F450956

General Info

Members Datasets Scaffolds Average Seq Length
473 184 946 108

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100582300|Ga0070675_1005823002
Length 117
Sequence MPGSLMTEPKQINFTIVPEDPDPQDSSTSKREYANFCAVAHTPFDLTLTFCDVRPLSERDVKSAEANQTVRAPVVSRIALPFAVVPGLIAALQEQMRAVQEAQAAQTPVNWPKGPLH

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
111 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
157 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
158 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
168 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 1.06
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 17.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100582300 3300005354 Unclassified 1014
2 Ga0065704_10344253 3300005289 Bacteria 819
3 Ga0065712_10155832 3300005290 Bacteria 1336
4 Ga0065712_10261990 3300005290 Bacteria 935
5 Ga0065712_10368332 3300005290 Bacteria 766
6 Ga0065715_10093446 3300005293 Bacteria 4667
7 Ga0065715_10164551 3300005293 Bacteria 1598
8 Ga0065715_10362048 3300005293 Bacteria 934
9 Ga0065707_10000711 3300005295 Bacteria 16357
10 Ga0065707_10559015 3300005295 Bacteria 716
11 Ga0065707_10757287 3300005295 Bacteria 616
12 Ga0070670_100316747 3300005331 Bacteria 1366
13 Ga0070670_100451754 3300005331 Bacteria 1139
14 Ga0070670_101679230 3300005331 Bacteria 584
15 Ga0070677_10505383 3300005333 Unclassified 656
16 Ga0070677_10622797 3300005333 Bacteria 600
17 Ga0068869_100265207 3300005334 Bacteria 1376
18 Ga0070680_100322195 3300005336 Bacteria 1312
19 Ga0068868_101037508 3300005338 Unclassified 752
20 Ga0070689_100118937 3300005340 Bacteria 2109
21 Ga0070689_101299618 3300005340 Unclassified 655
22 Ga0070689_101509741 3300005340 Bacteria 609
23 Ga0070692_10966790 3300005345 Unclassified 593
24 Ga0070668_100160710 3300005347 Bacteria 1823
25 Ga0070669_100020555 3300005353 Bacteria 4715
26 Ga0070669_100365563 3300005353 Bacteria 1174
27 Ga0070669_101120958 3300005353 Unclassified 678
28 Ga0070669_101451280 3300005353 Unclassified 596
29 Ga0070675_100295224 3300005354 Unclassified 1427
30 Ga0070675_100350590 3300005354 Bacteria 1309
31 Ga0070675_100394982 3300005354 Bacteria 1233
32 Ga0070675_101914378 3300005354 Unclassified 547
33 Ga0070674_100127242 3300005356 Bacteria 1894
34 Ga0070674_100443409 3300005356 Unclassified 1070
35 Ga0070673_100520082 3300005364 Bacteria 1078
36 Ga0070673_100862370 3300005364 Bacteria 838
37 Ga0070688_100089406 3300005365 Bacteria 2009
38 Ga0070688_100103296 3300005365 Bacteria 1883
39 Ga0070688_100554456 3300005365 Bacteria 874
40 Ga0070667_100206616 3300005367 Bacteria 1744
41 Ga0070703_10030749 3300005406 Bacteria 1620
42 Ga0070703_10105413 3300005406 Bacteria 1000
43 Ga0070701_10220153 3300005438 Bacteria 1132
44 Ga0070700_100522966 3300005441 Bacteria 917
45 Ga0070700_100678281 3300005441 Bacteria 817
46 Ga0070700_100966343 3300005441 Bacteria 698
47 Ga0070700_101276713 3300005441 Bacteria 616
48 Ga0070694_101174938 3300005444 Bacteria 642
49 Ga0070708_100738640 3300005445 Bacteria 926
50 Ga0070678_100754708 3300005456 Unclassified 880
51 Ga0070662_100287132 3300005457 Bacteria 1333
52 Ga0068867_100045926 3300005459 Bacteria 3206
53 Ga0070707_100162935 3300005468 Bacteria 2173
54 Ga0070684_100906840 3300005535 Bacteria 826
55 Ga0068853_101902336 3300005539 Unclassified 577
56 Ga0070686_100088057 3300005544 Bacteria 2071
57 Ga0070695_100117770 3300005545 Bacteria 1813
58 Ga0070695_101541166 3300005545 Bacteria 554
59 Ga0070665_100767668 3300005548 Bacteria 977
60 Ga0070665_101949574 3300005548 Unclassified 593
61 Ga0070704_100059365 3300005549 Bacteria 2729
62 Ga0070704_100077801 3300005549 Bacteria 2431
63 Ga0070704_100356563 3300005549 Bacteria 1236
64 Ga0070704_100829043 3300005549 Bacteria 828
65 Ga0068854_100645967 3300005578 Bacteria 908
66 Ga0068852_102373491 3300005616 Bacteria 551
67 Ga0068859_100004386 3300005617 Bacteria 14390
68 Ga0068859_100206163 3300005617 Bacteria 2051
69 Ga0068859_100259160 3300005617 Bacteria 1830
70 Ga0068859_100274723 3300005617 Bacteria 1777
71 Ga0068859_101700340 3300005617 Unclassified 697
72 Ga0068859_102579831 3300005617 Unclassified 559
73 Ga0068859_102886512 3300005617 Bacteria 527
74 Ga0068861_100218789 3300005719 Bacteria 1608
75 Ga0068861_100229287 3300005719 Bacteria 1574
76 Ga0068861_100310529 3300005719 Unclassified 1369
77 Ga0068870_10110085 3300005840 Bacteria 1571
78 Ga0068863_100777848 3300005841 Bacteria 954
