495617_116382 3300046452 Bacteria 863
311 Ga0495592_0044505 3300046454 Bacteria 3316
312 Ga0495592_0055783 3300046454 Bacteria 2921
313 Ga0495603_0054142 3300046455 Bacteria 2379
314 Ga0495629_0258719 3300046459 Bacteria 1197
315 Ga0495629_0324374 3300046459 Bacteria 1052
316 Ga0495629_0917633 3300046459 Bacteria 573
317 Ga0495641_0213784 3300046461 Bacteria 865
318 Ga0495651_0013997 3300046462 Bacteria 6203
319 Ga0495651_0246623 3300046462 Bacteria 1222
320 Ga0495651_0293293 3300046462 Bacteria 1094
321 Ga0495653_0010304 3300046463 Bacteria 7648
322 Ga0495650_0176852 3300046471 Bacteria 753
323 Ga0495580_0008118 3300046472 Bacteria 8372
324 Ga0495605_0494338 3300046474 Bacteria 500
325 Ga0495639_0022723 3300046475 Bacteria 2752
326 Ga0495662_0116654 3300046476 Bacteria 1309
327 Ga0495664_0030269 3300046477 Bacteria 3170
328 Ga0495664_0051756 3300046477 Bacteria 2438
329 Ga0495664_0448380 3300046477 Bacteria 773
330 Ga0495594_0284134 3300046499 Bacteria 943
331 Ga0495596_0224381 3300046500 Bacteria 730
332 Ga0495608_0009318 3300046511 Bacteria 6865
333 Ga0495608_0313430 3300046511 Bacteria 970
334 Ga0495608_0509412 3300046511 Bacteria 728
335 Ga0495610_0172798 3300046512 Bacteria 905
336 Ga0495618_0009726 3300046514 Bacteria 5808
337 Ga0495620_0248823 3300046515 Bacteria 678
338 Ga0495628_0035847 3300046516 Bacteria 3985
339 Ga0495628_0389466 3300046516 Bacteria 1020
340 Ga0495628_0610059 3300046516 Bacteria 779
341 Ga0495630_0245010 3300046517 Bacteria 1369
342 Ga0495630_0478891 3300046517 Bacteria 954
343 Ga0495631_0161647 3300046518 Bacteria 961
344 Ga0495632_0124431 3300046519 Bacteria 1203
345 Ga0495644_0435033 3300046523 Bacteria 521
346 Ga0495663_0154846 3300046525 Bacteria 784
347 Ga0495652_0013685 3300046529 Bacteria 7299
348 Ga0495652_0119998 3300046529 Bacteria 2099
349 Ga0495640_0026974 3300046533 Bacteria 4146
350 Ga0495640_0046784 3300046533 Bacteria 2996
351 Ga0495586_0604516 3300046535 Bacteria 634
352 Ga0495587_0006002 3300046536 Bacteria 7918
353 Ga0495598_0002644 3300046537 Bacteria 3710
354 Ga0495598_0108328 3300046537 Bacteria 928
355 Ga0495645_0182457 3300046543 Bacteria 1437
356 Ga0495645_0411483 3300046543 Bacteria 860
357 Ga0495633_0347546 3300046558 Bacteria 672
358 Ga0495667_0007339 3300046559 Bacteria 7474
359 Ga0495667_0514510 3300046559 Bacteria 749
360 Ga0495656_0455463 3300046615 Bacteria 674
361 Ga0495656_0506509 3300046615 Bacteria 641
362 Ga0495668_0080689 3300046616 Bacteria 1785
363 Ga0495668_0240254 3300046616 Bacteria 992
364 Ga0495668_0386441 3300046616 Bacteria 769
365 Ga0495634_0034597 3300046642 Bacteria 3466
366 Ga0495634_0767031 3300046642 Bacteria 551
367 Ga0495625_0288029 3300046660 Bacteria 1055
368 Ga0495625_0491048 3300046660 Bacteria 752
369 Ga0495635_0038960 3300046663 Bacteria 3290
370 Ga0495588_0474698 3300046674 Bacteria 656
