F450844

General Info

Members Datasets Scaffolds Average Seq Length
472 200 944 211

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0482115|Ga0373937_0482115_437_1138
Length 233
Sequence MTTRRSQMMIMHRPLYWGAAFLLLASGALVAASQSTAKLPADLDPDSHARVPYLQRKDLDARGQKIYDTLPGRSAEGVLRGPLAFAAYNPAVAQALFDLHNAAVQEGTLDPHARELAILVACRETNYSLEWNAHEASALKAGVDPKVIDAVRHSRALTGVDDKDALVIRFGRQMLRDRNMDSATFAKAVELFGRRGAMDMVAVMSTYAVSGLFAIAVDEHMPAGRPELERIAR

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 2.54
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 21.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0482115 3300036401 Bacteria 1178
2 JGI24746J21847_1005887 3300001977 Bacteria 1906
3 Ga0065714_10236806 3300005288 Unclassified 804
4 Ga0065712_10088375 3300005290 Unclassified 2524
5 Ga0065707_10117702 3300005295 Bacteria 2205
6 Ga0065707_10157868 3300005295 Bacteria 1591
7 Ga0070658_10220068 3300005327 Bacteria 1605
8 Ga0070676_10097878 3300005328 Bacteria 1808
9 Ga0070676_10104664 3300005328 Bacteria 1754
10 Ga0070676_10294652 3300005328 Bacteria 1098
11 Ga0070683_100398442 3300005329 Bacteria 1312
12 Ga0070690_100051648 3300005330 Bacteria 2625
13 Ga0070690_100057425 3300005330 Bacteria 2498
14 Ga0070690_100394144 3300005330 Bacteria 1015
15 Ga0070670_100003224 3300005331 Bacteria 13470
16 Ga0070670_100033138 3300005331 Bacteria 4449
17 Ga0070677_10032736 3300005333 Bacteria 1997
18 Ga0070677_10039232 3300005333 Bacteria 1857
19 Ga0070677_10093008 3300005333 Unclassified 1315
20 Ga0068869_100005684 3300005334 Bacteria 7865
21 Ga0068869_100032433 3300005334 Bacteria 3681
22 Ga0068869_100047507 3300005334 Bacteria 3100
23 Ga0070666_10003973 3300005335 Bacteria 8970
24 Ga0070666_10012290 3300005335 Bacteria 5395
25 Ga0070666_10086232 3300005335 Bacteria 2151
26 Ga0070666_10468545 3300005335 Bacteria 911
27 Ga0070680_100169407 3300005336 Unclassified 1837
28 Ga0070680_100260450 3300005336 Bacteria 1467
29 Ga0068868_100014502 3300005338 Bacteria 5809
30 Ga0068868_100791894 3300005338 Bacteria 855
31 Ga0070689_100030882 3300005340 Bacteria 4068
32 Ga0070689_100128547 3300005340 Bacteria 2030
33 Ga0070687_100072679 3300005343 Bacteria 1852
34 Ga0070661_100056046 3300005344 Bacteria 2886
35 Ga0070661_100090583 3300005344 Bacteria 2265
36 Ga0070692_10417969 3300005345 Bacteria 851
37 Ga0070668_100044388 3300005347 Bacteria 3410
38 Ga0070668_100362106 3300005347 Unclassified 1230
39 Ga0070668_100836107 3300005347 Bacteria 820
40 Ga0070669_100004616 3300005353 Bacteria 9940
41 Ga0070669_100038115 3300005353 Bacteria 3489
42 Ga0070669_100098246 3300005353 Unclassified 2205
43 Ga0070669_100122771 3300005353 Unclassified 1984
44 Ga0070669_100194699 3300005353 Unclassified 1592
45 Ga0070675_100030478 3300005354 Bacteria 4355
46 Ga0070675_100050542 3300005354 Bacteria 3413
47 Ga0070675_100068388 3300005354 Bacteria 2941
48 Ga0070675_100228119 3300005354 Bacteria 1624
49 Ga0070675_100475157 3300005354 Bacteria 1124
50 Ga0070675_100581626 3300005354 Bacteria 1015
51 Ga0070671_100094029 3300005355 Bacteria 2512
52 Ga0070671_100595839 3300005355 Bacteria 955
53 Ga0070674_100009570 3300005356 Bacteria 5805
54 Ga0070674_100053637 3300005356 Bacteria 2785
55 Ga0070674_100081510 3300005356 Bacteria 2312
