F450898

General Info

Members Datasets Scaffolds Average Seq Length
472 208 944 156

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0562885|Ga0501036_0562885_348_863
Length 171
Sequence MAVAAAASTAGRSNPVVFLDTSVLLAGLIDFGPQSAPAQQIMLAVADRSLSAVTAWHCCLEVYSVATRLPPEYRVAPPDAARLLQDEVLARLGVHELPPGARAAFLAALVQDQIAGGRIYDAHIADVARAAGAAVIVTDNRRHFLAALRHAIRVETPGEFLAARRKRPPSP

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 3.39
Rhizosphere 95.55
Stem 0
Stem Tuber 0
Unclassified 35.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0562885 3300049572 Bacteria 947
2 MRS1b_contig_2181088 2162886011 Unclassified 968
3 JGI24746J21847_1001559 3300001977 Unclassified 3653
4 Ga0065712_10011148 3300005290 Bacteria 6654
5 Ga0065715_10001892 3300005293 Bacteria 5442
6 Ga0065715_10069229 3300005293 Bacteria 745
7 Ga0065715_10402785 3300005293 Unclassified 879
8 Ga0065707_10200417 3300005295 Unclassified 1313
9 Ga0070676_10011327 3300005328 Unclassified 4848
10 Ga0070690_100033305 3300005330 Bacteria 3224
11 Ga0070670_100167175 3300005331 Unclassified 1907
12 Ga0070670_100177410 3300005331 Bacteria 1849
13 Ga0070670_101038376 3300005331 Bacteria 746
14 Ga0070677_10002077 3300005333 Bacteria 6385
15 Ga0070677_10007847 3300005333 Bacteria 3571
16 Ga0070677_10093057 3300005333 Bacteria 1315
17 Ga0070677_10294359 3300005333 Unclassified 822
18 Ga0068869_100012636 3300005334 Bacteria 5585
19 Ga0068869_100028942 3300005334 Bacteria 3875
20 Ga0068869_100288414 3300005334 Bacteria 1322
21 Ga0068869_100383278 3300005334 Bacteria 1153
22 Ga0070666_10011839 3300005335 Bacteria 5485
23 Ga0070680_100368932 3300005336 Bacteria 1221
24 Ga0068868_100033445 3300005338 Bacteria 3963
25 Ga0070660_100859318 3300005339 Bacteria 764
26 Ga0070689_100078749 3300005340 Unclassified 2584
27 Ga0070689_100715184 3300005340 Unclassified 875
28 Ga0070687_100004378 3300005343 Bacteria 5622
29 Ga0070661_100192590 3300005344 Unclassified 1555
30 Ga0070692_10521451 3300005345 Bacteria 774
31 Ga0070668_100007845 3300005347 Bacteria 7926
32 Ga0070669_100010179 3300005353 Bacteria 6684
33 Ga0070669_100045300 3300005353 Bacteria 3205
34 Ga0070669_100076323 3300005353 Bacteria 2487
35 Ga0070669_100158162 3300005353 Bacteria 1759
36 Ga0070675_100000107 3300005354 Bacteria 48865
37 Ga0070675_100142674 3300005354 Unclassified 2048
38 Ga0070675_100149085 3300005354 Unclassified 2004
39 Ga0070674_100011505 3300005356 Bacteria 5391
40 Ga0070674_100068776 3300005356 Unclassified 2496
41 Ga0070674_100713890 3300005356 Bacteria 858
42 Ga0070673_100013955 3300005364 Bacteria 5579
43 Ga0070673_100105784 3300005364 Unclassified 2325
44 Ga0070688_100032430 3300005365 Unclassified 3149
45 Ga0070659_100015316 3300005366 Bacteria 5741
46 Ga0070667_100009997 3300005367 Bacteria 7861
47 Ga0070667_100686860 3300005367 Unclassified 946
48 Ga0070703_10036013 3300005406 Unclassified 1518
49 Ga0070703_10186259 3300005406 Bacteria 805
50 Ga0070701_10114362 3300005438 Unclassified 1512
51 Ga0070701_10413246 3300005438 Unclassified 858
52 Ga0070705_100038376 3300005440 Bacteria 2710
53 Ga0070700_100017381 3300005441 Bacteria 4111
54 Ga0070700_100215607 3300005441 Unclassified 1357
55 Ga0070694_100004521 3300005444 Bacteria 8362
56 Ga0070694_100018404 3300005444 Bacteria 4433
57 Ga0070694_100187107 3300005444 Bacteria 1535
58 Ga0070694_100363602 3300005444 Unclassified 1124
59 Ga0070694_100375488 3300005444 Bacteria 1107
60 Ga0070678_101287440 3300005456 Bacteria 680
61 Ga0070662_100056486 3300005457 Bacteria 2850
62 Ga0070662_100061510 3300005457 Unclassified 2741
63 Ga0070662_100229858 3300005457 Bacteria 1483
64 Ga0070662_100688637 3300005457 Bacteria 864
65 Ga0068867_100075564 3300005459 Unclassified 2528
66 Ga0068867_100225798 3300005459 Unclassified 1511
67 Ga0068867_100684587 3300005459 Unclassified 903
68 Ga0070685_10018702 3300005466 Unclassified 3730
69 Ga0070685_10275788 3300005466 Unclassified 1124
70 Ga0070706_100309329 3300005467 Bacteria 1474
71 Ga0070707_100204803 3300005468 Bacteria 1923
72 Ga0070707_101245896 3300005468 Unclassified 710
73 Ga0070698_100060474 3300005471 Unclassified 3823
74 Ga0070698_100326978 3300005471 Bacteria 1464
75 Ga0070698_101209707 3300005471 Unclassified 705
76 Ga0070699_100017501 3300005518 Bacteria 6151
77 Ga0070699_100025347 3300005518 Bacteria 5114
78 Ga0070699_100614233 3300005518 Bacteria 992
79 Ga0070697_100016591 3300005536 Bacteria 5794
80 Ga0070697_101378134 3300005536 Bacteria 629
81 Ga0070672_100004683 3300005543 Bacteria 8969
82 Ga0070672_100013614 3300005543 Bacteria 5750
83 Ga0070672_100068370 3300005543 Unclassified 2817