371 Ga0495657_0008996 3300046675 Bacteria 7598
372 Ga0495657_0283869 3300046675 Bacteria 990
373 Ga0495599_0002511 3300046678 Bacteria 10674
374 Ga0495599_0831903 3300046678 Bacteria 526
375 Ga0495623_0006237 3300046679 Bacteria 7756
376 Ga0495646_0048078 3300046680 Bacteria 2594
377 Ga0495646_0165445 3300046680 Bacteria 1222
378 Ga0495646_0397286 3300046680 Bacteria 717
379 Ga0495646_0577644 3300046680 Bacteria 572
380 Ga0495647_0009973 3300046681 Bacteria 3228
381 Ga0495658_0016719 3300046683 Bacteria 3778
382 Ga0495669_0019490 3300046684 Bacteria 2928
383 Ga0495669_0043652 3300046684 Bacteria 1996
384 Ga0495669_0284542 3300046684 Bacteria 796
385 Ga0495613_0890363 3300046689 Bacteria 576
386 Ga0495624_0297279 3300046690 Bacteria 974
387 Ga0495671_0410527 3300046692 Bacteria 648
388 Ga0495649_0245064 3300046694 Bacteria 922
389 Ga0495589_0060924 3300046794 Bacteria 1853
390 Ga0495589_0302759 3300046794 Bacteria 741
391 Ga0495600_0005105 3300046809 Bacteria 7887
392 Ga0495600_0455001 3300046809 Bacteria 791
393 Ga0495600_0508372 3300046809 Bacteria 740
394 Ga0495581_0345368 3300047315 Bacteria 869
395 Ga0495604_0009503 3300047317 Bacteria 7684
396 Ga0495636_0384506 3300047318 Bacteria 667
397 Ga0495674_0013912 3300047319 Bacteria 7547
398 Ga0495674_0095195 3300047319 Bacteria 2539
399 Ga0495674_0709369 3300047319 Bacteria 789
400 Ga0495672_0247413 3300047320 Bacteria 867
401 Ga0495672_0334330 3300047320 Bacteria 708
402 Ga0495676_0123986 3300047321 Bacteria 1875
403 Ga0495676_0503130 3300047321 Bacteria 795
404 Ga0495680_0009654 3300047322 Bacteria 8661
405 Ga0495683_0366694 3300047323 Bacteria 605
406 Ga0495675_0005615 3300047444 Bacteria 7659
407 Ga0495677_0117723 3300047445 Bacteria 1012
408 Ga0495684_0008846 3300047471 Bacteria 7781
409 Ga0495684_0013936 3300047471 Bacteria 6185
410 Ga0495602_0049889 3300048088 Bacteria 3744
411 Ga0495602_0467224 3300048088 Bacteria 888
412 Ga0496100_0032306 3300048903 Bacteria 3263
413 Ga0496100_1688997 3300048903 Bacteria 501
414 Ga0496101_0588411 3300048904 Bacteria 880
415 Ga0496101_0602566 3300048904 Bacteria 868
416 Ga0496101_1303617 3300048904 Bacteria 568
417 Ga0496102_0475042 3300048905 Bacteria 1171
418 Ga0496102_0699890 3300048905 Bacteria 936
419 Ga0496103_0269245 3300048906 Bacteria 1096
420 Ga0496103_0744616 3300048906 Bacteria 620
421 Ga0496104_0031894 3300048907 Bacteria 4902
422 Ga0496104_0047135 3300048907 Bacteria 4061
423 Ga0496104_1154370 3300048907 Bacteria 678
424 Ga0496104_1357764 3300048907 Bacteria 614
425 Ga0496105_0024244 3300048908 Bacteria 4929
426 Ga0496106_0113701 3300048909 Bacteria 2110
427 Ga0496108_0058974 3300048911 Bacteria 3227
428 Ga0496108_0087381 3300048911 Bacteria 2648
429 Ga0496108_0996793 3300048911 Bacteria 716
430 Ga0496109_0019078 3300048912 Bacteria 6039
431 Ga0496109_0745286 3300048912 Bacteria 917
