F451020

General Info

Members Datasets Scaffolds Average Seq Length
473 171 946 109

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10224357|Ga0207690_102243571
Length 128
Sequence VALTEPLEPATVVPVMKRYLALPLAWLLAGCLTHPAPXXXXYHAVGTEPFWNLLIDEHNLTFTQPDAQPVTQPTPPVIVGIAGEIYQTPRINVNIVHGSCSDGMSDRTYPDKVQVTVDGRQFNGCGGL

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
169 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.92
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10224357 3300025932 Bacteria 1439
2 JGI24741J21665_1042310 3300001915 Bacteria 672
3 JGI24740J21852_10011894 3300001979 Bacteria 3299
4 JGI24737J22298_10017333 3300001990 Bacteria 2321
5 JGI24737J22298_10018325 3300001990 Bacteria 2247
6 JGI24743J22301_10000984 3300001991 Bacteria 3714
7 JGI24743J22301_10079820 3300001991 Bacteria 690
8 JGI24735J21928_10004803 3300002067 Bacteria 4512
9 JGI24738J21930_10002501 3300002075 Bacteria 4786
10 Ga0070658_10000346 3300005327 Bacteria 40223
11 Ga0070658_10007820 3300005327 Bacteria 8613
12 Ga0070658_10013428 3300005327 Bacteria 6571
13 Ga0070658_10021282 3300005327 Bacteria 5197
14 Ga0070658_10166223 3300005327 Bacteria 1852
15 Ga0070658_10238037 3300005327 Bacteria 1542
16 Ga0070658_11626908 3300005327 Bacteria 559
17 Ga0070658_11975641 3300005327 Bacteria 503
18 Ga0070676_10047943 3300005328 Bacteria 2497
19 Ga0070683_100474418 3300005329 Bacteria 1195
20 Ga0070690_101284653 3300005330 Bacteria 586
21 Ga0070670_100038374 3300005331 Bacteria 4119
22 Ga0070670_100068310 3300005331 Bacteria 3050
23 Ga0070670_100457960 3300005331 Bacteria 1131
24 Ga0068869_100581614 3300005334 Bacteria 944
25 Ga0070666_10016909 3300005335 Bacteria 4670
26 Ga0070666_10399643 3300005335 Bacteria 988
27 Ga0070666_10517623 3300005335 Bacteria 866
28 Ga0070666_10555720 3300005335 Bacteria 835
29 Ga0070666_11197297 3300005335 Unclassified 566
30 Ga0070680_100065969 3300005336 Bacteria 2967
31 Ga0070680_100087504 3300005336 Bacteria 2576
32 Ga0070680_100390558 3300005336 Bacteria 1185
33 Ga0070682_100704912 3300005337 Bacteria 810
34 Ga0070682_100984268 3300005337 Bacteria 699
35 Ga0068868_100237036 3300005338 Bacteria 1532
36 Ga0068868_100259899 3300005338 Bacteria 1464
37 Ga0070660_100000061 3300005339 Bacteria 63766
38 Ga0070660_100008683 3300005339 Bacteria 7117
39 Ga0070660_100032678 3300005339 Bacteria 3918
40 Ga0070660_100033786 3300005339 Bacteria 3858
41 Ga0070660_100036228 3300005339 Bacteria 3736
42 Ga0070660_100068924 3300005339 Bacteria 2758
43 Ga0070660_100091800 3300005339 Bacteria 2396
44 Ga0070660_100391241 3300005339 Bacteria 1148
45 Ga0070660_100457613 3300005339 Unclassified 1059
46 Ga0070689_100418232 3300005340 Bacteria 1136
47 Ga0070661_100018635 3300005344 Bacteria 4937
48 Ga0070661_100025778 3300005344 Bacteria 4226
49 Ga0070661_100076519 3300005344 Bacteria 2466
50 Ga0070661_100292512 3300005344 Bacteria 1266
51 Ga0070661_100651752 3300005344 Bacteria 855
52 Ga0070692_10039180 3300005345 Bacteria 2419
53 Ga0070692_10124266 3300005345 Bacteria 1443
54 Ga0070692_10142322 3300005345 Bacteria 1358
55 Ga0070692_10181977 3300005345 Bacteria 1219
56 Ga0070692_10350340 3300005345 Bacteria 917
57 Ga0070669_100252857 3300005353 Bacteria 1403
58 Ga0070669_101542889 3300005353 Bacteria 578
59 Ga0070671_100008387 3300005355 Bacteria 8281
60 Ga0070671_100025374 3300005355 Bacteria 4863
61 Ga0070671_100074191 3300005355 Bacteria 2842
62 Ga0070671_100153041 3300005355 Bacteria 1948
63 Ga0070671_101254725 3300005355 Bacteria 653
64 Ga0070673_100176570 3300005364 Bacteria 1826
65 Ga0070673_100366058 3300005364 Bacteria 1282
66 Ga0070659_100011162 3300005366 Bacteria 6636
67 Ga0070659_100023202 3300005366 Bacteria 4745
68 Ga0070659_100100747 3300005366 Bacteria 2324
69 Ga0070659_100207358 3300005366 Bacteria 1614
70 Ga0070659_100273230 3300005366 Bacteria 1405
71 Ga0070659_100495007 3300005366 Bacteria 1041
72 Ga0070659_100940573 3300005366 Bacteria 757
73 Ga0070667_100008431 3300005367 Bacteria 8548
74 Ga0070667_100422704 3300005367 Bacteria 1215
75 Ga0070667_100426630 3300005367 Bacteria 1209
76 Ga0070694_100011758 3300005444 Bacteria 5426
77 Ga0070663_100005821 3300005455 Bacteria 7365
78 Ga0070663_100021105 3300005455 Bacteria 4325
79 Ga0070663_100062082 3300005455 Bacteria 2692
80 Ga0070663_100580881 3300005455 Bacteria 940
81 Ga0070663_100609870 3300005455 Bacteria 919
82 Ga0070663_100648581 3300005455 Bacteria 893
83 Ga0070663_101159548 3300005455 Bacteria 678