84 Ga0070686_100033738 3300005544 Bacteria 3147
85 Ga0070686_100054549 3300005544 Unclassified 2557
86 Ga0070686_100114234 3300005544 Unclassified 1845
87 Ga0070695_100000451 3300005545 Bacteria 21392
88 Ga0070695_100037685 3300005545 Bacteria 3048
89 Ga0070695_100055550 3300005545 Bacteria 2552
90 Ga0070696_100030608 3300005546 Plasmid 3686
91 Ga0070696_100089238 3300005546 Bacteria 2192
92 Ga0070696_100143452 3300005546 Unclassified 1747
93 Ga0070696_100149486 3300005546 Bacteria 1713
94 Ga0070696_100196356 3300005546 Unclassified 1504
95 Ga0070693_100021115 3300005547 Bacteria 3446
96 Ga0070693_100260386 3300005547 Bacteria 1153
97 Ga0070665_100066037 3300005548 Bacteria 3629
98 Ga0070704_100008310 3300005549 Bacteria 6218
99 Ga0070704_100046923 3300005549 Bacteria 3016
100 Ga0070704_100055896 3300005549 Bacteria 2800
101 Ga0070704_100261288 3300005549 Bacteria 1426
102 Ga0070704_100437515 3300005549 Unclassified 1123
103 Ga0070704_100666306 3300005549 Bacteria 920
104 Ga0070664_100002534 3300005564 Bacteria 14738
105 Ga0070664_100989874 3300005564 Unclassified 790
106 Ga0068854_100087739 3300005578 Bacteria 2308
107 Ga0068856_101075281 3300005614 Unclassified 822
108 Ga0070702_100252858 3300005615 Unclassified 1195
109 Ga0068852_100061196 3300005616 Bacteria 3271
110 Ga0068859_100103004 3300005617 Unclassified 2912
111 Ga0068859_100332200 3300005617 Unclassified 1614
112 Ga0068859_100449478 3300005617 Unclassified 1385
113 Ga0068859_100531276 3300005617 Unclassified 1271
114 Ga0068864_100002895 3300005618 Bacteria 14184
115 Ga0068864_100025702 3300005618 Bacteria 4962
116 Ga0068864_100127309 3300005618 Unclassified 2284
117 Ga0068864_100253022 3300005618 Unclassified 1636
118 Ga0068864_101763665 3300005618 Unclassified 624
119 Ga0068861_100012700 3300005719 Bacteria 5877
120 Ga0068851_10080801 3300005834 Unclassified 1697
121 Ga0068870_10018501 3300005840 Unclassified 3366
122 Ga0068870_10039028 3300005840 Unclassified 2455
123 Ga0068870_10729313 3300005840 Unclassified 686
124 Ga0068863_100043291 3300005841 Bacteria 4274
125 Ga0068858_100018182 3300005842 Bacteria 6583
126 Ga0068858_100061678 3300005842 Unclassified 3466
127 Ga0068858_101131569 3300005842 Unclassified 769
128 Ga0068858_101555351 3300005842 Bacteria 652
129 Ga0068860_100025269 3300005843 Bacteria 5732
130 Ga0068860_100051514 3300005843 Unclassified 3917
131 Ga0068860_100408117 3300005843 Bacteria 1345
132 Ga0068860_100846969 3300005843 Unclassified 929
133 Ga0068862_100002006 3300005844 Bacteria 18465
134 Ga0068862_100052012 3300005844 Bacteria 3504
135 Ga0068862_100075090 3300005844 Bacteria 2923
136 Ga0068862_100097141 3300005844 Bacteria 2571
137 Ga0068862_100377479 3300005844 Bacteria 1321
138 Ga0068862_100386645 3300005844 Unclassified 1306
139 Ga0081455_10045128 3300005937 Bacteria 3837
140 Ga0081539_10207035 3300005985 Bacteria 901
141 Ga0075364_10253303 3300006051 Bacteria 1196
142 Ga0070712_100431291 3300006175 Bacteria 1094
143 Ga0075367_10063903 3300006178 Bacteria 2201
144 Ga0097621_100264958 3300006237 Unclassified 1508
145 Ga0097621_100583848 3300006237 Unclassified 1020
146 Ga0068871_100372353 3300006358 Unclassified 1267
147 Ga0068871_101447953 3300006358 Unclassified 648
148 Ga0075428_100003607 3300006844 Bacteria 16969
149 Ga0075428_100010406 3300006844 Bacteria 10329
150 Ga0075428_100038580 3300006844 Bacteria 5257
151 Ga0075430_100000838 3300006846 Bacteria 24071
152 Ga0075430_100311761 3300006846 Bacteria 1301
153 Ga0075430_100417496 3300006846 Bacteria 1107
154 Ga0075430_100461544 3300006846 Unclassified 1048
155 Ga0075431_100001011 3300006847 Bacteria 25024
156 Ga0075431_100074874 3300006847 Bacteria 3494
157 Ga0075431_100132981 3300006847 Bacteria 2565
158 Ga0075431_100547919 3300006847 Unclassified 1144
159 Ga0075431_100696787 3300006847 Bacteria 994
160 Ga0075431_101420703 3300006847 Unclassified 653
161 Ga0075433_10004167 3300006852 Bacteria 11223
162 Ga0075433_10012401 3300006852 Bacteria 6884
163 Ga0075433_10035603 3300006852 Unclassified 4283
164 Ga0075433_10207814 3300006852 Unclassified 1740
165 Ga0075433_10208454 3300006852 Bacteria 1737
166 Ga0075433_10321139 3300006852 Unclassified 1370
167 Ga0075434_100000264 3300006871 Bacteria 37263
168 Ga0075434_100003927 3300006871 Bacteria 13319
169 Ga0075434_100006791 3300006871 Bacteria 10523
170 Ga0075434_100011961 3300006871 Bacteria 8208
171 Ga0075434_100074993 3300006871 Bacteria 3376
172 Ga0075434_100905550 3300006871 Bacteria 897
173 Ga0075429_100000674 3300006880 Bacteria 26483
174 Ga0075429_100126059 3300006880 Unclassified 2239
175 Ga0075429_100276278 3300006880 Bacteria 1471