79 Ga0068863_101213735 3300005841 Bacteria 760
80 Ga0068858_100308544 3300005842 Bacteria 1511
81 Ga0068860_100124497 3300005843 Bacteria 2471
82 Ga0068860_100184273 3300005843 Unclassified 2018
83 Ga0068862_100588191 3300005844 Bacteria 1067
84 Ga0068862_100755352 3300005844 Bacteria 946
85 Ga0068862_100925842 3300005844 Bacteria 858
86 Ga0075363_100821135 3300006048 Unclassified 566
87 Ga0075367_10005554 3300006178 Bacteria 6280
88 Ga0075366_10038270 3300006195 Bacteria 2833
89 Ga0075366_10414622 3300006195 Unclassified 829
90 Ga0097621_100204832 3300006237 Bacteria 1714
91 Ga0068871_100947528 3300006358 Bacteria 800
92 Ga0068871_101120372 3300006358 Unclassified 736
93 Ga0075428_100000010 3300006844 Bacteria 213631
94 Ga0075428_102202099 3300006844 Bacteria 569
95 Ga0075433_10089844 3300006852 Bacteria 2715
96 Ga0075433_10436283 3300006852 Bacteria 1155
97 Ga0075429_101088051 3300006880 Bacteria 698
98 Ga0068865_102146427 3300006881 Unclassified 508
99 Ga0097620_100004386 3300006931 Bacteria 14390
100 Ga0097620_100206164 3300006931 Bacteria 2051
101 Ga0097620_100259164 3300006931 Bacteria 1830
102 Ga0097620_100274717 3300006931 Bacteria 1777
103 Ga0097620_101700536 3300006931 Unclassified 697
104 Ga0097620_102581190 3300006931 Unclassified 559
105 Ga0097620_102886557 3300006931 Bacteria 527
106 Ga0075435_100085533 3300007076 Bacteria 2596
107 Ga0111539_10000001 3300009094 Bacteria 1035431
108 Ga0111539_10014318 3300009094 Bacteria 9904
109 Ga0111539_10048898 3300009094 Bacteria 5048
110 Ga0111539_10200407 3300009094 Bacteria 2328
111 Ga0111539_10448985 3300009094 Bacteria 1501
112 Ga0111539_10458551 3300009094 Unclassified 1484
113 Ga0111539_11007087 3300009094 Bacteria 969
114 Ga0114129_12470777 3300009147 Bacteria 621
115 Ga0105243_11696228 3300009148 Unclassified 661
116 Ga0105242_12025187 3300009176 Unclassified 618
117 Ga0105242_12046078 3300009176 Bacteria 616
118 Ga0105242_12646308 3300009176 Unclassified 551
119 Ga0105248_11020071 3300009177 Bacteria 935
120 Ga0105248_13312226 3300009177 Unclassified 512
121 Ga0105249_10187968 3300009553 Bacteria 2014
122 Ga0105249_10283009 3300009553 Bacteria 1657
123 Ga0105249_11043369 3300009553 Bacteria 887
124 Ga0105249_11555194 3300009553 Unclassified 734
125 Ga0105249_12495256 3300009553 Unclassified 589
126 Ga0163162_10564305 3300013306 Bacteria 1266
127 Ga0163163_10000011 3300014325 Bacteria 264399
128 Ga0157380_10042450 3300014326 Bacteria 3555
129 Ga0157380_10099635 3300014326 Bacteria 2417
130 Ga0157380_10346978 3300014326 Bacteria 1387
131 Ga0157380_10773869 3300014326 Bacteria 974
132 Ga0157380_10993105 3300014326 Bacteria 872
133 Ga0157380_11078505 3300014326 Bacteria 841
134 Ga0157380_11403677 3300014326 Bacteria 749
135 Ga0157380_11435377 3300014326 Bacteria 741
136 Ga0207653_10131922 3300025885 Bacteria 907
137 Ga0207682_10026896 3300025893 Bacteria 2289
138 Ga0207688_10882883 3300025901 Bacteria 566
139 Ga0207643_10247341 3300025908 Bacteria 1098
140 Ga0207684_10299070 3300025910 Bacteria 1387
141 Ga0207646_10093021 3300025922 Bacteria 2699
142 Ga0207681_10039083 3300025923 Bacteria 3148
143 Ga0207681_10855984 3300025923 Unclassified 760
144 Ga0207681_11760146 3300025923 Unclassified 517
145 Ga0207681_11772613 3300025923 Unclassified 515
146 Ga0207650_10078978 3300025925 Bacteria 2491
147 Ga0207650_10410230 3300025925 Bacteria 1123
148 Ga0207659_10094851 3300025926 Bacteria 2236
149 Ga0207659_10223734 3300025926 Bacteria 1514
150 Ga0207659_10733643 3300025926 Bacteria 847
151 Ga0207706_10533746 3300025933 Bacteria 1011
152 Ga0207670_10456856 3300025936 Bacteria 1031
153 Ga0207670_11095240 3300025936 Unclassified 672
154 Ga0207669_10185573 3300025937 Bacteria 1495
155 Ga0207711_10021872 3300025941 Bacteria 5342
156 Ga0207711_10312553 3300025941 Bacteria 1451
157 Ga0207711_11278687 3300025941 Unclassified 676
158 Ga0207711_11994932 3300025941 Unclassified 523
159 Ga0207689_10843502 3300025942 Bacteria 773
160 Ga0207651_11280645 3300025960 Bacteria 659
161 Ga0207712_10167289 3300025961 Bacteria 1715
162 Ga0207712_10311596 3300025961 Bacteria 1295
163 Ga0207712_11386166 3300025961 Unclassified 629
164 Ga0207668_10426127 3300025972 Bacteria 1127
165 Ga0207668_10626692 3300025972 Bacteria 939
166 Ga0207658_10166550 3300025986 Bacteria 1811
167 Ga0207677_11289403 3300026023 Unclassified 671
168 Ga0207703_10543232 3300026035 Bacteria 1095
169 Ga0207708_10186508 3300026075 Bacteria 1649
170 Ga0207708_10825206 3300026075 Bacteria 799