84 Ga0070663_101192393 3300005455 Bacteria 669
85 Ga0070678_100515666 3300005456 Bacteria 1057
86 Ga0070662_100010463 3300005457 Bacteria 6089
87 Ga0070662_100174983 3300005457 Bacteria 1688
88 Ga0070662_100467774 3300005457 Bacteria 1048
89 Ga0070681_10860329 3300005458 Bacteria 824
90 Ga0068867_100467440 3300005459 Bacteria 1078
91 Ga0068867_100795759 3300005459 Bacteria 843
92 Ga0070679_100019821 3300005530 Bacteria 6548
93 Ga0070679_100221968 3300005530 Bacteria 1851
94 Ga0070679_100223350 3300005530 Bacteria 1844
95 Ga0070679_100224145 3300005530 Bacteria 1840
96 Ga0070679_100639304 3300005530 Bacteria 1007
97 Ga0070679_100936461 3300005530 Bacteria 810
98 Ga0070684_100302376 3300005535 Bacteria 1468
99 Ga0068853_100037285 3300005539 Bacteria 4136
100 Ga0068853_100080226 3300005539 Bacteria 2854
101 Ga0068853_100106291 3300005539 Bacteria 2487
102 Ga0068853_100551820 3300005539 Bacteria 1091
103 Ga0068853_100556924 3300005539 Bacteria 1086
104 Ga0068853_100727140 3300005539 Bacteria 948
105 Ga0070696_100179973 3300005546 Bacteria 1568
106 Ga0070696_100420718 3300005546 Bacteria 1049
107 Ga0070693_100014059 3300005547 Bacteria 4091
108 Ga0070665_100075129 3300005548 Bacteria 3386
109 Ga0070665_100604005 3300005548 Bacteria 1110
110 Ga0070704_100332482 3300005549 Unclassified 1277
111 Ga0068855_100000318 3300005563 Bacteria 60020
112 Ga0068855_100181409 3300005563 Bacteria 2380
113 Ga0068855_100360402 3300005563 Bacteria 1600
114 Ga0068855_100375039 3300005563 Bacteria 1563
115 Ga0068855_101464843 3300005563 Bacteria 702
116 Ga0070664_100002393 3300005564 Bacteria 15065
117 Ga0070664_100004455 3300005564 Bacteria 11251
118 Ga0070664_100009971 3300005564 Bacteria 7700
119 Ga0070664_100039998 3300005564 Bacteria 3953
120 Ga0070664_100205316 3300005564 Bacteria 1759
121 Ga0070664_101908141 3300005564 Bacteria 563
122 Ga0068857_100004407 3300005577 Bacteria 11899
123 Ga0068857_100013714 3300005577 Bacteria 7063
124 Ga0068857_100079697 3300005577 Bacteria 2923
125 Ga0068857_100658882 3300005577 Bacteria 992
126 Ga0068854_100011091 3300005578 Bacteria 5851
127 Ga0068854_100625175 3300005578 Bacteria 922
128 Ga0068854_101118393 3300005578 Bacteria 702
129 Ga0068856_100141699 3300005614 Bacteria 2411
130 Ga0068856_100513431 3300005614 Bacteria 1219
131 Ga0068856_101052567 3300005614 Bacteria 831
132 Ga0068856_102093087 3300005614 Bacteria 576
133 Ga0068852_100002740 3300005616 Bacteria 12192
134 Ga0068852_100007337 3300005616 Bacteria 8044
135 Ga0068852_100038179 3300005616 Bacteria 4034
136 Ga0068852_100040483 3300005616 Bacteria 3932
137 Ga0068852_100266120 3300005616 Bacteria 1648
138 Ga0068859_100021782 3300005617 Bacteria 6428
139 Ga0068859_100513682 3300005617 Bacteria 1293
140 Ga0068864_100012335 3300005618 Bacteria 7062
141 Ga0068864_100087729 3300005618 Bacteria 2739
142 Ga0068864_100540591 3300005618 Bacteria 1125
143 Ga0068851_10020575 3300005834 Bacteria 3196
144 Ga0068851_10092541 3300005834 Bacteria 1593
145 Ga0068851_10196566 3300005834 Bacteria 1124
146 Ga0068851_10285742 3300005834 Bacteria 945
147 Ga0068851_10745260 3300005834 Bacteria 606
148 Ga0068863_100040629 3300005841 Bacteria 4423
149 Ga0068863_100240214 3300005841 Bacteria 1748
150 Ga0068863_100887525 3300005841 Bacteria 891
151 Ga0068858_100062946 3300005842 Bacteria 3431
152 Ga0068858_100203453 3300005842 Bacteria 1873
153 Ga0068860_100101864 3300005843 Bacteria 2739
154 Ga0068860_102482925 3300005843 Bacteria 538
155 Ga0068862_100207879 3300005844 Bacteria 1767
156 Ga0068862_100403090 3300005844 Unclassified 1280
157 Ga0068862_100417245 3300005844 Bacteria 1259
158 Ga0070715_10779194 3300006163 Bacteria 578
159 Ga0097621_100010319 3300006237 Bacteria 6827
160 Ga0097621_100692342 3300006237 Bacteria 938
161 Ga0068871_100220284 3300006358 Bacteria 1644
162 Ga0068871_100453671 3300006358 Bacteria 1150
163 Ga0097620_100021781 3300006931 Bacteria 6428
164 Ga0097620_100513742 3300006931 Bacteria 1293
165 Ga0105243_10274628 3300009148 Bacteria 1515
166 Ga0105248_10004287 3300009177 Bacteria 15777
167 Ga0105248_10030156 3300009177 Bacteria 6054
168 Ga0105237_10070205 3300009545 Bacteria 3498
169 Ga0105238_11332458 3300009551 Bacteria 744
170 Ga0105249_10065081 3300009553 Bacteria 3353
171 Ga0105239_10048972 3300010375 Bacteria 4633
172 Ga0105239_10267211 3300010375 Bacteria 1923
173 Ga0105246_10537477 3300011119 Unclassified 999
174 Ga0105246_10729597 3300011119 Bacteria 872