176 Ga0075429_100305991 3300006880 Bacteria 1392
177 Ga0075429_100454392 3300006880 Bacteria 1122
178 Ga0075429_100526259 3300006880 Bacteria 1036
179 Ga0075429_100590413 3300006880 Unclassified 973
180 Ga0068865_100017492 3300006881 Bacteria 4611
181 Ga0068865_100374479 3300006881 Unclassified 1160
182 Ga0075436_100002643 3300006914 Bacteria 12329
183 Ga0075436_100007194 3300006914 Bacteria 7612
184 Ga0097620_100103003 3300006931 Unclassified 2912
185 Ga0097620_100332177 3300006931 Unclassified 1614
186 Ga0097620_100449439 3300006931 Unclassified 1385
187 Ga0097620_100531219 3300006931 Unclassified 1271
188 Ga0075435_100000163 3300007076 Bacteria 38632
189 Ga0075435_100002619 3300007076 Bacteria 11989
190 Ga0075435_100006613 3300007076 Bacteria 8208
191 Ga0075435_100060445 3300007076 Bacteria 3072
192 Ga0075435_100075577 3300007076 Bacteria 2759
193 Ga0075435_100307167 3300007076 Bacteria 1357
194 Ga0075435_100627080 3300007076 Unclassified 933
195 Ga0111539_10000324 3300009094 Bacteria 58406
196 Ga0111539_10040028 3300009094 Bacteria 5645
197 Ga0111539_10884397 3300009094 Unclassified 1039
198 Ga0111539_10918916 3300009094 Unclassified 1018
199 Ga0111539_12212258 3300009094 Bacteria 638
200 Ga0105245_10031303 3300009098 Bacteria 4708
201 Ga0105247_10001119 3300009101 Bacteria 19989
202 Ga0105247_10123744 3300009101 Unclassified 1679
203 Ga0114129_10006554 3300009147 Bacteria 16521
204 Ga0114129_10014145 3300009147 Bacteria 11369
205 Ga0114129_10014773 3300009147 Bacteria 11124
206 Ga0114129_10045158 3300009147 Bacteria 6194
207 Ga0114129_10054662 3300009147 Bacteria 5597
208 Ga0114129_10100582 3300009147 Bacteria 4001
209 Ga0114129_10132632 3300009147 Bacteria 3420
210 Ga0114129_10254133 3300009147 Unclassified 2358
211 Ga0114129_10260416 3300009147 Unclassified 2325
212 Ga0114129_10916121 3300009147 Bacteria 1110
213 Ga0114129_11166495 3300009147 Bacteria 961
214 Ga0114129_11388515 3300009147 Unclassified 867
215 Ga0105243_10408024 3300009148 Bacteria 1264
216 Ga0105242_10748146 3300009176 Unclassified 962
217 Ga0105248_10002081 3300009177 Bacteria 22128
218 Ga0105248_10875560 3300009177 Unclassified 1014
219 Ga0105238_10151051 3300009551 Bacteria 2298
220 Ga0105249_10001361 3300009553 Bacteria 21366
221 Ga0105249_10127515 3300009553 Unclassified 2425
222 Ga0105249_10361348 3300009553 Bacteria 1473
223 Ga0105239_10500896 3300010375 Bacteria 1381
224 Ga0105246_10128707 3300011119 Unclassified 1888
225 Ga0105246_11673314 3300011119 Bacteria 604
226 Ga0157374_10236993 3300013296 Unclassified 1794
227 Ga0157378_10439360 3300013297 Unclassified 1293
228 Ga0163162_10064876 3300013306 Unclassified 3698
229 Ga0157375_10062430 3300013308 Unclassified 3702
230 Ga0163163_10014771 3300014325 Bacteria 7186
231 Ga0163163_10466907 3300014325 Bacteria 1323
232 Ga0157380_10003773 3300014326 Bacteria 10418
233 Ga0157380_10165962 3300014326 Unclassified 1924
234 Ga0157380_10715433 3300014326 Bacteria 1008
235 Ga0157380_11230508 3300014326 Unclassified 793
236 Ga0157377_10146131 3300014745 Unclassified 1458
237 Ga0157377_10190893 3300014745 Unclassified 1294
238 Ga0157379_10120079 3300014968 Unclassified 2364
239 Ga0157376_10135464 3300014969 Unclassified 2203
240 Ga0207697_10000081 3300025315 Bacteria 42074
241 Ga0207656_10058677 3300025321 Unclassified 1682
242 Ga0207653_10177078 3300025885 Bacteria 796
243 Ga0207682_10000128 3300025893 Bacteria 34058
244 Ga0207682_10016679 3300025893 Bacteria 2866
245 Ga0207682_10089069 3300025893 Bacteria 1335
246 Ga0207682_10369600 3300025893 Unclassified 676
247 Ga0207710_10014691 3300025900 Bacteria 3305
248 Ga0207688_10002269 3300025901 Bacteria 10346
249 Ga0207688_10107842 3300025901 Bacteria 1614
250 Ga0207688_10154367 3300025901 Unclassified 1358
251 Ga0207688_10575526 3300025901 Bacteria 709
252 Ga0207680_10107839 3300025903 Bacteria 1801
253 Ga0207645_10001420 3300025907 Bacteria 19605
254 Ga0207645_10599628 3300025907 Bacteria 748
255 Ga0207643_10000867 3300025908 Bacteria 18219
256 Ga0207643_10020314 3300025908 Unclassified 3645
257 Ga0207643_10623235 3300025908 Unclassified 695
258 Ga0207660_10336117 3300025917 Bacteria 1208
259 Ga0207662_10000680 3300025918 Bacteria 15450
260 Ga0207662_10014612 3300025918 Unclassified 4408
261 Ga0207646_10045079 3300025922 Bacteria 3958
262 Ga0207681_10280228 3300025923 Unclassified 1312
263 Ga0207694_10176820 3300025924 Bacteria 1729
264 Ga0207650_10021026 3300025925 Unclassified 4610
265 Ga0207650_10063934 3300025925 Bacteria 2753
266 Ga0207650_10750440 3300025925 Bacteria 826
267 Ga0207650_10892609 3300025925 Bacteria 755