432 Ga0496110_0047680 3300048913 Bacteria 3753
433 Ga0496110_0503623 3300048913 Bacteria 1102
434 Ga0496111_0251924 3300048914 Bacteria 1310
435 Ga0496112_0006883 3300048915 Bacteria 10025
436 Ga0496112_0009722 3300048915 Bacteria 8681
437 Ga0496112_0092556 3300048915 Bacteria 2993
438 Ga0496112_0855320 3300048915 Bacteria 833
439 Ga0496113_0407653 3300048916 Bacteria 1091
440 Ga0496114_0128994 3300048917 Bacteria 2182
441 Ga0496114_0858847 3300048917 Bacteria 788
442 Ga0496115_0070183 3300048918 Bacteria 2840
443 Ga0496115_0071941 3300048918 Bacteria 2805
444 Ga0496115_0108399 3300048918 Bacteria 2280
445 Ga0496121_0449036 3300048924 Bacteria 831
446 Ga0495682_0317093 3300049460 Bacteria 550
447 nmdc:mga0yw44_205921_c1 3300050492 Bacteria 1300
448 nmdc:mga0yw44_681537_c1 3300050492 Bacteria 698
449 nmdc:mga0yw44_74363_c1 3300050492 Bacteria 2116
450 nmdc:mga06z11_27712_c1 3300050494 Bacteria 2710
451 nmdc:mga07m45_65108_c1 3300050496 Bacteria 2069
452 nmdc:mga0n895_528490_c1 3300050512 Bacteria 1187
453 nmdc:mga08x19_220430_c1 3300050514 Bacteria 1303
454 nmdc:mga0a205_214804_c1 3300050515 Bacteria 642
455 nmdc:mga0sz30_280842_c1 3300050516 Bacteria 742
456 Ga0495601_0136056 3300053077 Bacteria 1602
457 Ga0495601_0310709 3300053077 Bacteria 1027
458 Ga0495612_0503127 3300053078 Bacteria 556
459 Ga0495619_0006369 3300053085 Bacteria 7477
460 Ga0495619_0427504 3300053085 Bacteria 914
461 Ga0495619_0551901 3300053085 Bacteria 790
462 Ga0500628_271931 3300053129 Bacteria 501
463 Ga0500658_0408072 3300053134 Bacteria 621
464 Ga0466962_0053879 3300061719 Bacteria 1922
465 2844320115 2844315083 Bacteria 8138177
466 2847938991 2847930680 Bacteria 9342022
467 2885370052 2885366525 Bacteria 8326213
468 2903730211 2903727486 Bacteria 8281579
469 2906609940 2906602504 Bacteria 8295279
470 3005600401 3005594810 Bacteria 8716512
471 3005714175 3005710791 Bacteria 7622528
472 3005723250 3005718088 Bacteria 8283608
473 8006928266 8006926726 Bacteria 6749210
474 8019649454 8019648815 Bacteria 10014479
475 8056974979 8056967851 Bacteria 9038162
476 Ga0268266_10952902
477 JGI24749J21850_1072042
478 JGI25153J46596_10000760
479 Ga0070658_10605187
480 Ga0070676_10381924
481 Ga0070683_100150315
482 Ga0070683_102048987
483 Ga0070690_100131486
484 Ga0070690_101480620
485 Ga0068869_101174498
486 Ga0070666_10551184
487 Ga0070682_101818778
488 Ga0068868_100082769
489 Ga0068868_100178658
490 Ga0068868_100793258
491 Ga0068868_101682673
492 Ga0070660_101047565
493 Ga0070689_101285387
494 Ga0070687_100402587
495 Ga0070668_100019814
496 Ga0070668_100077854
497 Ga0070668_100942357
498 Ga0070675_100151007
499 Ga0070671_101539486
500 Ga0070674_101576367
501 Ga0070673_100665306
502 Ga0070667_100129943
503 Ga0070700_100119183
504 Ga0070700_100842028
505 Ga0070663_100052547
506 Ga0070678_100015637
507 Ga0070678_100178007