56 Ga0070674_100350572 3300005356 Unclassified 1192
57 Ga0070673_100022128 3300005364 Bacteria 4623
58 Ga0070673_100204036 3300005364 Bacteria 1704
59 Ga0070673_100209242 3300005364 Bacteria 1684
60 Ga0070673_100420718 3300005364 Bacteria 1198
61 Ga0070688_100003798 3300005365 Bacteria 7828
62 Ga0070688_100041955 3300005365 Bacteria 2812
63 Ga0070688_100644675 3300005365 Bacteria 815
64 Ga0070667_100008209 3300005367 Bacteria 8655
65 Ga0070667_100080351 3300005367 Bacteria 2789
66 Ga0070701_10033018 3300005438 Bacteria 2583
67 Ga0070701_10151500 3300005438 Bacteria 1336
68 Ga0070705_100256132 3300005440 Bacteria 1231
69 Ga0070700_100014745 3300005441 Bacteria 4417
70 Ga0070700_100039160 3300005441 Bacteria 2894
71 Ga0070700_100869205 3300005441 Bacteria 732
72 Ga0070694_100170609 3300005444 Bacteria 1602
73 Ga0070678_100066020 3300005456 Bacteria 2689
74 Ga0070678_100160139 3300005456 Unclassified 1822
75 Ga0070678_100199053 3300005456 Unclassified 1652
76 Ga0070678_100261636 3300005456 Bacteria 1455
77 Ga0070678_100533423 3300005456 Bacteria 1040
78 Ga0070662_100014714 3300005457 Bacteria 5229
79 Ga0070662_100295618 3300005457 Bacteria 1314
80 Ga0070662_100381786 3300005457 Unclassified 1160
81 Ga0070662_100514237 3300005457 Unclassified 1000
82 Ga0070681_10000457 3300005458 Bacteria 33462
83 Ga0070681_10111437 3300005458 Bacteria 2675
84 Ga0068867_100008173 3300005459 Bacteria 7391
85 Ga0068867_100038283 3300005459 Bacteria 3491
86 Ga0068867_100287801 3300005459 Bacteria 1350
87 Ga0068867_100319040 3300005459 Unclassified 1287
88 Ga0068867_100559365 3300005459 Unclassified 992
89 Ga0070685_10037118 3300005466 Bacteria 2758
90 Ga0070685_10105932 3300005466 Bacteria 1724
91 Ga0070707_100580474 3300005468 Bacteria 1083
92 Ga0070698_100115259 3300005471 Bacteria 2652
93 Ga0070698_100294798 3300005471 Bacteria 1553
94 Ga0070679_100006598 3300005530 Bacteria 10814
95 Ga0070679_100203431 3300005530 Bacteria 1945
96 Ga0068853_100001835 3300005539 Bacteria 15608
97 Ga0070672_100024118 3300005543 Bacteria 4489
98 Ga0070672_100050203 3300005543 Bacteria 3248
99 Ga0070672_100483508 3300005543 Bacteria 1069
100 Ga0070672_100556136 3300005543 Bacteria 996
101 Ga0070686_100002942 3300005544 Bacteria 9351
102 Ga0070686_100120731 3300005544 Bacteria 1799
103 Ga0070686_100957019 3300005544 Unclassified 700
104 Ga0070696_100069569 3300005546 Bacteria 2474
105 Ga0070696_100655746 3300005546 Unclassified 851
106 Ga0070665_100080375 3300005548 Bacteria 3265
107 Ga0070664_100085304 3300005564 Bacteria 2727
108 Ga0068857_100065634 3300005577 Unclassified 3228
109 Ga0068857_100973354 3300005577 Unclassified 816
110 Ga0068854_100034334 3300005578 Bacteria 3542
111 Ga0068854_100448910 3300005578 Bacteria 1077
112 Ga0068859_100000580 3300005617 Bacteria 36483
113 Ga0068859_100045961 3300005617 Unclassified 4386
114 Ga0068859_100649146 3300005617 Unclassified 1147
115 Ga0068864_100057468 3300005618 Bacteria 3361
116 Ga0068864_100138933 3300005618 Unclassified 2190
117 Ga0068866_10085751 3300005718 Bacteria 1703
118 Ga0068866_10388781 3300005718 Unclassified 897
119 Ga0068861_100038785 3300005719 Bacteria 3552
120 Ga0068861_100234904 3300005719 Bacteria 1557
121 Ga0068861_100615192 3300005719 Unclassified 999