268 Ga0207659_10000925 3300025926 Bacteria 17486
269 Ga0207659_10020334 3300025926 Unclassified 4387
270 Ga0207659_10027477 3300025926 Bacteria 3853
271 Ga0207687_10321905 3300025927 Bacteria 1252
272 Ga0207644_10471064 3300025931 Unclassified 1033
273 Ga0207706_10000390 3300025933 Bacteria 47471
274 Ga0207706_10029501 3300025933 Bacteria 4897
275 Ga0207706_10037640 3300025933 Bacteria 4295
276 Ga0207706_10601387 3300025933 Unclassified 944
277 Ga0207706_10810778 3300025933 Unclassified 795
278 Ga0207670_10030253 3300025936 Unclassified 3458
279 Ga0207669_10002014 3300025937 Bacteria 8621
280 Ga0207669_10263490 3300025937 Unclassified 1290
281 Ga0207704_10401688 3300025938 Unclassified 1081
282 Ga0207704_10800377 3300025938 Bacteria 787
283 Ga0207691_10000697 3300025940 Bacteria 33255
284 Ga0207691_10002022 3300025940 Bacteria 19849
285 Ga0207691_10005657 3300025940 Bacteria 12085
286 Ga0207691_10027162 3300025940 Bacteria 5369
287 Ga0207691_10489613 3300025940 Bacteria 1045
288 Ga0207711_10041515 3300025941 Bacteria 3918
289 Ga0207711_10229488 3300025941 Unclassified 1700
290 Ga0207711_10453387 3300025941 Bacteria 1194
291 Ga0207689_10000944 3300025942 Bacteria 27922
292 Ga0207689_10183235 3300025942 Bacteria 1727
293 Ga0207679_10008375 3300025945 Bacteria 6586
294 Ga0207679_10270316 3300025945 Bacteria 1453
295 Ga0207667_11850238 3300025949 Bacteria 567
296 Ga0207651_10193921 3300025960 Unclassified 1622
297 Ga0207712_10020247 3300025961 Unclassified 4355
298 Ga0207668_10096073 3300025972 Unclassified 2189
299 Ga0207640_10198830 3300025981 Bacteria 1517
300 Ga0207658_10124395 3300025986 Bacteria 2061
301 Ga0207658_11127085 3300025986 Bacteria 717
302 Ga0207677_10263804 3300026023 Unclassified 1405
303 Ga0207677_10341157 3300026023 Unclassified 1252
304 Ga0207703_10017816 3300026035 Bacteria 5546
305 Ga0207703_10157225 3300026035 Bacteria 1988
306 Ga0207703_10184909 3300026035 Bacteria 1841
307 Ga0207703_10261485 3300026035 Bacteria 1564
308 Ga0207703_10284001 3300026035 Unclassified 1504
309 Ga0207703_11197778 3300026035 Unclassified 730
310 Ga0207678_11150856 3300026067 Unclassified 687
311 Ga0207708_10005261 3300026075 Bacteria 9528
312 Ga0207708_10034172 3300026075 Unclassified 3866
313 Ga0207641_10010314 3300026088 Bacteria 7680
314 Ga0207641_10620556 3300026088 Unclassified 1060
315 Ga0207648_10014799 3300026089 Bacteria 7198
316 Ga0207648_10021175 3300026089 Bacteria 5846
317 Ga0207648_10190828 3300026089 Bacteria 1815
318 Ga0207676_10006988 3300026095 Bacteria 8001
319 Ga0207676_10044604 3300026095 Unclassified 3422
320 Ga0207676_10320761 3300026095 Unclassified 1422
321 Ga0207676_10510891 3300026095 Bacteria 1142
322 Ga0207674_10198866 3300026116 Bacteria 1954
323 Ga0207675_100010563 3300026118 Bacteria 8650
324 Ga0207675_100100524 3300026118 Bacteria 2724
325 Ga0207675_100190859 3300026118 Bacteria 1965
326 Ga0207683_10011625 3300026121 Bacteria 7514
327 Ga0207683_10085994 3300026121 Unclassified 2795
328 Ga0207683_10150660 3300026121 Unclassified 2099
329 Ga0207698_10180103 3300026142 Bacteria 1871
330 Ga0210000_1031681 3300027462 Unclassified 828
331 Ga0207428_10000373 3300027907 Bacteria 57156
332 Ga0207428_10001229 3300027907 Bacteria 27466
333 Ga0268266_10052444 3300028379 Bacteria 3503
334 Ga0268265_10007664 3300028380 Bacteria 7286
335 Ga0268265_10042131 3300028380 Bacteria 3385
336 Ga0268265_10098961 3300028380 Bacteria 2350
337 Ga0268265_10133708 3300028380 Unclassified 2066
338 Ga0268265_10356092 3300028380 Bacteria 1338
339 Ga0268265_10712186 3300028380 Unclassified 971
340 Ga0268265_11521868 3300028380 Bacteria 673
341 Ga0268264_10042412 3300028381 Unclassified 3766
342 Ga0268264_10070578 3300028381 Bacteria 2957
343 Ga0307408_100330592 3300031548 Bacteria 1287
344 Ga0307408_100421263 3300031548 Unclassified 1151
345 Ga0307405_10533268 3300031731 Unclassified 947
346 Ga0307416_100466782 3300032002 Unclassified 1319
347 Ga0307416_100695633 3300032002 Unclassified 1105
348 Ga0307411_10198013 3300032005 Bacteria 1540
349 Ga0373928_0103808 3300035084 Unclassified 744
350 Ga0373932_0004756 3300035112 Bacteria 3204
351 Ga0373939_0036591 3300035114 Unclassified 1453
352 Ga0373941_0276163 3300035115 Unclassified 663
353 Ga0373962_0033276 3300035242 Unclassified 1422
354 Ga0373935_0625033 3300035692 Bacteria 789
355 Ga0373925_1152582 3300037068 Unclassified 637
356 Ga0439450_141530 3300042008 Bacteria 628
357 Ga0439456_083582 3300042013 Unclassified 714
358 Ga0439460_0065316 3300042461 Bacteria 1118
359 Ga0439460_0133248 3300042461 Bacteria 820
360 Ga0450916_017612 3300042530 Bacteria 956