508 Ga0070678_101175574
509 Ga0070678_101435787
510 Ga0070678_102144245
511 Ga0070662_100094451
512 Ga0068867_100077081
513 Ga0068867_100471007
514 Ga0070685_10386270
515 Ga0070685_10644525
516 Ga0070706_101136052
517 Ga0070684_100145881
518 Ga0070697_101070972
519 Ga0068853_100258246
520 Ga0068853_100748985
521 Ga0070672_100052461
522 Ga0070672_100827188
523 Ga0070672_101562118
524 Ga0070686_100362883
525 Ga0070665_100093305
526 Ga0070665_101537238
527 Ga0070664_100268888
528 Ga0070664_100610904
529 Ga0068854_100893030
530 Ga0068854_101163027
531 Ga0068852_100169412
532 Ga0068852_100644333
533 Ga0068852_101788741
534 Ga0068864_100068222
535 Ga0068864_100915185
536 Ga0068864_102340041
537 Ga0068861_100141575
538 Ga0068861_100243260
539 Ga0068851_10035808
540 Ga0068860_100461522
541 Ga0068862_100423143
542 Ga0075365_10847125
543 Ga0075363_101026201
544 Ga0070716_100893273
545 Ga0070712_100729199
546 Ga0075367_10485881
547 Ga0075366_10120799
548 Ga0097621_100050242
549 Ga0097621_101060923
550 Ga0097621_101242069
551 Ga0097621_101304873
552 Ga0075370_10105371
553 Ga0068871_100074900
554 Ga0075428_102203503
555 Ga0068865_100029175
556 Ga0068865_100443756
557 Ga0068865_100993223
558 Ga0068865_101114459
559 Ga0099823_1013382
560 Ga0075435_100970879
561 Ga0105250_10313023
562 Ga0105240_10223670
563 Ga0105245_10254963
564 Ga0105245_10311479
565 Ga0105245_10556862
566 Ga0105245_12488013
567 Ga0105247_10248422
568 Ga0105247_10274565
569 Ga0105247_11572732
570 Ga0105243_10366980
571 Ga0105243_10533560
572 Ga0105241_10445187
573 Ga0105241_11754565
574 Ga0105242_10047362
575 Ga0105242_10058738
576 Ga0105242_11215576
577 Ga0105248_11497643
578 Ga0105248_13201411
579 Ga0105237_10192973
580 Ga0105237_10242902
581 Ga0105237_10687904
582 Ga0105237_10709567
583 Ga0105237_11231330
584 Ga0105238_10036110
585 Ga0105238_10859559
586 Ga0105249_10332247
587 Ga0105249_10355344
588 Ga0099796_10023331
589 Ga0105239_10021077
590 Ga0105239_10162123
591 Ga0105239_10209143
592 Ga0105239_11047762
593 Ga0105239_11524670
594 Ga0105239_12117912
595 Ga0105246_10021489
596 Ga0105246_10101661
597 Ga0157313_1018770
598 Ga0157371_10354549
599 Ga0157369_10430935
600 Ga0157374_10026445
601 Ga0157374_10531062
602 Ga0157374_12916583
603 Ga0157378_10129543
604 Ga0157378_11213114
605 Ga0157378_11281146
606 Ga0163162_10014160
607 Ga0163162_11014964
608 Ga0163162_11185764
609 Ga0163162_11213377
610 Ga0163162_11313536
611 Ga0163162_11392231
612 Ga0157372_10441029
613 Ga0157372_11671187
614 Ga0157375_10169482
615 Ga0157375_10202769
616 Ga0157375_10755075
617 Ga0157375_10949412
618 Ga0157375_12330044
619 Ga0157375_13748354
620 Ga0163163_10009084
621 Ga0163163_10104577
622 Ga0163163_11439608
623 Ga0157380_10065280
624 Ga0157380_10134947
625 Ga0157380_11063714
626 Ga0157380_11932949
627 Ga0157380_12399836
628 Ga0157380_13082146
629 Ga0157377_10139768