175 Ga0157373_10072709 3300013100 Bacteria 2427
176 Ga0157373_10196165 3300013100 Bacteria 1423
177 Ga0157373_10225450 3300013100 Bacteria 1323
178 Ga0157373_10593981 3300013100 Bacteria 806
179 Ga0157373_11330280 3300013100 Bacteria 545
180 Ga0157371_10000616 3300013102 Bacteria 42353
181 Ga0157371_10012023 3300013102 Bacteria 6637
182 Ga0157371_10119566 3300013102 Bacteria 1873
183 Ga0157371_10194511 3300013102 Bacteria 1453
184 Ga0157371_10292162 3300013102 Bacteria 1179
185 Ga0157371_10363929 3300013102 Bacteria 1054
186 Ga0157371_10377066 3300013102 Bacteria 1035
187 Ga0157371_10426527 3300013102 Bacteria 973
188 Ga0157371_10983961 3300013102 Bacteria 643
189 Ga0157371_11188439 3300013102 Bacteria 587
190 Ga0157371_11326221 3300013102 Unclassified 557
191 Ga0157370_10545499 3300013104 Bacteria 1063
192 Ga0157370_10994266 3300013104 Bacteria 760
193 Ga0157369_10521051 3300013105 Bacteria 1230
194 Ga0157369_10542644 3300013105 Bacteria 1202
195 Ga0157369_11364891 3300013105 Bacteria 722
196 Ga0157374_10041076 3300013296 Bacteria 4260
197 Ga0157374_10180407 3300013296 Bacteria 2062
198 Ga0163162_10701715 3300013306 Bacteria 1133
199 Ga0157372_10040013 3300013307 Bacteria 5176
200 Ga0157372_10303217 3300013307 Bacteria 1858
201 Ga0157372_11112600 3300013307 Bacteria 914
202 Ga0157372_12030811 3300013307 Bacteria 661
203 Ga0157372_12347799 3300013307 Bacteria 612
204 Ga0157380_10025918 3300014326 Bacteria 4449
205 Ga0182008_10127999 3300014497 Bacteria 1265
206 Ga0157379_10004123 3300014968 Bacteria 12399
207 Ga0157379_11505529 3300014968 Unclassified 655
208 Ga0207656_10026964 3300025321 Bacteria 2346
209 Ga0207682_10057041 3300025893 Bacteria 1627
210 Ga0207680_10004667 3300025903 Bacteria 6507
211 Ga0207680_10058455 3300025903 Bacteria 2337
212 Ga0207680_11206661 3300025903 Unclassified 539
213 Ga0207647_10005953 3300025904 Bacteria 8888
214 Ga0207647_10022324 3300025904 Bacteria 4205
215 Ga0207647_10054959 3300025904 Bacteria 2448
216 Ga0207647_10058986 3300025904 Bacteria 2349
217 Ga0207647_10179266 3300025904 Bacteria 1231
218 Ga0207647_10464102 3300025904 Unclassified 709
219 Ga0207645_10020256 3300025907 Bacteria 4355
220 Ga0207645_10283588 3300025907 Bacteria 1100
221 Ga0207705_10000131 3300025909 Bacteria 81639
222 Ga0207705_10001710 3300025909 Bacteria 17412
223 Ga0207705_10003540 3300025909 Bacteria 11892
224 Ga0207705_10005342 3300025909 Bacteria 9605
225 Ga0207705_10009913 3300025909 Bacteria 6936
226 Ga0207705_10011512 3300025909 Bacteria 6399
227 Ga0207705_10035138 3300025909 Bacteria 3585
228 Ga0207705_10044160 3300025909 Bacteria 3202
229 Ga0207705_10295639 3300025909 Bacteria 1241
230 Ga0207705_11499941 3300025909 Bacteria 510
231 Ga0207705_11504778 3300025909 Unclassified 509
232 Ga0207707_10542452 3300025912 Bacteria 989
233 Ga0207671_10014940 3300025914 Bacteria 6104
234 Ga0207660_10341822 3300025917 Bacteria 1198
235 Ga0207657_10000181 3300025919 Bacteria 65099
236 Ga0207657_10005217 3300025919 Bacteria 13609
237 Ga0207657_10006575 3300025919 Bacteria 12036
238 Ga0207657_10078327 3300025919 Bacteria 2783
239 Ga0207657_10080664 3300025919 Bacteria 2734
240 Ga0207657_10135503 3300025919 Bacteria 2015
241 Ga0207657_10142040 3300025919 Bacteria 1961
242 Ga0207657_10332947 3300025919 Bacteria 1199
243 Ga0207649_10005272 3300025920 Bacteria 6992
244 Ga0207649_10014893 3300025920 Bacteria 4362
245 Ga0207649_10091229 3300025920 Bacteria 1995
246 Ga0207649_10313918 3300025920 Bacteria 1150
247 Ga0207649_10398986 3300025920 Bacteria 1029
248 Ga0207652_10013437 3300025921 Bacteria 6625
249 Ga0207652_10290556 3300025921 Bacteria 1475
250 Ga0207652_10324751 3300025921 Bacteria 1389
251 Ga0207681_11431499 3300025923 Bacteria 580
252 Ga0207681_11732143 3300025923 Bacteria 522
253 Ga0207650_10052043 3300025925 Bacteria 3032
254 Ga0207650_10225828 3300025925 Bacteria 1509
255 Ga0207650_10394843 3300025925 Bacteria 1144
256 Ga0207644_10000389 3300025931 Bacteria 28599
257 Ga0207644_10193444 3300025931 Bacteria 1600
258 Ga0207644_10691366 3300025931 Bacteria 850
259 Ga0207690_10011065 3300025932 Bacteria 5382
260 Ga0207690_10029379 3300025932 Bacteria 3494
261 Ga0207690_10069685 3300025932 Bacteria 2420
262 Ga0207690_10170229 3300025932 Bacteria 1631
263 Ga0207690_10480854 3300025932 Bacteria 1002
264 Ga0207690_10865790 3300025932 Bacteria 748
265 Ga0207706_10012647 3300025933 Bacteria 7682
266 Ga0207706_10013628 3300025933 Bacteria 7383