361 Ga0451576_0007747 3300045051 Bacteria 12753
362 Ga0451576_0015733 3300045051 Bacteria 8374
363 Ga0451576_0061172 3300045051 Bacteria 3927
364 Ga0451576_0424765 3300045051 Bacteria 1395
365 Ga0495591_076226 3300046458 Bacteria 862
366 Ga0495584_0124219 3300046491 Bacteria 1307
367 Ga0495584_0397038 3300046491 Unclassified 701
368 Ga0495663_0052522 3300046525 Bacteria 1265
369 Ga0495587_0428540 3300046536 Bacteria 734
370 Ga0495598_0384616 3300046537 Unclassified 546
371 Ga0495609_0118449 3300046538 Bacteria 1140
372 Ga0495609_0149870 3300046538 Bacteria 992
373 Ga0495621_0030185 3300046539 Unclassified 1852
374 Ga0495621_0052711 3300046539 Unclassified 1459
375 Ga0495659_0039158 3300046664 Unclassified 1685
376 Ga0495659_0098792 3300046664 Bacteria 1128
377 Ga0495659_0408932 3300046664 Unclassified 586
378 Ga0495670_0191191 3300046691 Bacteria 1082
379 Ga0495636_0038077 3300047318 Unclassified 1988
380 Ga0495677_0066372 3300047445 Bacteria 1342
381 Ga0495677_0188779 3300047445 Unclassified 800
382 Ga0495685_054734 3300047447 Bacteria 1350
383 Ga0496100_0670546 3300048903 Unclassified 808
384 Ga0496101_1199138 3300048904 Unclassified 595
385 Ga0496102_0347280 3300048905 Unclassified 1397
386 Ga0496104_0009400 3300048907 Bacteria 8696
387 Ga0496106_0280804 3300048909 Bacteria 1334
388 Ga0496106_0566513 3300048909 Unclassified 911
389 Ga0496108_0045055 3300048911 Bacteria 3683
390 Ga0496108_0831833 3300048911 Unclassified 795
391 Ga0496109_0008736 3300048912 Bacteria 8625
392 Ga0496110_0081723 3300048913 Bacteria 2881
393 Ga0496110_0503578 3300048913 Unclassified 1102
394 Ga0496111_0651861 3300048914 Unclassified 768
395 Ga0496112_0001479 3300048915 Bacteria 18055
396 Ga0496112_0096959 3300048915 Bacteria 2919
397 Ga0496113_0505518 3300048916 Unclassified 970
398 Ga0496113_1084729 3300048916 Unclassified 628
399 Ga0501036_0104136 3300049572 Bacteria 2400
400 Ga0501040_0872966 3300049576 Bacteria 651
401 Ga0501043_0405629 3300049579 Bacteria 1029
402 Ga0501046_0213965 3300049580 Bacteria 1430
403 Ga0501071_0074532 3300049587 Bacteria 2477
404 Ga0501073_0988405 3300049589 Bacteria 579
405 Ga0501077_0650981 3300049593 Bacteria 677
406 Ga0501080_0208062 3300049742 Bacteria 1794
407 Ga0501081_0061102 3300049743 Bacteria 2612
408 Ga0501045_0206862 3300049824 Bacteria 1462
409 nmdc:mga00v17_264554_c1 3300050491 Bacteria 1116
410 nmdc:mga06z11_164160_c1 3300050494 Bacteria 1271
411 nmdc:mga07m45_14244_c1 3300050496 Bacteria 4232
412 nmdc:mga05p37_132938_c1 3300050507 Bacteria 3052
413 nmdc:mga05p37_1541994_c1 3300050507 Bacteria 659
414 nmdc:mga05p37_1742_c1 3300050507 Bacteria 25391
415 nmdc:mga05p37_297731_c1 3300050507 Bacteria 1918
416 nmdc:mga05p37_403192_c1 3300050507 Bacteria 1596
417 nmdc:mga05p37_55578_c1 3300050507 Bacteria 4872
418 nmdc:mga05p37_5621_c1 3300050507 Bacteria 14733
419 nmdc:mga05p37_637709_c1 3300050507 Bacteria 1196
420 nmdc:mga05p37_65201_c1 3300050507 Bacteria 4482
421 nmdc:mga05p37_79161_c1 3300050507 Bacteria 4047
422 nmdc:mga05p37_843464_c1 3300050507 Bacteria 996
423 nmdc:mga05p37_94222_c1 3300050507 Bacteria 3690
424 nmdc:mga09592_219_c1 3300050508 Bacteria 41151
425 nmdc:mga09592_2212_c1 3300050508 Bacteria 15656
426 nmdc:mga09592_276469_c1 3300050508 Bacteria 1457
427 nmdc:mga0qj67_1377192_c1 3300050509 Bacteria 545
428 nmdc:mga0qj67_214004_c1 3300050509 Bacteria 1565
429 nmdc:mga0qj67_324_c1 3300050509 Bacteria 32941
430 nmdc:mga0qj67_332244_c1 3300050509 Bacteria 1230
431 nmdc:mga0qj67_413533_c1 3300050509 Unclassified 1088
432 nmdc:mga06r32_1479383_c1 3300050510 Unclassified 620
433 nmdc:mga06r32_1546795_c1 3300050510 Bacteria 603
434 nmdc:mga06r32_208599_c1 3300050510 Bacteria 1942
435 nmdc:mga06r32_365694_c1 3300050510 Bacteria 1426
436 nmdc:mga06r32_6855_c1 3300050510 Bacteria 10240
437 nmdc:mga08y16_1224_c1 3300050511 Bacteria 25390
438 nmdc:mga08y16_1382214_c1 3300050511 Unclassified 668
439 nmdc:mga08y16_1698275_c1 3300050511 Unclassified 587
440 nmdc:mga08y16_534111_c1 3300050511 Bacteria 1188
441 nmdc:mga08y16_600_c1 3300050511 Bacteria 33622
442 nmdc:mga08y16_728516_c1 3300050511 Bacteria 989
443 nmdc:mga0n895_12_c1 3300050512 Bacteria 112043
444 nmdc:mga0n895_1342478_c1 3300050512 Bacteria 685
445 nmdc:mga0n895_1817_c1 3300050512 Bacteria 16242
446 nmdc:mga0n895_20264_c1 3300050512 Bacteria 6198
447 nmdc:mga0n895_2186235_c1 3300050512 Bacteria 509
448 nmdc:mga0n895_408376_c1 3300050512 Unclassified 1373
449 nmdc:mga0n895_473963_c1 3300050512 Bacteria 1263
450 nmdc:mga0n895_532467_c1 3300050512 Bacteria 1182
451 nmdc:mga0n895_726174_c1 3300050512 Bacteria 988
452 nmdc:mga0n895_75131_c1 3300050512 Bacteria 3359