630 Ga0157377_10426553
631 Ga0157379_10325136
632 Ga0157379_10852148
633 Ga0157379_11144415
634 Ga0157376_10001208
635 Ga0157376_10945537
636 Ga0163161_10078730
637 Ga0163161_11106623
638 Ga0213874_10016413
639 Ga0213876_10581920
640 Ga0213875_10098020
641 Ga0209148_1000347
642 Ga0209455_1007537
643 Ga0209758_1000133
644 Ga0209758_1000845
645 Ga0207682_10517847
646 Ga0207642_10051109
647 Ga0207688_10531591
648 Ga0207647_10411508
649 Ga0207647_10495432
650 Ga0207645_10348823
651 Ga0207654_10534766
652 Ga0207663_10065198
653 Ga0207662_10146303
654 Ga0207681_11177012
655 Ga0207694_10336532
656 Ga0207694_10609346
657 Ga0207687_10157043
658 Ga0207664_10509221
659 Ga0207644_10299380
660 Ga0207644_10411338
661 Ga0207644_11252251
662 Ga0207706_10087388
663 Ga0207686_10102134
664 Ga0207670_11162434
665 Ga0207669_10017640
666 Ga0207704_10094574
667 Ga0207704_10447347
668 Ga0207665_10383156
669 Ga0207665_10497877
670 Ga0207691_10397427
671 Ga0207691_10826730
672 Ga0207711_10314555
673 Ga0207689_11142395
674 Ga0207661_10001004
675 Ga0207661_10152747
676 Ga0207661_11178024
677 Ga0207679_10494943
678 Ga0207651_10356215
679 Ga0207651_10754639
680 Ga0207712_10691521
681 Ga0207668_10014608
682 Ga0207668_10082925
683 Ga0207640_10850056
684 Ga0207640_11314272
685 Ga0207658_10204420
686 Ga0207677_10179006
687 Ga0207677_10483070
688 Ga0207639_10925004
689 Ga0207678_10139627
690 Ga0207708_11313029
691 Ga0207648_10312607
692 Ga0207676_10414940
693 Ga0207676_11475602
694 Ga0207674_10613982
695 Ga0207675_100093709
696 Ga0207683_10040848
697 Ga0207683_10791999
698 Ga0207683_10807786
699 Ga0207683_10903487
700 Ga0207683_11610551
701 Ga0209389_1000001
702 Ga0209489_101114
703 Ga0209700_100007
704 Ga0268266_10153299
705 Ga0268266_10977792
706 Ga0268266_11085578
707 Ga0268266_11166984
708 Ga0268266_11307659
709 Ga0268266_11646922
710 Ga0268265_10390437
711 Ga0268264_11070330
712 Ga0265330_10002683
713 Ga0265340_10005768
714 Ga0265339_10217415
715 Ga0265342_10227352
716 Ga0307415_100550757
717 Ga0373926_0025336
718 Ga0373934_0106603
719 Ga0373923_0383648
720 Ga0373936_0016170
721 Ga0373936_0139343
722 Ga0373936_0214308
723 Ga0373945_0018536
724 Ga0373945_0282266
725 Ga0373953_0006871
726 Ga0373953_0073075
727 Ga0373954_0002773
728 Ga0373954_0017247
729 Ga0373956_0053407
730 Ga0373957_0010317
731 Ga0373943_0028257
732 Ga0373946_0019252
733 Ga0373955_0016090
734 Ga0373924_0003289
735 Ga0373935_0032399
736 Ga0373927_0007911
737 Ga0373927_0014536
738 Ga0373927_0318310
739 Ga0373933_0003493
740 Ga0373933_0137743
741 Ga0373947_0006013
742 Ga0373947_0017695
743 Ga0373947_1045170
744 Ga0373947_1173766
745 Ga0373937_0018454
746 Ga0373937_0143247
747 Ga0373925_0082446
748 Ga0395900_0140116
749 Ga0395905_0006970
750 Ga0436364_0311404
751 Ga0436364_1191523
752 Ga0395901_0300909
753 Ga0436365_0184478
754 Ga0436365_0215245