122 Ga0068861_100989153 3300005719 Unclassified 802
123 Ga0068851_10028628 3300005834 Unclassified 2753
124 Ga0068870_10020476 3300005840 Bacteria 3222
125 Ga0068870_10023614 3300005840 Unclassified 3034
126 Ga0068870_10075973 3300005840 Bacteria 1844
127 Ga0068870_10267319 3300005840 Bacteria 1067
128 Ga0068870_10280306 3300005840 Bacteria 1045
129 Ga0068870_10366236 3300005840 Unclassified 929
130 Ga0068863_100042810 3300005841 Bacteria 4302
131 Ga0068863_100087255 3300005841 Bacteria 2956
132 Ga0068863_100210429 3300005841 Bacteria 1873
133 Ga0068858_100028289 3300005842 Bacteria 5208
134 Ga0068858_100043561 3300005842 Bacteria 4161
135 Ga0068858_100045869 3300005842 Bacteria 4052
136 Ga0068858_100203199 3300005842 Bacteria 1874
137 Ga0068858_100392951 3300005842 Bacteria 1332
138 Ga0068860_100005752 3300005843 Bacteria 12507
139 Ga0068860_100010654 3300005843 Bacteria 9078
140 Ga0068860_100224597 3300005843 Unclassified 1824
141 Ga0068860_100248439 3300005843 Bacteria 1732
142 Ga0068862_100047474 3300005844 Bacteria 3665
143 Ga0068862_100061762 3300005844 Bacteria 3221
144 Ga0068862_100246431 3300005844 Bacteria 1627
145 Ga0068862_100265952 3300005844 Unclassified 1567
146 Ga0081539_10033573 3300005985 Unclassified 3121
147 Ga0081539_10125385 3300005985 Unclassified 1269
148 Ga0097621_100010183 3300006237 Bacteria 6864
149 Ga0097621_100068834 3300006237 Unclassified 2921
150 Ga0097621_100094201 3300006237 Bacteria 2510
151 Ga0097621_100158197 3300006237 Bacteria 1946
152 Ga0097621_100404358 3300006237 Unclassified 1223
153 Ga0097621_100455549 3300006237 Bacteria 1153
154 Ga0068871_100002665 3300006358 Bacteria 12192
155 Ga0068871_100025719 3300006358 Bacteria 4583
156 Ga0068871_100180894 3300006358 Bacteria 1812
157 Ga0068871_100332225 3300006358 Bacteria 1341
158 Ga0068871_100560057 3300006358 Unclassified 1036
159 Ga0075428_100006820 3300006844 Bacteria 12702
160 Ga0075428_100093552 3300006844 Bacteria 3277
161 Ga0075428_100543563 3300006844 Bacteria 1242
162 Ga0075430_100038218 3300006846 Bacteria 4067
163 Ga0075430_100146063 3300006846 Unclassified 1970
164 Ga0075431_100637329 3300006847 Unclassified 1047
165 Ga0075433_10000460 3300006852 Bacteria 26456
166 Ga0075433_10002304 3300006852 Bacteria 14537
167 Ga0075434_100003682 3300006871 Bacteria 13693
168 Ga0075434_100012919 3300006871 Bacteria 7932
169 Ga0075434_100693118 3300006871 Unclassified 1036
170 Ga0075429_100020030 3300006880 Bacteria 5800
171 Ga0075429_100031069 3300006880 Bacteria 4642
172 Ga0075429_100535928 3300006880 Bacteria 1026
173 Ga0068865_100005988 3300006881 Bacteria 7408
174 Ga0068865_100057308 3300006881 Bacteria 2717
175 Ga0068865_100145005 3300006881 Bacteria 1795
176 Ga0068865_100519516 3300006881 Bacteria 995
177 Ga0097620_100000580 3300006931 Bacteria 36483
178 Ga0097620_100045959 3300006931 Unclassified 4386
179 Ga0097620_100649263 3300006931 Unclassified 1147
180 Ga0075435_100039406 3300007076 Unclassified 3770
181 Ga0075435_100088424 3300007076 Bacteria 2553
182 Ga0075435_100521413 3300007076 Bacteria 1028
183 Ga0105240_10017379 3300009093 Bacteria 9696
184 Ga0111539_10000151 3300009094 Bacteria 79134
185 Ga0111539_10000810 3300009094 Bacteria 40595
186 Ga0111539_10002719 3300009094 Bacteria 23469