171 Ga0207675_100216116 3300026118 Unclassified 1846
172 Ga0207675_100348925 3300026118 Bacteria 1450
173 Ga0207675_100839603 3300026118 Bacteria 933
174 Ga0207428_10000002 3300027907 Bacteria 854851
175 Ga0207428_10017090 3300027907 Bacteria 6233
176 Ga0207428_10075171 3300027907 Bacteria 2648
177 Ga0207428_10852132 3300027907 Bacteria 645
178 Ga0268266_11479658 3300028379 Bacteria 655
179 Ga0268265_10624147 3300028380 Bacteria 1033
180 Ga0268265_10966379 3300028380 Unclassified 840
181 Ga0268265_11039165 3300028380 Bacteria 811
182 Ga0268264_10093130 3300028381 Unclassified 2602
183 Ga0268264_10165453 3300028381 Bacteria 1996
184 Ga0268264_12098535 3300028381 Unclassified 574
185 Ga0268264_12105186 3300028381 Bacteria 573
186 Ga0307408_100032664 3300031548 Bacteria 3630
187 Ga0307408_100049179 3300031548 Bacteria 3027
188 Ga0307408_100052776 3300031548 Bacteria 2934
189 Ga0307408_100241301 3300031548 Bacteria 1485
190 Ga0307405_10107905 3300031731 Bacteria 1880
191 Ga0307405_10329053 3300031731 Bacteria 1170
192 Ga0307405_10825724 3300031731 Unclassified 778
193 Ga0307413_10054878 3300031824 Bacteria 2420
194 Ga0307413_10345375 3300031824 Bacteria 1146
195 Ga0307413_10416747 3300031824 Bacteria 1057
196 Ga0307410_10164597 3300031852 Bacteria 1665
197 Ga0307410_10264308 3300031852 Bacteria 1343
198 Ga0307410_10922886 3300031852 Bacteria 749
199 Ga0307406_10146266 3300031901 Bacteria 1680
200 Ga0307407_10079170 3300031903 Bacteria 1982
201 Ga0307407_11393117 3300031903 Unclassified 552
202 Ga0307412_10087440 3300031911 Bacteria 2171
203 Ga0307412_10152083 3300031911 Bacteria 1709
204 Ga0307412_10447045 3300031911 Bacteria 1064
205 Ga0307412_10482829 3300031911 Unclassified 1028
206 Ga0307412_10517053 3300031911 Bacteria 997
207 Ga0307409_100061792 3300031995 Bacteria 2929
208 Ga0307409_100131252 3300031995 Bacteria 2141
209 Ga0307409_100179559 3300031995 Bacteria 1872
210 Ga0307416_100040904 3300032002 Bacteria 3606
211 Ga0307416_100106013 3300032002 Bacteria 2462
212 Ga0307416_100155164 3300032002 Bacteria 2106
213 Ga0307416_100921856 3300032002 Unclassified 974
214 Ga0307416_101541449 3300032002 Bacteria 770
215 Ga0307416_101566606 3300032002 Bacteria 764
216 Ga0307416_101700428 3300032002 Bacteria 736
217 Ga0307411_10047228 3300032005 Bacteria 2782
218 Ga0307411_10879973 3300032005 Unclassified 794
219 Ga0307411_11585886 3300032005 Bacteria 604
220 Ga0307415_102006312 3300032126 Unclassified 563
221 Ga0373934_0000878 3300035086 Bacteria 10850
222 Ga0373953_0044489 3300035117 Bacteria 1775
223 Ga0373956_0004818 3300035119 Bacteria 5398
224 Ga0373956_0044495 3300035119 Bacteria 1979
225 Ga0373956_0602839 3300035119 Bacteria 524
226 Ga0373957_0138855 3300035120 Bacteria 992
227 Ga0373955_0001450 3300035172 Bacteria 10076
228 Ga0373933_0084435 3300035724 Bacteria 1951
229 Ga0373947_0510972 3300035725 Bacteria 817
230 Ga0373937_0000867 3300036401 Bacteria 26012
231 Ga0373937_1226220 3300036401 Unclassified 698
232 Ga0451807_0417392 3300041486 Unclassified 650
233 Ga0451853_2114990 3300041512 Unclassified 636
234 Ga0450920_062702 3300042122 Unclassified 752
235 Ga0439459_0114381 3300042438 Bacteria 674
236 Ga0453683_0157120 3300044673 Bacteria 1438
237 Ga0451576_0007100 3300045051 Bacteria 13523
238 Ga0466967_1492054 3300045976 Bacteria 673
239 Ga0495592_0101022 3300046454 Bacteria 2056
240 Ga0495592_0122778 3300046454 Bacteria 1825
241 Ga0495592_0538234 3300046454 Bacteria 720
242 Ga0495641_0283648 3300046461 Bacteria 746
243 Ga0495651_0752119 3300046462 Unclassified 604
244 Ga0495587_0237549 3300046536 Bacteria 1026
245 Ga0495587_0465882 3300046536 Bacteria 700
246 Ga0495587_0614165 3300046536 Bacteria 598
247 Ga0495598_0204131 3300046537 Bacteria 715
248 Ga0495621_0052358 3300046539 Bacteria 1463
249 Ga0495645_0231205 3300046543 Bacteria 1238
250 Ga0495656_0046437 3300046615 Bacteria 1838
251 Ga0495599_0088202 3300046678 Bacteria 1937
252 Ga0495599_0725915 3300046678 Bacteria 571
253 Ga0495684_0746838 3300047471 Bacteria 644
254 Ga0496102_0758915 3300048905 Bacteria 893
255 Ga0496106_0796231 3300048909 Bacteria 750
256 Ga0496110_0702028 3300048913 Bacteria 913
257 Ga0496114_1586337 3300048917 Unclassified 542
258 Ga0501298_072198 3300049521 Unclassified 747
259 Ga0501031_0013288 3300049568 Bacteria 5373
260 Ga0501031_0782590 3300049568 Bacteria 612
261 Ga0501032_0005211 3300049569 Bacteria 9673
262 Ga0501032_0005991 3300049569 Bacteria 8969
263 Ga0501032_0080911 3300049569 Bacteria 2161