755 Ga0436365_0460680
756 Ga0436365_1883056
757 Ga0436363_0557152
758 Ga0436363_1146060
759 Ga0436363_1169712
760 Ga0439466_0089303
761 Ga0451804_0259862
762 Ga0451851_0060115
763 Ga0451853_2278326
764 Ga0466972_0000134
765 Ga0466972_0388920
766 Ga0466966_0259586
767 Ga0466966_0260730
768 Ga0466966_0401973
769 Ga0466961_0562409
770 Ga0466964_0107342
771 Ga0466964_0255084
772 Ga0466971_0450161
773 Ga0466968_0007204
774 Ga0466968_0118987
775 Ga0466968_0641267
776 Ga0466960_0048070
777 Ga0466960_0088183
778 Ga0466960_0199581
779 Ga0466959_0215246
780 Ga0466958_0164499
781 Ga0466967_0264135
782 Ga0466967_0440630
783 Ga0466967_0656403
784 Ga0466967_1091223
785 Ga0495617_116382
786 Ga0495592_0044505
787 Ga0495592_0055783
788 Ga0495603_0054142
789 Ga0495629_0258719
790 Ga0495629_0324374
791 Ga0495629_0917633
792 Ga0495641_0213784
793 Ga0495651_0013997
794 Ga0495651_0246623
795 Ga0495651_0293293
796 Ga0495653_0010304
797 Ga0495650_0176852
798 Ga0495580_0008118
799 Ga0495605_0494338
800 Ga0495639_0022723
801 Ga0495662_0116654
802 Ga0495664_0030269
803 Ga0495664_0051756
804 Ga0495664_0448380
805 Ga0495594_0284134
806 Ga0495596_0224381
807 Ga0495608_0009318
808 Ga0495608_0313430
809 Ga0495608_0509412
810 Ga0495610_0172798
811 Ga0495618_0009726
812 Ga0495620_0248823
813 Ga0495628_0035847
814 Ga0495628_0389466
815 Ga0495628_0610059
816 Ga0495630_0245010
817 Ga0495630_0478891
818 Ga0495631_0161647
819 Ga0495632_0124431
820 Ga0495644_0435033
821 Ga0495663_0154846
822 Ga0495652_0013685
823 Ga0495652_0119998
824 Ga0495640_0026974
825 Ga0495640_0046784
826 Ga0495586_0604516
827 Ga0495587_0006002
828 Ga0495598_0002644
829 Ga0495598_0108328
830 Ga0495645_0182457
831 Ga0495645_0411483
832 Ga0495633_0347546
833 Ga0495667_0007339
834 Ga0495667_0514510
835 Ga0495656_0455463
836 Ga0495656_0506509
837 Ga0495668_0080689
838 Ga0495668_0240254
839 Ga0495668_0386441
840 Ga0495634_0034597
841 Ga0495634_0767031
842 Ga0495625_0288029
843 Ga0495625_0491048
844 Ga0495635_0038960
845 Ga0495588_0474698
846 Ga0495657_0008996
847 Ga0495657_0283869
848 Ga0495599_0002511
849 Ga0495599_0831903
850 Ga0495623_0006237
851 Ga0495646_0048078
852 Ga0495646_0165445
853 Ga0495646_0397286
854 Ga0495646_0577644
855 Ga0495647_0009973
856 Ga0495658_0016719
857 Ga0495669_0019490
858 Ga0495669_0043652
859 Ga0495669_0284542
860 Ga0495613_0890363
861 Ga0495624_0297279
862 Ga0495671_0410527
863 Ga0495649_0245064
864 Ga0495589_0060924
865 Ga0495589_0302759
866 Ga0495600_0005105
867 Ga0495600_0455001
868 Ga0495600_0508372
869 Ga0495581_0345368
870 Ga0495604_0009503
871 Ga0495636_0384506
872 Ga0495674_0013912
873 Ga0495674_0095195
874 Ga0495674_0709369
875 Ga0495672_0247413
876 Ga0495672_0334330
877 Ga0495676_0123986
878 Ga0495676_0503130
879 Ga0495680_0009654
880 Ga0495683_0366694
881 Ga0495675_0005615
882 Ga0495677_0117723
883 Ga0495684_0008846