267 Ga0207706_10164336 3300025933 Bacteria 1951
268 Ga0207706_10473945 3300025933 Bacteria 1082
269 Ga0207706_10854213 3300025933 Bacteria 771
270 Ga0207709_10031770 3300025935 Bacteria 3087
271 Ga0207704_10835548 3300025938 Bacteria 771
272 Ga0207711_10011037 3300025941 Bacteria 7507
273 Ga0207711_10015819 3300025941 Bacteria 6258
274 Ga0207661_10024961 3300025944 Bacteria 4539
275 Ga0207661_11112447 3300025944 Bacteria 727
276 Ga0207679_10006229 3300025945 Bacteria 7529
277 Ga0207679_10140265 3300025945 Bacteria 1953
278 Ga0207667_10000282 3300025949 Bacteria 69790
279 Ga0207667_10071172 3300025949 Bacteria 3617
280 Ga0207667_10779326 3300025949 Bacteria 954
281 Ga0207667_10793049 3300025949 Bacteria 944
282 Ga0207667_10949014 3300025949 Bacteria 850
283 Ga0207667_11555645 3300025949 Bacteria 631
284 Ga0207651_10005720 3300025960 Bacteria 6418
285 Ga0207651_10147046 3300025960 Bacteria 1829
286 Ga0207651_10180219 3300025960 Bacteria 1675
287 Ga0207712_10055017 3300025961 Bacteria 2797
288 Ga0207668_10459050 3300025972 Bacteria 1089
289 Ga0207668_11780352 3300025972 Bacteria 556
290 Ga0207640_10012258 3300025981 Bacteria 4878
291 Ga0207640_10107644 3300025981 Bacteria 1969
292 Ga0207640_10212332 3300025981 Bacteria 1475
293 Ga0207640_11362219 3300025981 Bacteria 635
294 Ga0207658_10012127 3300025986 Bacteria 5878
295 Ga0207658_10796996 3300025986 Bacteria 857
296 Ga0207677_10060697 3300026023 Bacteria 2615
297 Ga0207677_10630919 3300026023 Bacteria 944
298 Ga0207703_10052689 3300026035 Bacteria 3305
299 Ga0207703_10534346 3300026035 Bacteria 1104
300 Ga0207703_10683857 3300026035 Bacteria 975
301 Ga0207639_10018449 3300026041 Bacteria 4958
302 Ga0207639_10110067 3300026041 Bacteria 2243
303 Ga0207639_10186030 3300026041 Bacteria 1771
304 Ga0207678_10000587 3300026067 Bacteria 33282
305 Ga0207678_10001423 3300026067 Bacteria 21936
306 Ga0207678_10003028 3300026067 Bacteria 15206
307 Ga0207678_10086472 3300026067 Bacteria 2679
308 Ga0207678_10097030 3300026067 Bacteria 2519
309 Ga0207678_10317622 3300026067 Bacteria 1340
310 Ga0207678_10341090 3300026067 Bacteria 1291
311 Ga0207678_10357818 3300026067 Bacteria 1259
312 Ga0207678_10703930 3300026067 Bacteria 889
313 Ga0207702_10010616 3300026078 Bacteria 7697
314 Ga0207641_10007862 3300026088 Bacteria 8849
315 Ga0207641_10375942 3300026088 Bacteria 1359
316 Ga0207648_10331021 3300026089 Bacteria 1370
317 Ga0207648_10413470 3300026089 Bacteria 1224
318 Ga0207676_10020037 3300026095 Bacteria 4888
319 Ga0207676_10395393 3300026095 Bacteria 1290
320 Ga0207674_10001996 3300026116 Bacteria 25880
321 Ga0207674_10008156 3300026116 Bacteria 12145
322 Ga0207674_10039579 3300026116 Bacteria 4886
323 Ga0207674_10633402 3300026116 Bacteria 1032
324 Ga0207675_100195318 3300026118 Bacteria 1942
325 Ga0207683_10446692 3300026121 Bacteria 1192
326 Ga0207698_10000609 3300026142 Bacteria 20927
327 Ga0207698_10017760 3300026142 Bacteria 4835
328 Ga0207698_10061318 3300026142 Bacteria 2930
329 Ga0207698_10230795 3300026142 Bacteria 1680
330 Ga0207698_10473733 3300026142 Bacteria 1213
331 Ga0207698_12119822 3300026142 Unclassified 576
332 Ga0268266_10329090 3300028379 Bacteria 1432
333 Ga0268266_10929204 3300028379 Bacteria 841
334 Ga0268265_10231691 3300028380 Bacteria 1624
335 Ga0268265_10392446 3300028380 Unclassified 1280
336 Ga0268264_10004042 3300028381 Bacteria 12558
337 Ga0268264_10612045 3300028381 Bacteria 1074
338 Ga0307408_100239099 3300031548 Bacteria 1491
339 Ga0307405_10057774 3300031731 Bacteria 2438
340 Ga0307405_10351844 3300031731 Bacteria 1136
341 Ga0307413_10014967 3300031824 Bacteria 3960
342 Ga0307413_10630272 3300031824 Bacteria 881
343 Ga0307410_10006758 3300031852 Bacteria 6220
344 Ga0307410_10139530 3300031852 Bacteria 1791
345 Ga0307410_10322391 3300031852 Bacteria 1226
346 Ga0307406_10025848 3300031901 Bacteria 3518
347 Ga0307406_10482204 3300031901 Bacteria 1002
348 Ga0307406_11039472 3300031901 Bacteria 704
349 Ga0307407_10056011 3300031903 Bacteria 2280
350 Ga0307412_10672055 3300031911 Bacteria 886
351 Ga0307409_100025353 3300031995 Bacteria 4157
352 Ga0307409_100051105 3300031995 Bacteria 3161
353 Ga0307409_100679724 3300031995 Bacteria 1026
354 Ga0307409_102242216 3300031995 Bacteria 575
355 Ga0307416_100187427 3300032002 Bacteria 1946
356 Ga0307416_100602431 3300032002 Bacteria 1178
357 Ga0307414_11073569 3300032004 Unclassified 743
358 Ga0307411_10006771 3300032005 Bacteria 5767