264 Ga0501032_0081965 3300049569 Bacteria 2146
265 Ga0501033_0003267 3300049570 Bacteria 13417
266 Ga0501033_0006579 3300049570 Bacteria 9090
267 Ga0501033_0018774 3300049570 Bacteria 5226
268 Ga0501033_0417766 3300049570 Bacteria 934
269 Ga0501033_0420350 3300049570 Bacteria 931
270 Ga0501033_0812153 3300049570 Bacteria 632
271 Ga0501034_0002713 3300049571 Bacteria 20857
272 Ga0501034_0007399 3300049571 Bacteria 11692
273 Ga0501034_0012642 3300049571 Bacteria 8710
274 Ga0501034_0024299 3300049571 Bacteria 6163
275 Ga0501034_0149414 3300049571 Bacteria 2312
276 Ga0501034_0238654 3300049571 Bacteria 1764
277 Ga0501034_0621240 3300049571 Bacteria 984
278 Ga0501036_0004139 3300049572 Bacteria 11667
279 Ga0501036_0008367 3300049572 Bacteria 8477
280 Ga0501036_0021561 3300049572 Bacteria 5416
281 Ga0501036_0022618 3300049572 Bacteria 5289
282 Ga0501036_0094108 3300049572 Bacteria 2532
283 Ga0501036_0231547 3300049572 Bacteria 1550
284 Ga0501036_1105352 3300049572 Unclassified 647
285 Ga0501036_1609633 3300049572 Unclassified 524
286 Ga0501037_0002251 3300049573 Bacteria 13948
287 Ga0501037_0025602 3300049573 Bacteria 4359
288 Ga0501037_0048350 3300049573 Bacteria 3118
289 Ga0501037_0074856 3300049573 Bacteria 2459
290 Ga0501037_0139243 3300049573 Bacteria 1737
291 Ga0501037_0343967 3300049573 Bacteria 1030
292 Ga0501037_0572743 3300049573 Bacteria 760
293 Ga0501038_0001132 3300049574 Bacteria 24183
294 Ga0501038_0016576 3300049574 Bacteria 6679
295 Ga0501038_0061632 3300049574 Bacteria 3207
296 Ga0501038_0104093 3300049574 Bacteria 2359
297 Ga0501038_0146525 3300049574 Bacteria 1927
298 Ga0501038_0454707 3300049574 Unclassified 984
299 Ga0501038_0480223 3300049574 Bacteria 952
300 Ga0501039_0003636 3300049575 Bacteria 11554
301 Ga0501039_0006632 3300049575 Bacteria 8795
302 Ga0501039_0032267 3300049575 Bacteria 4038
303 Ga0501039_1083770 3300049575 Bacteria 621
304 Ga0501040_0281752 3300049576 Bacteria 1187
305 Ga0501040_0416202 3300049576 Bacteria 966
306 Ga0501040_0423877 3300049576 Unclassified 956
307 Ga0501041_0178257 3300049577 Bacteria 1330
308 Ga0501041_0244801 3300049577 Bacteria 1127
309 Ga0501042_0041389 3300049578 Bacteria 3276
310 Ga0501042_0047819 3300049578 Bacteria 3050
311 Ga0501042_0394928 3300049578 Bacteria 1002
312 Ga0501042_0799871 3300049578 Bacteria 686
313 Ga0501043_0008071 3300049579 Bacteria 8308
314 Ga0501043_0013788 3300049579 Bacteria 6325
315 Ga0501043_0022838 3300049579 Bacteria 4905
316 Ga0501043_0059173 3300049579 Bacteria 3006
317 Ga0501043_0382736 3300049579 Bacteria 1065
318 Ga0501043_0461035 3300049579 Bacteria 953
319 Ga0501046_0001492 3300049580 Bacteria 22428
320 Ga0501046_0006759 3300049580 Bacteria 10127
321 Ga0501046_0008708 3300049580 Bacteria 8819
322 Ga0501046_0695256 3300049580 Unclassified 717
323 Ga0501046_1172897 3300049580 Unclassified 528
324 Ga0501047_0000936 3300049581 Bacteria 29599
325 Ga0501047_0007496 3300049581 Bacteria 10267
326 Ga0501047_0194365 3300049581 Bacteria 1891
327 Ga0501047_0295006 3300049581 Bacteria 1464
328 Ga0501047_0309174 3300049581 Bacteria 1421
329 Ga0501047_0420704 3300049581 Bacteria 1167
330 Ga0501047_0455975 3300049581 Bacteria 1107
331 Ga0501047_0820684 3300049581 Bacteria 744
332 Ga0501048_0001779 3300049582 Bacteria 16375
333 Ga0501048_0022895 3300049582 Bacteria 4567
334 Ga0501048_0047611 3300049582 Bacteria 3059
335 Ga0501048_0085288 3300049582 Bacteria 2227
336 Ga0501048_0266935 3300049582 Bacteria 1216
337 Ga0501048_0286915 3300049582 Bacteria 1170
338 Ga0501067_0000881 3300049583 Bacteria 16143
339 Ga0501067_0205083 3300049583 Bacteria 1098
340 Ga0501068_0001505 3300049584 Bacteria 12410
341 Ga0501068_0008328 3300049584 Bacteria 5766
342 Ga0501068_0119992 3300049584 Bacteria 1639
343 Ga0501068_0274300 3300049584 Bacteria 1077
344 Ga0501069_0000446 3300049585 Bacteria 18778
345 Ga0501069_0040112 3300049585 Bacteria 2587
346 Ga0501069_0081628 3300049585 Bacteria 1821
347 Ga0501069_0183562 3300049585 Bacteria 1209
348 Ga0501069_0202740 3300049585 Unclassified 1150
349 Ga0501070_0016601 3300049586 Bacteria 6184
350 Ga0501070_0081791 3300049586 Bacteria 2672
351 Ga0501070_0261869 3300049586 Bacteria 1413
352 Ga0501070_0368668 3300049586 Bacteria 1164
353 Ga0501070_0630041 3300049586 Bacteria 853
354 Ga0501071_0001919 3300049587 Bacteria 12379
355 Ga0501071_0043714 3300049587 Bacteria 3213
356 Ga0501071_0442162 3300049587 Bacteria 995
357 Ga0501072_0030676 3300049588 Bacteria 4206