453 nmdc:mga0rr50_11313_c1 3300050513 Bacteria 5706
454 nmdc:mga0rr50_139670_c1 3300050513 Bacteria 1948
455 nmdc:mga0rr50_180540_c1 3300050513 Unclassified 1725
456 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
457 nmdc:mga0rr50_2388_c1 3300050513 Bacteria 10559
458 nmdc:mga0rr50_746855_c1 3300050513 Unclassified 835
459 nmdc:mga0rr50_764554_c1 3300050513 Unclassified 824
460 nmdc:mga0rr50_95329_c1 3300050513 Unclassified 2326
461 nmdc:mga08x19_80578_c1 3300050514 Unclassified 2137
462 nmdc:mga08x19_87_c1 3300050514 Bacteria 83168
463 nmdc:mga0a205_14542_c1 3300050515 Bacteria 7343
464 nmdc:mga0a205_166_c1 3300050515 Bacteria 44087
465 nmdc:mga0a205_175750_c1 3300050515 Unclassified 2037
466 nmdc:mga0a205_323488_c1 3300050515 Unclassified 1413
467 nmdc:mga0a205_3683_c1 3300050515 Bacteria 13719
468 nmdc:mga0a205_382002_c1 3300050515 Bacteria 1274
469 nmdc:mga0a205_451219_c1 3300050515 Bacteria 1146
470 nmdc:mga0a205_4938_c1 3300050515 Bacteria 12000
471 nmdc:mga0a205_58788_c1 3300050515 Bacteria 3714
472 Ga0495619_0032743 3300053085 Bacteria 3374
473 Ga0501036_0562885
474 MRS1b_contig_2181088
475 JGI24746J21847_1001559
476 Ga0065712_10011148
477 Ga0065715_10001892
478 Ga0065715_10069229
479 Ga0065715_10402785
480 Ga0065707_10200417
481 Ga0070676_10011327
482 Ga0070690_100033305
483 Ga0070670_100167175
484 Ga0070670_100177410
485 Ga0070670_101038376
486 Ga0070677_10002077
487 Ga0070677_10007847
488 Ga0070677_10093057
489 Ga0070677_10294359
490 Ga0068869_100012636
491 Ga0068869_100028942
492 Ga0068869_100288414
493 Ga0068869_100383278
494 Ga0070666_10011839
495 Ga0070680_100368932
496 Ga0068868_100033445
497 Ga0070660_100859318
498 Ga0070689_100078749
499 Ga0070689_100715184
500 Ga0070687_100004378
501 Ga0070661_100192590
502 Ga0070692_10521451
503 Ga0070668_100007845
504 Ga0070669_100010179
505 Ga0070669_100045300
506 Ga0070669_100076323
507 Ga0070669_100158162
508 Ga0070675_100000107
509 Ga0070675_100142674
510 Ga0070675_100149085
511 Ga0070674_100011505
512 Ga0070674_100068776
513 Ga0070674_100713890
514 Ga0070673_100013955
515 Ga0070673_100105784
516 Ga0070688_100032430
517 Ga0070659_100015316
518 Ga0070667_100009997
519 Ga0070667_100686860
520 Ga0070703_10036013
521 Ga0070703_10186259
522 Ga0070701_10114362
523 Ga0070701_10413246
524 Ga0070705_100038376
525 Ga0070700_100017381
526 Ga0070700_100215607
527 Ga0070694_100004521
528 Ga0070694_100018404
529 Ga0070694_100187107
530 Ga0070694_100363602
531 Ga0070694_100375488
532 Ga0070678_101287440
533 Ga0070662_100056486
534 Ga0070662_100061510
535 Ga0070662_100229858
536 Ga0070662_100688637
537 Ga0068867_100075564
538 Ga0068867_100225798
539 Ga0068867_100684587
540 Ga0070685_10018702
541 Ga0070685_10275788
542 Ga0070706_100309329
543 Ga0070707_100204803
544 Ga0070707_101245896
545 Ga0070698_100060474
546 Ga0070698_100326978
547 Ga0070698_101209707
548 Ga0070699_100017501
549 Ga0070699_100025347
550 Ga0070699_100614233
551 Ga0070697_100016591
552 Ga0070697_101378134
553 Ga0070672_100004683
554 Ga0070672_100013614
555 Ga0070672_100068370
556 Ga0070686_100033738
557 Ga0070686_100054549
558 Ga0070686_100114234
559 Ga0070695_100000451
560 Ga0070695_100037685
561 Ga0070695_100055550
562 Ga0070696_100030608
563 Ga0070696_100089238
564 Ga0070696_100143452
565 Ga0070696_100149486
566 Ga0070696_100196356
567 Ga0070693_100021115
568 Ga0070693_100260386
569 Ga0070665_100066037
570 Ga0070704_100008310
571 Ga0070704_100046923
572 Ga0070704_100055896
573 Ga0070704_100261288
574 Ga0070704_100437515
575 Ga0070704_100666306
576 Ga0070664_100002534
577 Ga0070664_100989874
578 Ga0068854_100087739
579 Ga0068856_101075281
580 Ga0070702_100252858
581 Ga0068852_100061196
582 Ga0068859_100103004
583 Ga0068859_100332200
584 Ga0068859_100449478
585 Ga0068859_100531276
586 Ga0068864_100002895
587 Ga0068864_100025702
588 Ga0068864_100127309
589 Ga0068864_100253022
590 Ga0068864_101763665
591 Ga0068861_100012700
592 Ga0068851_10080801
593 Ga0068870_10018501
594 Ga0068870_10039028
595 Ga0068870_10729313
596 Ga0068863_100043291
597 Ga0068858_100018182
598 Ga0068858_100061678
599 Ga0068858_101131569
600 Ga0068858_101555351
601 Ga0068860_100025269
602 Ga0068860_100051514
603 Ga0068860_100408117
604 Ga0068860_100846969
605 Ga0068862_100002006
606 Ga0068862_100052012
607 Ga0068862_100075090
608 Ga0068862_100097141
609 Ga0068862_100377479
610 Ga0068862_100386645
611 Ga0081455_10045128
612 Ga0081539_10207035
613 Ga0075364_10253303
614 Ga0070712_100431291
615 Ga0075367_10063903
616 Ga0097621_100264958
617 Ga0097621_100583848
618 Ga0068871_100372353
619 Ga0068871_101447953