359 Ga0307411_10035814 3300032005 Bacteria 3104
360 Ga0307411_10207320 3300032005 Bacteria 1510
361 Ga0307415_100129303 3300032126 Bacteria 1908
362 Ga0307415_100197347 3300032126 Bacteria 1593
363 Ga0373949_0280644 3300035090 Bacteria 523
364 Ga0373931_0965817 3300035691 Bacteria 575
365 Ga0395899_0000971 3300037312 Bacteria 26509
366 Ga0395899_0002539 3300037312 Bacteria 14790
367 Ga0395899_0069878 3300037312 Bacteria 2570
368 Ga0395899_0282034 3300037312 Bacteria 1130
369 Ga0395899_0944486 3300037312 Bacteria 523
370 Ga0395900_0000036 3300037418 Bacteria 250619
371 Ga0395900_0004149 3300037418 Bacteria 15419
372 Ga0395900_0029812 3300037418 Bacteria 5600
373 Ga0395900_0030100 3300037418 Bacteria 5572
374 Ga0395900_0082191 3300037418 Bacteria 3310
375 Ga0395900_0093683 3300037418 Bacteria 3085
376 Ga0395900_0674084 3300037418 Bacteria 969
377 Ga0395900_0859355 3300037418 Bacteria 832
378 Ga0395898_0001496 3300037466 Bacteria 32433
379 Ga0395898_0033811 3300037466 Bacteria 5099
380 Ga0395898_0128811 3300037466 Bacteria 2424
381 Ga0395898_0195831 3300037466 Bacteria 1930
382 Ga0395898_0305979 3300037466 Bacteria 1516
383 Ga0395898_0372177 3300037466 Bacteria 1362
384 Ga0395898_0514468 3300037466 Bacteria 1138
385 Ga0395898_0551812 3300037466 Bacteria 1094
386 Ga0395905_0014645 3300037471 Bacteria 7481
387 Ga0395905_0038332 3300037471 Bacteria 4497
388 Ga0395905_0038387 3300037471 Bacteria 4494
389 Ga0395905_0038605 3300037471 Bacteria 4480
390 Ga0395905_0045340 3300037471 Bacteria 4123
391 Ga0395905_0070334 3300037471 Bacteria 3279
392 Ga0395905_0080454 3300037471 Bacteria 3053
393 Ga0395905_0114649 3300037471 Bacteria 2532
394 Ga0395905_0402646 3300037471 Bacteria 1263
395 Ga0395905_0674477 3300037471 Bacteria 936
396 Ga0395905_0941855 3300037471 Bacteria 766
397 Ga0395901_0000036 3300038443 Bacteria 214274
398 Ga0395901_0000934 3300038443 Bacteria 31772
399 Ga0395901_0004785 3300038443 Bacteria 13663
400 Ga0395901_0058845 3300038443 Bacteria 3997
401 Ga0395901_0070425 3300038443 Bacteria 3643
402 Ga0395901_0082372 3300038443 Bacteria 3361
403 Ga0395901_0131454 3300038443 Bacteria 2630
404 Ga0395901_0181643 3300038443 Bacteria 2206
405 Ga0395901_0276847 3300038443 Bacteria 1744
406 Ga0395901_0434571 3300038443 Bacteria 1344
407 Ga0395901_0439185 3300038443 Bacteria 1336
408 Ga0395901_0826636 3300038443 Bacteria 913
409 Ga0439465_0032760 3300041413 Bacteria 1660
410 Ga0439432_016483 3300042006 Bacteria 2486
411 Ga0439449_0064992 3300042007 Bacteria 1346
412 Ga0466966_0131565 3300044684 Bacteria 1532
413 Ga0466966_0316041 3300044684 Bacteria 939
414 Ga0466963_0000501 3300044694 Bacteria 18241
415 Ga0466963_0011341 3300044694 Bacteria 5424
416 Ga0466963_0248463 3300044694 Bacteria 1248
417 Ga0466963_0462917 3300044694 Bacteria 895
418 Ga0466964_0086727 3300044706 Bacteria 1354
419 Ga0466957_0000802 3300044842 Bacteria 16030
420 Ga0466957_0028326 3300044842 Bacteria 3335
421 Ga0466967_0000024 3300045976 Bacteria 71156
422 Ga0466967_0069234 3300045976 Bacteria 3153
423 Ga0466967_0094558 3300045976 Bacteria 2722
424 Ga0466967_0226011 3300045976 Bacteria 1780
425 Ga0466967_0346230 3300045976 Bacteria 1438
426 Ga0466967_0377781 3300045976 Bacteria 1375
427 Ga0466967_0942683 3300045976 Bacteria 859
428 Ga0495580_1085612 3300046472 Bacteria 507
429 Ga0495605_0177638 3300046474 Bacteria 938
430 Ga0495606_0407888 3300046507 Bacteria 706
431 Ga0495606_0596898 3300046507 Bacteria 542
432 Ga0495620_0247991 3300046515 Bacteria 679
433 Ga0495663_0170492 3300046525 Bacteria 750
434 Ga0495633_0401334 3300046558 Bacteria 620
435 Ga0495668_0025039 3300046616 Bacteria 3392
436 Ga0495669_0015357 3300046684 Bacteria 3279
437 Ga0495669_0220562 3300046684 Bacteria 909
438 Ga0495669_0552429 3300046684 Bacteria 560
439 Ga0495677_0406992 3300047445 Unclassified 538
440 Ga0496100_0216554 3300048903 Bacteria 1403
441 Ga0496101_0072291 3300048904 Bacteria 2531
442 Ga0496101_0153295 3300048904 Bacteria 1764
443 Ga0496102_0191210 3300048905 Bacteria 1929
444 Ga0496102_0310743 3300048905 Bacteria 1485
445 Ga0496102_0395746 3300048905 Bacteria 1299
446 Ga0496103_0128948 3300048906 Bacteria 1614
447 Ga0496106_0620790 3300048909 Bacteria 865
448 Ga0496107_0079650 3300048910 Bacteria 2388
449 Ga0496107_0121853 3300048910 Bacteria 1921
450 Ga0496107_0648166 3300048910 Unclassified 779
451 Ga0496108_0013735 3300048911 Bacteria 6607
452 Ga0496108_0017150 3300048911 Bacteria 5922
453 Ga0496109_0023731 3300048912 Bacteria 5444