358 Ga0501072_0099391 3300049588 Bacteria 2313
359 Ga0501072_0099446 3300049588 Bacteria 2312
360 Ga0501072_0296453 3300049588 Bacteria 1285
361 Ga0501072_0417772 3300049588 Bacteria 1063
362 Ga0501073_0000488 3300049589 Bacteria 27619
363 Ga0501073_0002913 3300049589 Bacteria 12846
364 Ga0501073_0124178 3300049589 Bacteria 1789
365 Ga0501073_0201217 3300049589 Unclassified 1377
366 Ga0501073_0217044 3300049589 Bacteria 1322
367 Ga0501073_0232790 3300049589 Bacteria 1272
368 Ga0501073_0469871 3300049589 Bacteria 869
369 Ga0501073_0907705 3300049589 Unclassified 606
370 Ga0501073_0907806 3300049589 Unclassified 606
371 Ga0501074_0001142 3300049590 Bacteria 17387
372 Ga0501074_0002832 3300049590 Bacteria 12145
373 Ga0501074_0114508 3300049590 Bacteria 1929
374 Ga0501074_0261853 3300049590 Bacteria 1229
375 Ga0501075_0289017 3300049591 Bacteria 1249
376 Ga0501075_0296003 3300049591 Bacteria 1233
377 Ga0501075_0353653 3300049591 Bacteria 1119
378 Ga0501075_0853917 3300049591 Bacteria 692
379 Ga0501076_0037177 3300049592 Bacteria 3817
380 Ga0501076_0119345 3300049592 Bacteria 2135
381 Ga0501076_0484436 3300049592 Bacteria 1019
382 Ga0501076_0558002 3300049592 Bacteria 944
383 Ga0501076_0583620 3300049592 Bacteria 922
384 Ga0501076_0583913 3300049592 Bacteria 922
385 Ga0501076_1462963 3300049592 Bacteria 561
386 Ga0501077_0057227 3300049593 Bacteria 2476
387 Ga0501077_0148343 3300049593 Bacteria 1488
388 Ga0501199_039886 3300049650 Unclassified 606
389 Ga0501201_053107 3300049651 Unclassified 510
390 Ga0501206_053428 3300049653 Unclassified 648
391 Ga0501249_034532 3300049679 Bacteria 1135
392 Ga0501253_059000 3300049683 Bacteria 822
393 Ga0501221_135822 3300049704 Unclassified 640
394 Ga0501245_048530 3300049708 Unclassified 747
395 Ga0501079_0008289 3300049741 Bacteria 7875
396 Ga0501079_0021446 3300049741 Bacteria 4941
397 Ga0501079_0028340 3300049741 Bacteria 4296
398 Ga0501079_0150731 3300049741 Bacteria 1813
399 Ga0501079_0450106 3300049741 Bacteria 1011
400 Ga0501079_1202362 3300049741 Unclassified 597
401 Ga0501080_0001608 3300049742 Bacteria 19201
402 Ga0501080_0005855 3300049742 Bacteria 11002
403 Ga0501080_0041187 3300049742 Bacteria 4305
404 Ga0501080_0050478 3300049742 Bacteria 3871
405 Ga0501080_0053573 3300049742 Bacteria 3756
406 Ga0501080_0366464 3300049742 Bacteria 1299
407 Ga0501080_0553814 3300049742 Bacteria 1024
408 Ga0501080_0628282 3300049742 Bacteria 952
409 Ga0501081_0120427 3300049743 Unclassified 1869
410 Ga0501081_0217864 3300049743 Bacteria 1388
411 Ga0501081_0421888 3300049743 Bacteria 989
412 Ga0501081_0608650 3300049743 Bacteria 818
413 Ga0501083_0004799 3300049744 Bacteria 9553
414 Ga0501083_0006416 3300049744 Bacteria 8340
415 Ga0501083_0006619 3300049744 Bacteria 8224
416 Ga0501083_0015256 3300049744 Bacteria 5381
417 Ga0501083_0018712 3300049744 Bacteria 4823
418 Ga0501083_0906876 3300049744 Unclassified 573
419 Ga0501268_145478 3300049765 Unclassified 543
420 Ga0501272_033141 3300049769 Unclassified 664
421 Ga0501035_0010875 3300049822 Bacteria 8428
422 Ga0501035_0108626 3300049822 Bacteria 2432
423 Ga0501035_0232815 3300049822 Bacteria 1569
424 Ga0501035_0262227 3300049822 Bacteria 1464
425 Ga0501044_0001462 3300049823 Bacteria 27726
426 Ga0501044_0006946 3300049823 Bacteria 12458
427 Ga0501044_0376458 3300049823 Bacteria 1335
428 Ga0501044_0723105 3300049823 Bacteria 879
429 Ga0501044_0725638 3300049823 Bacteria 877
430 Ga0501044_0931388 3300049823 Unclassified 742
431 Ga0501045_0001053 3300049824 Bacteria 18173
432 Ga0501045_0018000 3300049824 Bacteria 5017
433 Ga0501045_0068898 3300049824 Bacteria 2600
434 Ga0501045_0277097 3300049824 Bacteria 1248
435 nmdc:mga0k408_24571_c1 3300050493 Bacteria 2571
436 nmdc:mga0k408_655678_c1 3300050493 Unclassified 617
437 nmdc:mga0qj67_1162234_c1 3300050509 Unclassified 601
438 nmdc:mga06r32_1160199_c1 3300050510 Bacteria 720
439 nmdc:mga06r32_1289881_c1 3300050510 Bacteria 674
440 nmdc:mga08y16_1299221_c1 3300050511 Unclassified 694
441 nmdc:mga08y16_131195_c1 3300050511 Bacteria 2605
442 nmdc:mga08y16_392430_c1 3300050511 Bacteria 1422
443 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
444 nmdc:mga08y16_68375_c1 3300050511 Bacteria 3703
445 nmdc:mga08y16_871_c1 3300050511 Bacteria 29077
446 nmdc:mga0n895_444272_c1 3300050512 Bacteria 1310
447 nmdc:mga0rr50_408343_c1 3300050513 Bacteria 1148
448 nmdc:mga0rr50_99512_c1 3300050513 Bacteria 2281
449 nmdc:mga0a205_298528_c1 3300050515 Bacteria 1484