187 Ga0111539_10295426 3300009094 Bacteria 1885
188 Ga0105245_10008455 3300009098 Bacteria 8986
189 Ga0105245_10031978 3300009098 Bacteria 4658
190 Ga0105245_10044601 3300009098 Bacteria 3958
191 Ga0105247_10039815 3300009101 Bacteria 2872
192 Ga0105247_10123039 3300009101 Unclassified 1683
193 Ga0105247_10284397 3300009101 Unclassified 1142
194 Ga0114129_10040182 3300009147 Bacteria 6595
195 Ga0114129_10096941 3300009147 Bacteria 4082
196 Ga0114129_10583927 3300009147 Bacteria 1450
197 Ga0114129_11694752 3300009147 Bacteria 771
198 Ga0105243_10015829 3300009148 Bacteria 5705
199 Ga0105243_10204623 3300009148 Bacteria 1734
200 Ga0105243_10694294 3300009148 Unclassified 991
201 Ga0105241_10009085 3300009174 Bacteria 7313
202 Ga0105242_10015852 3300009176 Bacteria 5855
203 Ga0105242_10040355 3300009176 Bacteria 3762
204 Ga0105242_10050119 3300009176 Bacteria 3399
205 Ga0105248_10007062 3300009177 Bacteria 12301
206 Ga0105248_10011887 3300009177 Bacteria 9604
207 Ga0105248_10092272 3300009177 Bacteria 3410
208 Ga0105248_10122601 3300009177 Unclassified 2932
209 Ga0105248_10268840 3300009177 Bacteria 1920
210 Ga0105248_10349997 3300009177 Bacteria 1663
211 Ga0105248_10492757 3300009177 Unclassified 1381
212 Ga0105238_10009581 3300009551 Bacteria 9690
213 Ga0105238_10032203 3300009551 Bacteria 5335
214 Ga0105238_10322473 3300009551 Bacteria 1531
215 Ga0105249_10088187 3300009553 Bacteria 2897
216 Ga0105239_10010656 3300010375 Bacteria 10282
217 Ga0105246_10080635 3300011119 Bacteria 2317
218 Ga0105246_10405547 3300011119 Unclassified 1133
219 Ga0157371_10076664 3300013102 Bacteria 2367
220 Ga0157370_10020303 3300013104 Bacteria 6635
221 Ga0157369_10006278 3300013105 Bacteria 13798
222 Ga0157369_10014855 3300013105 Bacteria 8788
223 Ga0157374_10026139 3300013296 Bacteria 5250
224 Ga0157378_10445631 3300013297 Unclassified 1284
225 Ga0157378_10500365 3300013297 Bacteria 1214
226 Ga0163162_10010532 3300013306 Bacteria 8992
227 Ga0163162_10093960 3300013306 Bacteria 3084
228 Ga0163162_10200022 3300013306 Bacteria 2127
229 Ga0157372_10013849 3300013307 Bacteria 8611
230 Ga0157372_10085649 3300013307 Bacteria 3575
231 Ga0157372_10647475 3300013307 Bacteria 1231
232 Ga0157372_11170424 3300013307 Bacteria 889
233 Ga0157375_10048063 3300013308 Bacteria 4171
234 Ga0157375_10127193 3300013308 Bacteria 2664
235 Ga0157375_10333746 3300013308 Bacteria 1681
236 Ga0157375_10385663 3300013308 Bacteria 1568
237 Ga0157375_11008935 3300013308 Bacteria 972
238 Ga0157375_11538779 3300013308 Unclassified 785
239 Ga0163163_10008254 3300014325 Bacteria 9244
240 Ga0163163_10017363 3300014325 Bacteria 6711
241 Ga0163163_10022330 3300014325 Bacteria 5988
242 Ga0163163_10048425 3300014325 Unclassified 4179
243 Ga0163163_10099117 3300014325 Unclassified 2935
244 Ga0163163_10175182 3300014325 Unclassified 2191
245 Ga0163163_11379952 3300014325 Bacteria 766
246 Ga0157380_10027274 3300014326 Bacteria 4343
247 Ga0157380_10057582 3300014326 Bacteria 3095
248 Ga0157380_10148472 3300014326 Bacteria 2023
249 Ga0157380_10264122 3300014326 Bacteria 1565
250 Ga0157380_10551971 3300014326 Unclassified 1130
251 Ga0157377_10009854 3300014745 Bacteria 4707
252 Ga0157377_10108073 3300014745 Bacteria 1668
253 Ga0157377_10218790 3300014745 Unclassified 1218