454 Ga0496109_0081006 3300048912 Bacteria 2991
455 Ga0496109_0569622 3300048912 Bacteria 1068
456 Ga0496110_0014377 3300048913 Bacteria 6571
457 Ga0496110_0043178 3300048913 Bacteria 3936
458 Ga0496111_0114779 3300048914 Bacteria 1985
459 Ga0496111_0150282 3300048914 Bacteria 1727
460 Ga0496112_0009912 3300048915 Bacteria 8616
461 Ga0496112_0010865 3300048915 Bacteria 8286
462 Ga0496112_0291836 3300048915 Bacteria 1577
463 Ga0496113_0012994 3300048916 Bacteria 5618
464 Ga0496113_0018869 3300048916 Bacteria 4813
465 Ga0496114_0000130 3300048917 Bacteria 54437
466 Ga0496114_0011953 3300048917 Bacteria 6945
467 Ga0496115_0017637 3300048918 Bacteria 5465
468 Ga0501258_021781 3300049687 Bacteria 759
469 Ga0501225_0020484 3300049705 Bacteria 1828
470 Ga0501241_102750 3300049758 Bacteria 618
471 Ga0501262_023131 3300049759 Bacteria 863
472 nmdc:mga0n895_1905871_c1 3300050512 Bacteria 553
473 Ga0495655_0058643 3300053083 Bacteria 1043
474 Ga0207690_10224357
475 JGI24741J21665_1042310
476 JGI24740J21852_10011894
477 JGI24737J22298_10017333
478 JGI24737J22298_10018325
479 JGI24743J22301_10000984
480 JGI24743J22301_10079820
481 JGI24735J21928_10004803
482 JGI24738J21930_10002501
483 Ga0070658_10000346
484 Ga0070658_10007820
485 Ga0070658_10013428
486 Ga0070658_10021282
487 Ga0070658_10166223
488 Ga0070658_10238037
489 Ga0070658_11626908
490 Ga0070658_11975641
491 Ga0070676_10047943
492 Ga0070683_100474418
493 Ga0070690_101284653
494 Ga0070670_100038374
495 Ga0070670_100068310
496 Ga0070670_100457960
497 Ga0068869_100581614
498 Ga0070666_10016909
499 Ga0070666_10399643
500 Ga0070666_10517623
501 Ga0070666_10555720
502 Ga0070666_11197297
503 Ga0070680_100065969
504 Ga0070680_100087504
505 Ga0070680_100390558
506 Ga0070682_100704912
507 Ga0070682_100984268
508 Ga0068868_100237036
509 Ga0068868_100259899
510 Ga0070660_100000061
511 Ga0070660_100008683
512 Ga0070660_100032678
513 Ga0070660_100033786
514 Ga0070660_100036228
515 Ga0070660_100068924
516 Ga0070660_100091800
517 Ga0070660_100391241
518 Ga0070660_100457613
519 Ga0070689_100418232
520 Ga0070661_100018635
521 Ga0070661_100025778
522 Ga0070661_100076519
523 Ga0070661_100292512
524 Ga0070661_100651752
525 Ga0070692_10039180
526 Ga0070692_10124266
527 Ga0070692_10142322
528 Ga0070692_10181977
529 Ga0070692_10350340
530 Ga0070669_100252857
531 Ga0070669_101542889
532 Ga0070671_100008387
533 Ga0070671_100025374
534 Ga0070671_100074191
535 Ga0070671_100153041
536 Ga0070671_101254725
537 Ga0070673_100176570
538 Ga0070673_100366058
539 Ga0070659_100011162
540 Ga0070659_100023202
541 Ga0070659_100100747
542 Ga0070659_100207358
543 Ga0070659_100273230
544 Ga0070659_100495007
545 Ga0070659_100940573
546 Ga0070667_100008431
547 Ga0070667_100422704
548 Ga0070667_100426630
549 Ga0070694_100011758
550 Ga0070663_100005821
551 Ga0070663_100021105
552 Ga0070663_100062082
553 Ga0070663_100580881
554 Ga0070663_100609870
555 Ga0070663_100648581
556 Ga0070663_101159548
557 Ga0070663_101192393
558 Ga0070678_100515666
559 Ga0070662_100010463
560 Ga0070662_100174983
561 Ga0070662_100467774
562 Ga0070681_10860329
563 Ga0068867_100467440
564 Ga0068867_100795759
565 Ga0070679_100019821
566 Ga0070679_100221968
567 Ga0070679_100223350
568 Ga0070679_100224145
569 Ga0070679_100639304
570 Ga0070679_100936461
571 Ga0070684_100302376
572 Ga0068853_100037285
573 Ga0068853_100080226
574 Ga0068853_100106291
575 Ga0068853_100551820
576 Ga0068853_100556924
577 Ga0068853_100727140
578 Ga0070696_100179973
579 Ga0070696_100420718
580 Ga0070693_100014059
581 Ga0070665_100075129
582 Ga0070665_100604005
583 Ga0070704_100332482
584 Ga0068855_100000318
585 Ga0068855_100181409
586 Ga0068855_100360402
587 Ga0068855_100375039
588 Ga0068855_101464843
589 Ga0070664_100002393
590 Ga0070664_100004455
591 Ga0070664_100009971
592 Ga0070664_100039998
593 Ga0070664_100205316
594 Ga0070664_101908141
595 Ga0068857_100004407
596 Ga0068857_100013714
597 Ga0068857_100079697
598 Ga0068857_100658882
599 Ga0068854_100011091
600 Ga0068854_100625175
601 Ga0068854_101118393
602 Ga0068856_100141699
603 Ga0068856_100513431
604 Ga0068856_101052567
605 Ga0068856_102093087
606 Ga0068852_100002740
607 Ga0068852_100007337
608 Ga0068852_100038179
609 Ga0068852_100040483
610 Ga0068852_100266120
611 Ga0068859_100021782
612 Ga0068859_100513682
613 Ga0068864_100012335
614 Ga0068864_100087729
615 Ga0068864_100540591
616 Ga0068851_10020575
617 Ga0068851_10092541
618 Ga0068851_10196566