450 nmdc:mga0a205_93937_c1 3300050515 Bacteria 2897
451 Ga0495601_0157295 3300053077 Bacteria 1484
452 Ga0495595_0530902 3300053084 Unclassified 600
453 Ga0495619_1072262 3300053085 Unclassified 537
454 Ga0501084_0010098 3300054114 Bacteria 7802
455 Ga0501084_0032364 3300054114 Bacteria 4374
456 Ga0501084_0037964 3300054114 Bacteria 4025
457 Ga0501084_0041444 3300054114 Bacteria 3852
458 Ga0501084_0201556 3300054114 Bacteria 1679
459 Ga0501084_0242750 3300054114 Bacteria 1520
460 Ga0501084_0533350 3300054114 Bacteria 992
461 Ga0501082_0005541 3300060353 Bacteria 10962
462 Ga0501082_0009747 3300060353 Bacteria 8275
463 Ga0501082_0010859 3300060353 Bacteria 7843
464 Ga0501082_0051524 3300060353 Bacteria 3548
465 Ga0501082_0203736 3300060353 Bacteria 1721
466 Ga0501082_0339799 3300060353 Bacteria 1308
467 Ga0501082_0552133 3300060353 Bacteria 1007
468 Ga0501082_0572118 3300060353 Bacteria 988
469 Ga0501082_0764555 3300060353 Bacteria 845
470 Ga0501082_0896793 3300060353 Bacteria 775
471 Ga0530510_0088674 3300061734 Bacteria 2255
472 Ga0530510_0345151 3300061734 Bacteria 1118
473 Ga0530510_0954823 3300061734 Bacteria 656
474 Ga0070675_100582300
475 Ga0065704_10344253
476 Ga0065712_10155832
477 Ga0065712_10261990
478 Ga0065712_10368332
479 Ga0065715_10093446
480 Ga0065715_10164551
481 Ga0065715_10362048
482 Ga0065707_10000711
483 Ga0065707_10559015
484 Ga0065707_10757287
485 Ga0070670_100316747
486 Ga0070670_100451754
487 Ga0070670_101679230
488 Ga0070677_10505383
489 Ga0070677_10622797
490 Ga0068869_100265207
491 Ga0070680_100322195
492 Ga0068868_101037508
493 Ga0070689_100118937
494 Ga0070689_101299618
495 Ga0070689_101509741
496 Ga0070692_10966790
497 Ga0070668_100160710
498 Ga0070669_100020555
499 Ga0070669_100365563
500 Ga0070669_101120958
501 Ga0070669_101451280
502 Ga0070675_100295224
503 Ga0070675_100350590
504 Ga0070675_100394982
505 Ga0070675_101914378
506 Ga0070674_100127242
507 Ga0070674_100443409
508 Ga0070673_100520082
509 Ga0070673_100862370
510 Ga0070688_100089406
511 Ga0070688_100103296
512 Ga0070688_100554456
513 Ga0070667_100206616
514 Ga0070703_10030749
515 Ga0070703_10105413
516 Ga0070701_10220153
517 Ga0070700_100522966
518 Ga0070700_100678281
519 Ga0070700_100966343
520 Ga0070700_101276713
521 Ga0070694_101174938
522 Ga0070708_100738640
523 Ga0070678_100754708
524 Ga0070662_100287132
525 Ga0068867_100045926
526 Ga0070707_100162935
527 Ga0070684_100906840
528 Ga0068853_101902336
529 Ga0070686_100088057
530 Ga0070695_100117770
531 Ga0070695_101541166
532 Ga0070665_100767668
533 Ga0070665_101949574
534 Ga0070704_100059365
535 Ga0070704_100077801
536 Ga0070704_100356563
537 Ga0070704_100829043
538 Ga0068854_100645967
539 Ga0068852_102373491
540 Ga0068859_100004386
541 Ga0068859_100206163
542 Ga0068859_100259160
543 Ga0068859_100274723
544 Ga0068859_101700340
545 Ga0068859_102579831
546 Ga0068859_102886512
547 Ga0068861_100218789
548 Ga0068861_100229287
549 Ga0068861_100310529
550 Ga0068870_10110085
551 Ga0068863_100777848
552 Ga0068863_101213735
553 Ga0068858_100308544
554 Ga0068860_100124497
555 Ga0068860_100184273
556 Ga0068862_100588191
557 Ga0068862_100755352
558 Ga0068862_100925842
559 Ga0075363_100821135
560 Ga0075367_10005554
561 Ga0075366_10038270
562 Ga0075366_10414622
563 Ga0097621_100204832
564 Ga0068871_100947528
565 Ga0068871_101120372
566 Ga0075428_100000010
567 Ga0075428_102202099
568 Ga0075433_10089844
569 Ga0075433_10436283
570 Ga0075429_101088051
571 Ga0068865_102146427
572 Ga0097620_100004386
573 Ga0097620_100206164
574 Ga0097620_100259164
575 Ga0097620_100274717
576 Ga0097620_101700536
577 Ga0097620_102581190
578 Ga0097620_102886557
579 Ga0075435_100085533
580 Ga0111539_10000001
581 Ga0111539_10014318
582 Ga0111539_10048898
583 Ga0111539_10200407
584 Ga0111539_10448985
585 Ga0111539_10458551
586 Ga0111539_11007087
587 Ga0114129_12470777
588 Ga0105243_11696228
589 Ga0105242_12025187
590 Ga0105242_12046078
591 Ga0105242_12646308
592 Ga0105248_11020071
593 Ga0105248_13312226
594 Ga0105249_10187968
595 Ga0105249_10283009
596 Ga0105249_11043369
597 Ga0105249_11555194
598 Ga0105249_12495256
599 Ga0163162_10564305
600 Ga0163163_10000011
601 Ga0157380_10042450
602 Ga0157380_10099635
603 Ga0157380_10346978
604 Ga0157380_10773869
605 Ga0157380_10993105
606 Ga0157380_11078505
607 Ga0157380_11403677
608 Ga0157380_11435377
609 Ga0207653_10131922
610 Ga0207682_10026896
611 Ga0207688_10882883
612 Ga0207643_10247341
613 Ga0207684_10299070
614 Ga0207646_10093021
615 Ga0207681_10039083