254 Ga0157379_10011768 3300014968 Bacteria 7641
255 Ga0157379_10042572 3300014968 Bacteria 4055
256 Ga0157376_10016802 3300014969 Bacteria 5565
257 Ga0157376_10154985 3300014969 Bacteria 2070
258 Ga0157376_10408185 3300014969 Unclassified 1315
259 Ga0157376_10432964 3300014969 Bacteria 1279
260 Ga0157376_10439939 3300014969 Bacteria 1269
261 Ga0163161_10067748 3300017792 Bacteria 2607
262 Ga0163161_10166503 3300017792 Bacteria 1683
263 Ga0163161_10729668 3300017792 Unclassified 827
264 Ga0213876_10075405 3300021384 Bacteria 1781
265 Ga0213875_10007862 3300021388 Bacteria 5480
266 Ga0207673_1002320 3300025290 Bacteria 2160
267 Ga0207697_10001629 3300025315 Bacteria 12138
268 Ga0207682_10000836 3300025893 Bacteria 14232
269 Ga0207682_10015373 3300025893 Bacteria 2979
270 Ga0207682_10018673 3300025893 Bacteria 2712
271 Ga0207682_10100238 3300025893 Unclassified 1266
272 Ga0207642_10109943 3300025899 Unclassified 1401
273 Ga0207710_10090193 3300025900 Bacteria 1433
274 Ga0207710_10132657 3300025900 Unclassified 1197
275 Ga0207688_10003748 3300025901 Bacteria 8297
276 Ga0207680_10026099 3300025903 Bacteria 3233
277 Ga0207680_10283485 3300025903 Bacteria 1151
278 Ga0207680_10693608 3300025903 Bacteria 730
279 Ga0207645_10030350 3300025907 Bacteria 3482
280 Ga0207645_10107413 3300025907 Bacteria 1805
281 Ga0207645_10176215 3300025907 Unclassified 1402
282 Ga0207643_10000951 3300025908 Bacteria 17361
283 Ga0207643_10064440 3300025908 Bacteria 2097
284 Ga0207643_10118500 3300025908 Unclassified 1566
285 Ga0207643_10318824 3300025908 Unclassified 970
286 Ga0207643_10431604 3300025908 Bacteria 836
287 Ga0207705_10173992 3300025909 Bacteria 1622
288 Ga0207707_10003104 3300025912 Bacteria 14740
289 Ga0207707_10046695 3300025912 Unclassified 3772
290 Ga0207695_10006879 3300025913 Bacteria 14636
291 Ga0207663_10379965 3300025916 Unclassified 1076
292 Ga0207660_10504694 3300025917 Bacteria 981
293 Ga0207662_10189791 3300025918 Bacteria 1326
294 Ga0207662_10203616 3300025918 Bacteria 1282
295 Ga0207649_10232499 3300025920 Bacteria 1319
296 Ga0207681_10010051 3300025923 Bacteria 5793
297 Ga0207681_10173791 3300025923 Bacteria 1635
298 Ga0207681_10246862 3300025923 Unclassified 1392
299 Ga0207681_10282453 3300025923 Bacteria 1307
300 Ga0207681_10357204 3300025923 Bacteria 1171
301 Ga0207681_10550573 3300025923 Unclassified 949
302 Ga0207694_10003061 3300025924 Bacteria 13409
303 Ga0207694_10060132 3300025924 Bacteria 2957
304 Ga0207650_10255775 3300025925 Bacteria 1419
305 Ga0207659_10007235 3300025926 Bacteria 6819
306 Ga0207659_10033088 3300025926 Bacteria 3555
307 Ga0207659_10063406 3300025926 Bacteria 2671
308 Ga0207659_10456101 3300025926 Bacteria 1077
309 Ga0207659_10592826 3300025926 Bacteria 944
310 Ga0207687_10008422 3300025927 Bacteria 6744
311 Ga0207687_10509825 3300025927 Unclassified 1005
312 Ga0207644_10072848 3300025931 Bacteria 2517
313 Ga0207644_10657464 3300025931 Unclassified 873
314 Ga0207706_10053091 3300025933 Unclassified 3578
315 Ga0207706_10114025 3300025933 Bacteria 2377
316 Ga0207706_10248933 3300025933 Bacteria 1553
317 Ga0207706_10464185 3300025933 Unclassified 1094
318 Ga0207686_10055389 3300025934 Bacteria 2488
319 Ga0207686_10385803 3300025934 Bacteria 1063