620 Ga0075428_100003607
621 Ga0075428_100010406
622 Ga0075428_100038580
623 Ga0075430_100000838
624 Ga0075430_100311761
625 Ga0075430_100417496
626 Ga0075430_100461544
627 Ga0075431_100001011
628 Ga0075431_100074874
629 Ga0075431_100132981
630 Ga0075431_100547919
631 Ga0075431_100696787
632 Ga0075431_101420703
633 Ga0075433_10004167
634 Ga0075433_10012401
635 Ga0075433_10035603
636 Ga0075433_10207814
637 Ga0075433_10208454
638 Ga0075433_10321139
639 Ga0075434_100000264
640 Ga0075434_100003927
641 Ga0075434_100006791
642 Ga0075434_100011961
643 Ga0075434_100074993
644 Ga0075434_100905550
645 Ga0075429_100000674
646 Ga0075429_100126059
647 Ga0075429_100276278
648 Ga0075429_100305991
649 Ga0075429_100454392
650 Ga0075429_100526259
651 Ga0075429_100590413
652 Ga0068865_100017492
653 Ga0068865_100374479
654 Ga0075436_100002643
655 Ga0075436_100007194
656 Ga0097620_100103003
657 Ga0097620_100332177
658 Ga0097620_100449439
659 Ga0097620_100531219
660 Ga0075435_100000163
661 Ga0075435_100002619
662 Ga0075435_100006613
663 Ga0075435_100060445
664 Ga0075435_100075577
665 Ga0075435_100307167
666 Ga0075435_100627080
667 Ga0111539_10000324
668 Ga0111539_10040028
669 Ga0111539_10884397
670 Ga0111539_10918916
671 Ga0111539_12212258
672 Ga0105245_10031303
673 Ga0105247_10001119
674 Ga0105247_10123744
675 Ga0114129_10006554
676 Ga0114129_10014145
677 Ga0114129_10014773
678 Ga0114129_10045158
679 Ga0114129_10054662
680 Ga0114129_10100582
681 Ga0114129_10132632
682 Ga0114129_10254133
683 Ga0114129_10260416
684 Ga0114129_10916121
685 Ga0114129_11166495
686 Ga0114129_11388515
687 Ga0105243_10408024
688 Ga0105242_10748146
689 Ga0105248_10002081
690 Ga0105248_10875560
691 Ga0105238_10151051
692 Ga0105249_10001361
693 Ga0105249_10127515
694 Ga0105249_10361348
695 Ga0105239_10500896
696 Ga0105246_10128707
697 Ga0105246_11673314
698 Ga0157374_10236993
699 Ga0157378_10439360
700 Ga0163162_10064876
701 Ga0157375_10062430
702 Ga0163163_10014771
703 Ga0163163_10466907
704 Ga0157380_10003773
705 Ga0157380_10165962
706 Ga0157380_10715433
707 Ga0157380_11230508
708 Ga0157377_10146131
709 Ga0157377_10190893
710 Ga0157379_10120079
711 Ga0157376_10135464
712 Ga0207697_10000081
713 Ga0207656_10058677
714 Ga0207653_10177078
715 Ga0207682_10000128
716 Ga0207682_10016679
717 Ga0207682_10089069
718 Ga0207682_10369600
719 Ga0207710_10014691
720 Ga0207688_10002269
721 Ga0207688_10107842
722 Ga0207688_10154367
723 Ga0207688_10575526
724 Ga0207680_10107839
725 Ga0207645_10001420
726 Ga0207645_10599628
727 Ga0207643_10000867
728 Ga0207643_10020314
729 Ga0207643_10623235
730 Ga0207660_10336117
731 Ga0207662_10000680
732 Ga0207662_10014612
733 Ga0207646_10045079
734 Ga0207681_10280228
735 Ga0207694_10176820
736 Ga0207650_10021026
737 Ga0207650_10063934
738 Ga0207650_10750440
739 Ga0207650_10892609
740 Ga0207659_10000925
741 Ga0207659_10020334
742 Ga0207659_10027477
743 Ga0207687_10321905
744 Ga0207644_10471064
745 Ga0207706_10000390
746 Ga0207706_10029501
747 Ga0207706_10037640
748 Ga0207706_10601387
749 Ga0207706_10810778
750 Ga0207670_10030253
751 Ga0207669_10002014
752 Ga0207669_10263490
753 Ga0207704_10401688
754 Ga0207704_10800377
755 Ga0207691_10000697
756 Ga0207691_10002022
757 Ga0207691_10005657
758 Ga0207691_10027162
759 Ga0207691_10489613
760 Ga0207711_10041515
761 Ga0207711_10229488
762 Ga0207711_10453387
763 Ga0207689_10000944
764 Ga0207689_10183235
765 Ga0207679_10008375
766 Ga0207679_10270316
767 Ga0207667_11850238
768 Ga0207651_10193921
769 Ga0207712_10020247
770 Ga0207668_10096073
771 Ga0207640_10198830
772 Ga0207658_10124395
773 Ga0207658_11127085
774 Ga0207677_10263804
775 Ga0207677_10341157
776 Ga0207703_10017816
777 Ga0207703_10157225
778 Ga0207703_10184909
779 Ga0207703_10261485
780 Ga0207703_10284001
781 Ga0207703_11197778
782 Ga0207678_11150856
783 Ga0207708_10005261
784 Ga0207708_10034172
785 Ga0207641_10010314
786 Ga0207641_10620556
787 Ga0207648_10014799
788 Ga0207648_10021175
789 Ga0207648_10190828
790 Ga0207676_10006988
791 Ga0207676_10044604
792 Ga0207676_10320761
793 Ga0207676_10510891
794 Ga0207674_10198866
795 Ga0207675_100010563
796 Ga0207675_100100524
797 Ga0207675_100190859
798 Ga0207683_10011625
799 Ga0207683_10085994
800 Ga0207683_10150660
801 Ga0207698_10180103
802 Ga0210000_1031681
803 Ga0207428_10000373
804 Ga0207428_10001229
805 Ga0268266_10052444
806 Ga0268265_10007664
807 Ga0268265_10042131
808 Ga0268265_10098961
809 Ga0268265_10133708
810 Ga0268265_10356092
811 Ga0268265_10712186
812 Ga0268265_11521868
813 Ga0268264_10042412
814 Ga0268264_10070578
815 Ga0307408_100330592
816 Ga0307408_100421263
817 Ga0307405_10533268