616 Ga0207681_10855984
617 Ga0207681_11760146
618 Ga0207681_11772613
619 Ga0207650_10078978
620 Ga0207650_10410230
621 Ga0207659_10094851
622 Ga0207659_10223734
623 Ga0207659_10733643
624 Ga0207706_10533746
625 Ga0207670_10456856
626 Ga0207670_11095240
627 Ga0207669_10185573
628 Ga0207711_10021872
629 Ga0207711_10312553
630 Ga0207711_11278687
631 Ga0207711_11994932
632 Ga0207689_10843502
633 Ga0207651_11280645
634 Ga0207712_10167289
635 Ga0207712_10311596
636 Ga0207712_11386166
637 Ga0207668_10426127
638 Ga0207668_10626692
639 Ga0207658_10166550
640 Ga0207677_11289403
641 Ga0207703_10543232
642 Ga0207708_10186508
643 Ga0207708_10825206
644 Ga0207675_100216116
645 Ga0207675_100348925
646 Ga0207675_100839603
647 Ga0207428_10000002
648 Ga0207428_10017090
649 Ga0207428_10075171
650 Ga0207428_10852132
651 Ga0268266_11479658
652 Ga0268265_10624147
653 Ga0268265_10966379
654 Ga0268265_11039165
655 Ga0268264_10093130
656 Ga0268264_10165453
657 Ga0268264_12098535
658 Ga0268264_12105186
659 Ga0307408_100032664
660 Ga0307408_100049179
661 Ga0307408_100052776
662 Ga0307408_100241301
663 Ga0307405_10107905
664 Ga0307405_10329053
665 Ga0307405_10825724
666 Ga0307413_10054878
667 Ga0307413_10345375
668 Ga0307413_10416747
669 Ga0307410_10164597
670 Ga0307410_10264308
671 Ga0307410_10922886
672 Ga0307406_10146266
673 Ga0307407_10079170
674 Ga0307407_11393117
675 Ga0307412_10087440
676 Ga0307412_10152083
677 Ga0307412_10447045
678 Ga0307412_10482829
679 Ga0307412_10517053
680 Ga0307409_100061792
681 Ga0307409_100131252
682 Ga0307409_100179559
683 Ga0307416_100040904
684 Ga0307416_100106013
685 Ga0307416_100155164
686 Ga0307416_100921856
687 Ga0307416_101541449
688 Ga0307416_101566606
689 Ga0307416_101700428
690 Ga0307411_10047228
691 Ga0307411_10879973
692 Ga0307411_11585886
693 Ga0307415_102006312
694 Ga0373934_0000878
695 Ga0373953_0044489
696 Ga0373956_0004818
697 Ga0373956_0044495
698 Ga0373956_0602839
699 Ga0373957_0138855
700 Ga0373955_0001450
701 Ga0373933_0084435
702 Ga0373947_0510972
703 Ga0373937_0000867
704 Ga0373937_1226220
705 Ga0451807_0417392
706 Ga0451853_2114990
707 Ga0450920_062702
708 Ga0439459_0114381
709 Ga0453683_0157120
710 Ga0451576_0007100
711 Ga0466967_1492054
712 Ga0495592_0101022
713 Ga0495592_0122778
714 Ga0495592_0538234
715 Ga0495641_0283648
716 Ga0495651_0752119
717 Ga0495587_0237549
718 Ga0495587_0465882
719 Ga0495587_0614165
720 Ga0495598_0204131
721 Ga0495621_0052358
722 Ga0495645_0231205
723 Ga0495656_0046437
724 Ga0495599_0088202
725 Ga0495599_0725915
726 Ga0495684_0746838
727 Ga0496102_0758915
728 Ga0496106_0796231
729 Ga0496110_0702028
730 Ga0496114_1586337
731 Ga0501298_072198
732 Ga0501031_0013288
733 Ga0501031_0782590
734 Ga0501032_0005211
735 Ga0501032_0005991
736 Ga0501032_0080911
737 Ga0501032_0081965
738 Ga0501033_0003267
739 Ga0501033_0006579
740 Ga0501033_0018774
741 Ga0501033_0417766
742 Ga0501033_0420350
743 Ga0501033_0812153
744 Ga0501034_0002713
745 Ga0501034_0007399
746 Ga0501034_0012642
747 Ga0501034_0024299
748 Ga0501034_0149414
749 Ga0501034_0238654
750 Ga0501034_0621240
751 Ga0501036_0004139
752 Ga0501036_0008367
753 Ga0501036_0021561
754 Ga0501036_0022618
755 Ga0501036_0094108
756 Ga0501036_0231547
757 Ga0501036_1105352
758 Ga0501036_1609633
759 Ga0501037_0002251
760 Ga0501037_0025602
761 Ga0501037_0048350
762 Ga0501037_0074856
763 Ga0501037_0139243
764 Ga0501037_0343967
765 Ga0501037_0572743
766 Ga0501038_0001132
767 Ga0501038_0016576
768 Ga0501038_0061632
769 Ga0501038_0104093
770 Ga0501038_0146525
771 Ga0501038_0454707
772 Ga0501038_0480223
773 Ga0501039_0003636
774 Ga0501039_0006632
775 Ga0501039_0032267
776 Ga0501039_1083770
777 Ga0501040_0281752
778 Ga0501040_0416202
779 Ga0501040_0423877
780 Ga0501041_0178257
781 Ga0501041_0244801
782 Ga0501042_0041389
783 Ga0501042_0047819
784 Ga0501042_0394928
785 Ga0501042_0799871
786 Ga0501043_0008071
787 Ga0501043_0013788
788 Ga0501043_0022838
789 Ga0501043_0059173
790 Ga0501043_0382736
791 Ga0501043_0461035
792 Ga0501046_0001492
793 Ga0501046_0006759
794 Ga0501046_0008708
795 Ga0501046_0695256
796 Ga0501046_1172897
797 Ga0501047_0000936
798 Ga0501047_0007496
799 Ga0501047_0194365
800 Ga0501047_0295006
801 Ga0501047_0309174
802 Ga0501047_0420704
803 Ga0501047_0455975
804 Ga0501047_0820684
805 Ga0501048_0001779
806 Ga0501048_0022895
807 Ga0501048_0047611
808 Ga0501048_0085288
809 Ga0501048_0266935
810 Ga0501048_0286915
811 Ga0501067_0000881
812 Ga0501067_0205083
813 Ga0501068_0001505