619 Ga0068851_10285742
620 Ga0068851_10745260
621 Ga0068863_100040629
622 Ga0068863_100240214
623 Ga0068863_100887525
624 Ga0068858_100062946
625 Ga0068858_100203453
626 Ga0068860_100101864
627 Ga0068860_102482925
628 Ga0068862_100207879
629 Ga0068862_100403090
630 Ga0068862_100417245
631 Ga0070715_10779194
632 Ga0097621_100010319
633 Ga0097621_100692342
634 Ga0068871_100220284
635 Ga0068871_100453671
636 Ga0097620_100021781
637 Ga0097620_100513742
638 Ga0105243_10274628
639 Ga0105248_10004287
640 Ga0105248_10030156
641 Ga0105237_10070205
642 Ga0105238_11332458
643 Ga0105249_10065081
644 Ga0105239_10048972
645 Ga0105239_10267211
646 Ga0105246_10537477
647 Ga0105246_10729597
648 Ga0157373_10072709
649 Ga0157373_10196165
650 Ga0157373_10225450
651 Ga0157373_10593981
652 Ga0157373_11330280
653 Ga0157371_10000616
654 Ga0157371_10012023
655 Ga0157371_10119566
656 Ga0157371_10194511
657 Ga0157371_10292162
658 Ga0157371_10363929
659 Ga0157371_10377066
660 Ga0157371_10426527
661 Ga0157371_10983961
662 Ga0157371_11188439
663 Ga0157371_11326221
664 Ga0157370_10545499
665 Ga0157370_10994266
666 Ga0157369_10521051
667 Ga0157369_10542644
668 Ga0157369_11364891
669 Ga0157374_10041076
670 Ga0157374_10180407
671 Ga0163162_10701715
672 Ga0157372_10040013
673 Ga0157372_10303217
674 Ga0157372_11112600
675 Ga0157372_12030811
676 Ga0157372_12347799
677 Ga0157380_10025918
678 Ga0182008_10127999
679 Ga0157379_10004123
680 Ga0157379_11505529
681 Ga0207656_10026964
682 Ga0207682_10057041
683 Ga0207680_10004667
684 Ga0207680_10058455
685 Ga0207680_11206661
686 Ga0207647_10005953
687 Ga0207647_10022324
688 Ga0207647_10054959
689 Ga0207647_10058986
690 Ga0207647_10179266
691 Ga0207647_10464102
692 Ga0207645_10020256
693 Ga0207645_10283588
694 Ga0207705_10000131
695 Ga0207705_10001710
696 Ga0207705_10003540
697 Ga0207705_10005342
698 Ga0207705_10009913
699 Ga0207705_10011512
700 Ga0207705_10035138
701 Ga0207705_10044160
702 Ga0207705_10295639
703 Ga0207705_11499941
704 Ga0207705_11504778
705 Ga0207707_10542452
706 Ga0207671_10014940
707 Ga0207660_10341822
708 Ga0207657_10000181
709 Ga0207657_10005217
710 Ga0207657_10006575
711 Ga0207657_10078327
712 Ga0207657_10080664
713 Ga0207657_10135503
714 Ga0207657_10142040
715 Ga0207657_10332947
716 Ga0207649_10005272
717 Ga0207649_10014893
718 Ga0207649_10091229
719 Ga0207649_10313918
720 Ga0207649_10398986
721 Ga0207652_10013437
722 Ga0207652_10290556
723 Ga0207652_10324751
724 Ga0207681_11431499
725 Ga0207681_11732143
726 Ga0207650_10052043
727 Ga0207650_10225828
728 Ga0207650_10394843
729 Ga0207644_10000389
730 Ga0207644_10193444
731 Ga0207644_10691366
732 Ga0207690_10011065
733 Ga0207690_10029379
734 Ga0207690_10069685
735 Ga0207690_10170229
736 Ga0207690_10480854
737 Ga0207690_10865790
738 Ga0207706_10012647
739 Ga0207706_10013628
740 Ga0207706_10164336
741 Ga0207706_10473945
742 Ga0207706_10854213
743 Ga0207709_10031770
744 Ga0207704_10835548
745 Ga0207711_10011037
746 Ga0207711_10015819
747 Ga0207661_10024961
748 Ga0207661_11112447
749 Ga0207679_10006229
750 Ga0207679_10140265
751 Ga0207667_10000282
752 Ga0207667_10071172
753 Ga0207667_10779326
754 Ga0207667_10793049
755 Ga0207667_10949014
756 Ga0207667_11555645
757 Ga0207651_10005720
758 Ga0207651_10147046
759 Ga0207651_10180219
760 Ga0207712_10055017
761 Ga0207668_10459050
762 Ga0207668_11780352
763 Ga0207640_10012258
764 Ga0207640_10107644
765 Ga0207640_10212332
766 Ga0207640_11362219
767 Ga0207658_10012127
768 Ga0207658_10796996
769 Ga0207677_10060697
770 Ga0207677_10630919
771 Ga0207703_10052689
772 Ga0207703_10534346
773 Ga0207703_10683857
774 Ga0207639_10018449
775 Ga0207639_10110067
776 Ga0207639_10186030
777 Ga0207678_10000587
778 Ga0207678_10001423
779 Ga0207678_10003028
780 Ga0207678_10086472
781 Ga0207678_10097030
782 Ga0207678_10317622
783 Ga0207678_10341090
784 Ga0207678_10357818
785 Ga0207678_10703930
786 Ga0207702_10010616
787 Ga0207641_10007862
788 Ga0207641_10375942
789 Ga0207648_10331021
790 Ga0207648_10413470
791 Ga0207676_10020037
792 Ga0207676_10395393
793 Ga0207674_10001996
794 Ga0207674_10008156
795 Ga0207674_10039579
796 Ga0207674_10633402
797 Ga0207675_100195318
798 Ga0207683_10446692
799 Ga0207698_10000609
800 Ga0207698_10017760
801 Ga0207698_10061318
802 Ga0207698_10230795
803 Ga0207698_10473733
804 Ga0207698_12119822
805 Ga0268266_10329090
806 Ga0268266_10929204
807 Ga0268265_10231691
808 Ga0268265_10392446
809 Ga0268264_10004042
810 Ga0268264_10612045