818 Ga0307416_100466782
819 Ga0307416_100695633
820 Ga0307411_10198013
821 Ga0373928_0103808
822 Ga0373932_0004756
823 Ga0373939_0036591
824 Ga0373941_0276163
825 Ga0373962_0033276
826 Ga0373935_0625033
827 Ga0373925_1152582
828 Ga0439450_141530
829 Ga0439456_083582
830 Ga0439460_0065316
831 Ga0439460_0133248
832 Ga0450916_017612
833 Ga0451576_0007747
834 Ga0451576_0015733
835 Ga0451576_0061172
836 Ga0451576_0424765
837 Ga0495591_076226
838 Ga0495584_0124219
839 Ga0495584_0397038
840 Ga0495663_0052522
841 Ga0495587_0428540
842 Ga0495598_0384616
843 Ga0495609_0118449
844 Ga0495609_0149870
845 Ga0495621_0030185
846 Ga0495621_0052711
847 Ga0495659_0039158
848 Ga0495659_0098792
849 Ga0495659_0408932
850 Ga0495670_0191191
851 Ga0495636_0038077
852 Ga0495677_0066372
853 Ga0495677_0188779
854 Ga0495685_054734
855 Ga0496100_0670546
856 Ga0496101_1199138
857 Ga0496102_0347280
858 Ga0496104_0009400
859 Ga0496106_0280804
860 Ga0496106_0566513
861 Ga0496108_0045055
862 Ga0496108_0831833
863 Ga0496109_0008736
864 Ga0496110_0081723
865 Ga0496110_0503578
866 Ga0496111_0651861
867 Ga0496112_0001479
868 Ga0496112_0096959
869 Ga0496113_0505518
870 Ga0496113_1084729
871 Ga0501036_0104136
872 Ga0501040_0872966
873 Ga0501043_0405629
874 Ga0501046_0213965
875 Ga0501071_0074532
876 Ga0501073_0988405
877 Ga0501077_0650981
878 Ga0501080_0208062
879 Ga0501081_0061102
880 Ga0501045_0206862
881 nmdc:mga00v17_264554_c1
882 nmdc:mga06z11_164160_c1
883 nmdc:mga07m45_14244_c1
884 nmdc:mga05p37_132938_c1
885 nmdc:mga05p37_1541994_c1
886 nmdc:mga05p37_1742_c1
887 nmdc:mga05p37_297731_c1
888 nmdc:mga05p37_403192_c1
889 nmdc:mga05p37_55578_c1
890 nmdc:mga05p37_5621_c1
891 nmdc:mga05p37_637709_c1
892 nmdc:mga05p37_65201_c1
893 nmdc:mga05p37_79161_c1
894 nmdc:mga05p37_843464_c1
895 nmdc:mga05p37_94222_c1
896 nmdc:mga09592_219_c1
897 nmdc:mga09592_2212_c1
898 nmdc:mga09592_276469_c1
899 nmdc:mga0qj67_1377192_c1
900 nmdc:mga0qj67_214004_c1
901 nmdc:mga0qj67_324_c1
902 nmdc:mga0qj67_332244_c1
903 nmdc:mga0qj67_413533_c1
904 nmdc:mga06r32_1479383_c1
905 nmdc:mga06r32_1546795_c1
906 nmdc:mga06r32_208599_c1
907 nmdc:mga06r32_365694_c1
908 nmdc:mga06r32_6855_c1
909 nmdc:mga08y16_1224_c1
910 nmdc:mga08y16_1382214_c1
911 nmdc:mga08y16_1698275_c1
912 nmdc:mga08y16_534111_c1
913 nmdc:mga08y16_600_c1
914 nmdc:mga08y16_728516_c1
915 nmdc:mga0n895_12_c1
916 nmdc:mga0n895_1342478_c1
917 nmdc:mga0n895_1817_c1
918 nmdc:mga0n895_20264_c1
919 nmdc:mga0n895_2186235_c1
920 nmdc:mga0n895_408376_c1
921 nmdc:mga0n895_473963_c1
922 nmdc:mga0n895_532467_c1
923 nmdc:mga0n895_726174_c1
924 nmdc:mga0n895_75131_c1
925 nmdc:mga0rr50_11313_c1
926 nmdc:mga0rr50_139670_c1
927 nmdc:mga0rr50_180540_c1
928 nmdc:mga0rr50_1_c1
929 nmdc:mga0rr50_2388_c1
930 nmdc:mga0rr50_746855_c1
931 nmdc:mga0rr50_764554_c1
932 nmdc:mga0rr50_95329_c1
933 nmdc:mga08x19_80578_c1
934 nmdc:mga08x19_87_c1
935 nmdc:mga0a205_14542_c1
936 nmdc:mga0a205_166_c1
937 nmdc:mga0a205_175750_c1
938 nmdc:mga0a205_323488_c1
939 nmdc:mga0a205_3683_c1
940 nmdc:mga0a205_382002_c1
941 nmdc:mga0a205_451219_c1
942 nmdc:mga0a205_4938_c1
943 nmdc:mga0a205_58788_c1
944 Ga0495619_0032743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

17

149

0.76

PF13470

PIN_3

PIN domain

16

142

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0a-assembly1.cif.gz_D cryo-em structure of human tric-npp state 0.6539 105 144
8dzj-assembly1.cif.gz_A cryo-em structure of acidibacillus sulfuroxidans cas12f in complex with sgrna and target dna 0.5854 85 143
3cw8-assembly1.cif.gz_X 4-chlorobenzoyl-coa ligase/synthetase, bound to 4cba-adenylate 0.5448 90 143
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.5399 1 122
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.5329 1 122
ID Description Score Start End Superfamily
af_Q5XIY8_665_753_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.682 120 155 3.40.50.10190
af_A0A1D6MWB7_118_238_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6507 107 141 3.40.50.150
4ieeA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.6317 105 143 3.30.420.240
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.597 103 141 3.40.50.2300
af_A0A1D6J965_162_204_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5808 110 144 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2H2Y0R7-F1-model_v4 deleted 0.9344 107 153
AF-A0A2N9NVR2-F1-model_v4 PIN domain-containing protein 0.9282 106 155
AF-Q01SS3-F1-model_v4 PIN domain-containing protein 0.928 107 155
AF-A0A1Z4NN12-F1-model_v4 PilT protein domain protein 0.9017 107 153
AF-A0A2V8HWG9-F1-model_v4 PIN domain-containing protein 0.9004 79 155

Map