814 Ga0501068_0008328
815 Ga0501068_0119992
816 Ga0501068_0274300
817 Ga0501069_0000446
818 Ga0501069_0040112
819 Ga0501069_0081628
820 Ga0501069_0183562
821 Ga0501069_0202740
822 Ga0501070_0016601
823 Ga0501070_0081791
824 Ga0501070_0261869
825 Ga0501070_0368668
826 Ga0501070_0630041
827 Ga0501071_0001919
828 Ga0501071_0043714
829 Ga0501071_0442162
830 Ga0501072_0030676
831 Ga0501072_0099391
832 Ga0501072_0099446
833 Ga0501072_0296453
834 Ga0501072_0417772
835 Ga0501073_0000488
836 Ga0501073_0002913
837 Ga0501073_0124178
838 Ga0501073_0201217
839 Ga0501073_0217044
840 Ga0501073_0232790
841 Ga0501073_0469871
842 Ga0501073_0907705
843 Ga0501073_0907806
844 Ga0501074_0001142
845 Ga0501074_0002832
846 Ga0501074_0114508
847 Ga0501074_0261853
848 Ga0501075_0289017
849 Ga0501075_0296003
850 Ga0501075_0353653
851 Ga0501075_0853917
852 Ga0501076_0037177
853 Ga0501076_0119345
854 Ga0501076_0484436
855 Ga0501076_0558002
856 Ga0501076_0583620
857 Ga0501076_0583913
858 Ga0501076_1462963
859 Ga0501077_0057227
860 Ga0501077_0148343
861 Ga0501199_039886
862 Ga0501201_053107
863 Ga0501206_053428
864 Ga0501249_034532
865 Ga0501253_059000
866 Ga0501221_135822
867 Ga0501245_048530
868 Ga0501079_0008289
869 Ga0501079_0021446
870 Ga0501079_0028340
871 Ga0501079_0150731
872 Ga0501079_0450106
873 Ga0501079_1202362
874 Ga0501080_0001608
875 Ga0501080_0005855
876 Ga0501080_0041187
877 Ga0501080_0050478
878 Ga0501080_0053573
879 Ga0501080_0366464
880 Ga0501080_0553814
881 Ga0501080_0628282
882 Ga0501081_0120427
883 Ga0501081_0217864
884 Ga0501081_0421888
885 Ga0501081_0608650
886 Ga0501083_0004799
887 Ga0501083_0006416
888 Ga0501083_0006619
889 Ga0501083_0015256
890 Ga0501083_0018712
891 Ga0501083_0906876
892 Ga0501268_145478
893 Ga0501272_033141
894 Ga0501035_0010875
895 Ga0501035_0108626
896 Ga0501035_0232815
897 Ga0501035_0262227
898 Ga0501044_0001462
899 Ga0501044_0006946
900 Ga0501044_0376458
901 Ga0501044_0723105
902 Ga0501044_0725638
903 Ga0501044_0931388
904 Ga0501045_0001053
905 Ga0501045_0018000
906 Ga0501045_0068898
907 Ga0501045_0277097
908 nmdc:mga0k408_24571_c1
909 nmdc:mga0k408_655678_c1
910 nmdc:mga0qj67_1162234_c1
911 nmdc:mga06r32_1160199_c1
912 nmdc:mga06r32_1289881_c1
913 nmdc:mga08y16_1299221_c1
914 nmdc:mga08y16_131195_c1
915 nmdc:mga08y16_392430_c1
916 nmdc:mga08y16_3_c1
917 nmdc:mga08y16_68375_c1
918 nmdc:mga08y16_871_c1
919 nmdc:mga0n895_444272_c1
920 nmdc:mga0rr50_408343_c1
921 nmdc:mga0rr50_99512_c1
922 nmdc:mga0a205_298528_c1
923 nmdc:mga0a205_93937_c1
924 Ga0495601_0157295
925 Ga0495595_0530902
926 Ga0495619_1072262
927 Ga0501084_0010098
928 Ga0501084_0032364
929 Ga0501084_0037964
930 Ga0501084_0041444
931 Ga0501084_0201556
932 Ga0501084_0242750
933 Ga0501084_0533350
934 Ga0501082_0005541
935 Ga0501082_0009747
936 Ga0501082_0010859
937 Ga0501082_0051524
938 Ga0501082_0203736
939 Ga0501082_0339799
940 Ga0501082_0552133
941 Ga0501082_0572118
942 Ga0501082_0764555
943 Ga0501082_0896793
944 Ga0530510_0088674
945 Ga0530510_0345151
946 Ga0530510_0954823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

6

105

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wii-assembly3.cif.gz_B complement c3b in complex with factor h domains 1-4 0.6326 22 78
5fo7-assembly1.cif.gz_B crystal structure of human complement c3b at 2.8 angstrom resolution 0.6303 24 78
2qki-assembly2.cif.gz_F human c3c in complex with the inhibitor compstatin 0.6189 24 78
6bz0-assembly2.cif.gz_C 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. 0.6081 24 42
1i8d-assembly1.cif.gz_B crystal structure of riboflavin synthase 0.6045 21 40
ID Description Score Start End Superfamily
af_P47140_80_304_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7334 29 71 3.90.190.10
af_K7VAH5_1_253_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6465 23 69 2.130.10.10
af_M9PAZ8_182_369_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.6256 21 45 2.130.10.30
6bz0A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6234 24 42 3.50.50.60
af_K7L296_1_116_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6206 24 71 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A2V8BTY7-F1-model_v4 DUF3467 domain-containing protein 0.7856 1 99
AF-A0A7X3QC05-F1-model_v4 DUF3467 domain-containing protein 0.7773 1 102
AF-A0A7X3QC05-F1-model_v4 DUF3467 domain-containing protein 0.7708 1 102
AF-A0A7Z9T9M2-F1-model_v4 DUF3467 domain-containing protein 0.7693 1 102
AF-A0A7Z9T9M2-F1-model_v4 DUF3467 domain-containing protein 0.7629 1 102

Map