884 Ga0495684_0013936
885 Ga0495602_0049889
886 Ga0495602_0467224
887 Ga0496100_0032306
888 Ga0496100_1688997
889 Ga0496101_0588411
890 Ga0496101_0602566
891 Ga0496101_1303617
892 Ga0496102_0475042
893 Ga0496102_0699890
894 Ga0496103_0269245
895 Ga0496103_0744616
896 Ga0496104_0031894
897 Ga0496104_0047135
898 Ga0496104_1154370
899 Ga0496104_1357764
900 Ga0496105_0024244
901 Ga0496106_0113701
902 Ga0496108_0058974
903 Ga0496108_0087381
904 Ga0496108_0996793
905 Ga0496109_0019078
906 Ga0496109_0745286
907 Ga0496110_0047680
908 Ga0496110_0503623
909 Ga0496111_0251924
910 Ga0496112_0006883
911 Ga0496112_0009722
912 Ga0496112_0092556
913 Ga0496112_0855320
914 Ga0496113_0407653
915 Ga0496114_0128994
916 Ga0496114_0858847
917 Ga0496115_0070183
918 Ga0496115_0071941
919 Ga0496115_0108399
920 Ga0496121_0449036
921 Ga0495682_0317093
922 nmdc:mga0yw44_205921_c1
923 nmdc:mga0yw44_681537_c1
924 nmdc:mga0yw44_74363_c1
925 nmdc:mga06z11_27712_c1
926 nmdc:mga07m45_65108_c1
927 nmdc:mga0n895_528490_c1
928 nmdc:mga08x19_220430_c1
929 nmdc:mga0a205_214804_c1
930 nmdc:mga0sz30_280842_c1
931 Ga0495601_0136056
932 Ga0495601_0310709
933 Ga0495612_0503127
934 Ga0495619_0006369
935 Ga0495619_0427504
936 Ga0495619_0551901
937 Ga0500628_271931
938 Ga0500658_0408072
939 Ga0466962_0053879
940 2844320115
941 2847938991
942 2885370052
943 2903730211
944 2906609940
945 3005600401
946 3005714175
947 3005723250
948 8006928266
949 8019649454
950 8056974979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

26

142

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kfc-assembly1.cif.gz_A crystal structure of a hyperactive mutant of response regulator kdpe complexed to its promoter dna 0.9195 1 127
4kny-assembly1.cif.gz_A crystal structure of the response regulator kdpe complexed to dna in an active-like conformation 0.9191 1 126
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.9166 4 129
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9164 4 127
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9163 4 127
ID Description Score Start End Superfamily
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9098 1 126 3.40.50.2300
3nnsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9093 4 126 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.909 2 126 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9088 2 125 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9081 1 127 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2A4T3L2-F1-model_v4 Response regulator 0.9498 3 129 GO:0000160
AF-A0A2D5YLV1-F1-model_v4 Response regulator 0.9492 4 121 GO:0000160
AF-A0A2A4N9W9-F1-model_v4 Response regulator 0.9478 3 127 GO:0000160
AF-T0RFB3-F1-model_v4 Response regulator receiver domain protein 0.9473 1 123 GO:0000160
AF-A0A508SUI7-F1-model_v4 Transcriptional regulatory protein ZraR 0.9463 1 129 GO:0000160

Map