811 Ga0307408_100239099
812 Ga0307405_10057774
813 Ga0307405_10351844
814 Ga0307413_10014967
815 Ga0307413_10630272
816 Ga0307410_10006758
817 Ga0307410_10139530
818 Ga0307410_10322391
819 Ga0307406_10025848
820 Ga0307406_10482204
821 Ga0307406_11039472
822 Ga0307407_10056011
823 Ga0307412_10672055
824 Ga0307409_100025353
825 Ga0307409_100051105
826 Ga0307409_100679724
827 Ga0307409_102242216
828 Ga0307416_100187427
829 Ga0307416_100602431
830 Ga0307414_11073569
831 Ga0307411_10006771
832 Ga0307411_10035814
833 Ga0307411_10207320
834 Ga0307415_100129303
835 Ga0307415_100197347
836 Ga0373949_0280644
837 Ga0373931_0965817
838 Ga0395899_0000971
839 Ga0395899_0002539
840 Ga0395899_0069878
841 Ga0395899_0282034
842 Ga0395899_0944486
843 Ga0395900_0000036
844 Ga0395900_0004149
845 Ga0395900_0029812
846 Ga0395900_0030100
847 Ga0395900_0082191
848 Ga0395900_0093683
849 Ga0395900_0674084
850 Ga0395900_0859355
851 Ga0395898_0001496
852 Ga0395898_0033811
853 Ga0395898_0128811
854 Ga0395898_0195831
855 Ga0395898_0305979
856 Ga0395898_0372177
857 Ga0395898_0514468
858 Ga0395898_0551812
859 Ga0395905_0014645
860 Ga0395905_0038332
861 Ga0395905_0038387
862 Ga0395905_0038605
863 Ga0395905_0045340
864 Ga0395905_0070334
865 Ga0395905_0080454
866 Ga0395905_0114649
867 Ga0395905_0402646
868 Ga0395905_0674477
869 Ga0395905_0941855
870 Ga0395901_0000036
871 Ga0395901_0000934
872 Ga0395901_0004785
873 Ga0395901_0058845
874 Ga0395901_0070425
875 Ga0395901_0082372
876 Ga0395901_0131454
877 Ga0395901_0181643
878 Ga0395901_0276847
879 Ga0395901_0434571
880 Ga0395901_0439185
881 Ga0395901_0826636
882 Ga0439465_0032760
883 Ga0439432_016483
884 Ga0439449_0064992
885 Ga0466966_0131565
886 Ga0466966_0316041
887 Ga0466963_0000501
888 Ga0466963_0011341
889 Ga0466963_0248463
890 Ga0466963_0462917
891 Ga0466964_0086727
892 Ga0466957_0000802
893 Ga0466957_0028326
894 Ga0466967_0000024
895 Ga0466967_0069234
896 Ga0466967_0094558
897 Ga0466967_0226011
898 Ga0466967_0346230
899 Ga0466967_0377781
900 Ga0466967_0942683
901 Ga0495580_1085612
902 Ga0495605_0177638
903 Ga0495606_0407888
904 Ga0495606_0596898
905 Ga0495620_0247991
906 Ga0495663_0170492
907 Ga0495633_0401334
908 Ga0495668_0025039
909 Ga0495669_0015357
910 Ga0495669_0220562
911 Ga0495669_0552429
912 Ga0495677_0406992
913 Ga0496100_0216554
914 Ga0496101_0072291
915 Ga0496101_0153295
916 Ga0496102_0191210
917 Ga0496102_0310743
918 Ga0496102_0395746
919 Ga0496103_0128948
920 Ga0496106_0620790
921 Ga0496107_0079650
922 Ga0496107_0121853
923 Ga0496107_0648166
924 Ga0496108_0013735
925 Ga0496108_0017150
926 Ga0496109_0023731
927 Ga0496109_0081006
928 Ga0496109_0569622
929 Ga0496110_0014377
930 Ga0496110_0043178
931 Ga0496111_0114779
932 Ga0496111_0150282
933 Ga0496112_0009912
934 Ga0496112_0010865
935 Ga0496112_0291836
936 Ga0496113_0012994
937 Ga0496113_0018869
938 Ga0496114_0000130
939 Ga0496114_0011953
940 Ga0496115_0017637
941 Ga0501258_021781
942 Ga0501225_0020484
943 Ga0501241_102750
944 Ga0501262_023131
945 nmdc:mga0n895_1905871_c1
946 Ga0495655_0058643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4upi-assembly1.cif.gz_A-2 dimeric sulfatase spas1 from silicibacter pomeroyi 0.8014 34 57
8gm7-assembly2.cif.gz_B structure of apurinic/apyrimidinic dna lyase tk0353 from thermococcus kodakarensis (native crystal form) 0.6711 60 101
8oyv-assembly1.cif.gz_A de novo designed claudin fold clf_4 0.6463 24 59
8a90-assembly1.cif.gz_A crystal structure of frsh 0.6358 69 107
8oyv-assembly2.cif.gz_B de novo designed claudin fold clf_4 0.6235 24 60
ID Description Score Start End Superfamily
af_A4I3I8_82_244_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8437 26 57 1.20.140.150
af_Q54IN0_2_216_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8422 24 57 1.20.140.150
af_Q55CP3_23_220_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8236 25 57 1.20.140.150
4upiA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8014 34 57 3.40.720.10
af_A0A5S9MNN1_63_201_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.788 34 59 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A484SE46-F1-model_v4 Lipoprotein, putative 0.9477 25 110
AF-A0A350ZX82-F1-model_v4 META domain-containing protein 0.9455 26 112 GO:0016020
AF-A0A842I3Y9-F1-model_v4 META domain-containing protein 0.945 25 112
AF-A0A838F747-F1-model_v4 NlpE C-terminal OB domain-containing protein 0.9444 25 111
AF-A0A7C4JUS2-F1-model_v4 Uncharacterized protein 0.9426 23 111

Map