320 Ga0207709_10035611 3300025935 Bacteria 2944
321 Ga0207709_10196375 3300025935 Bacteria 1438
322 Ga0207669_10252270 3300025937 Bacteria 1314
323 Ga0207704_10011439 3300025938 Bacteria 4369
324 Ga0207704_10047719 3300025938 Bacteria 2562
325 Ga0207704_10332578 3300025938 Bacteria 1176
326 Ga0207704_10475757 3300025938 Unclassified 1002
327 Ga0207704_10715801 3300025938 Bacteria 830
328 Ga0207704_10729613 3300025938 Bacteria 822
329 Ga0207691_10039742 3300025940 Unclassified 4351
330 Ga0207691_10057887 3300025940 Bacteria 3526
331 Ga0207691_10215555 3300025940 Bacteria 1666
332 Ga0207691_10254835 3300025940 Unclassified 1514
333 Ga0207711_10126113 3300025941 Bacteria 2290
334 Ga0207711_10148681 3300025941 Bacteria 2112
335 Ga0207711_10278472 3300025941 Bacteria 1540
336 Ga0207711_10506967 3300025941 Unclassified 1125
337 Ga0207689_10002108 3300025942 Bacteria 18714
338 Ga0207689_10024978 3300025942 Bacteria 5008
339 Ga0207689_10043587 3300025942 Bacteria 3709
340 Ga0207689_10656444 3300025942 Unclassified 884
341 Ga0207679_10404767 3300025945 Bacteria 1201
342 Ga0207667_10453881 3300025949 Unclassified 1302
343 Ga0207651_10016555 3300025960 Bacteria 4324
344 Ga0207651_10033321 3300025960 Bacteria 3321
345 Ga0207651_10121844 3300025960 Unclassified 1979
346 Ga0207651_10199740 3300025960 Bacteria 1601
347 Ga0207651_10207677 3300025960 Bacteria 1574
348 Ga0207651_10538068 3300025960 Bacteria 1014
349 Ga0207651_10746252 3300025960 Unclassified 865
350 Ga0207712_10264798 3300025961 Bacteria 1396
351 Ga0207668_10085839 3300025972 Bacteria 2298
352 Ga0207668_10357219 3300025972 Bacteria 1223
353 Ga0207640_10312065 3300025981 Bacteria 1248
354 Ga0207658_10398989 3300025986 Bacteria 1208
355 Ga0207677_10596902 3300026023 Bacteria 968
356 Ga0207703_10010948 3300026035 Bacteria 7068
357 Ga0207703_10030152 3300026035 Bacteria 4285
358 Ga0207678_10058858 3300026067 Bacteria 3306
359 Ga0207678_10402297 3300026067 Bacteria 1186
360 Ga0207708_10018346 3300026075 Bacteria 5270
361 Ga0207708_10043743 3300026075 Bacteria 3413
362 Ga0207708_10073428 3300026075 Bacteria 2621
363 Ga0207641_10087596 3300026088 Bacteria 2717
364 Ga0207641_10122857 3300026088 Bacteria 2320
365 Ga0207641_10724676 3300026088 Unclassified 980
366 Ga0207648_10006985 3300026089 Bacteria 11164
367 Ga0207648_10010574 3300026089 Bacteria 8731
368 Ga0207648_10153916 3300026089 Bacteria 2029
369 Ga0207648_10186550 3300026089 Bacteria 1837
370 Ga0207648_10395338 3300026089 Bacteria 1252
371 Ga0207676_10178375 3300026095 Bacteria 1858
372 Ga0207674_10045621 3300026116 Unclassified 4507
373 Ga0207674_10410656 3300026116 Bacteria 1308
374 Ga0207675_100016876 3300026118 Bacteria 6822
375 Ga0207675_100366371 3300026118 Bacteria 1415
376 Ga0207675_100458226 3300026118 Bacteria 1264
377 Ga0207675_100563635 3300026118 Unclassified 1139
378 Ga0207675_100577379 3300026118 Unclassified 1125
379 Ga0207683_10006350 3300026121 Bacteria 10124
380 Ga0207683_10026537 3300026121 Bacteria 4999
381 Ga0207683_10075221 3300026121 Bacteria 2989
382 Ga0207683_10132992 3300026121 Bacteria 2238
383 Ga0207683_10381371 3300026121 Bacteria 1296
384 Ga0207698_10538368 3300026142 Unclassified 1142
385 Ga0207428_10000144 3300027907 Bacteria 96684
386 Ga0207428_10004171 3300027907 Bacteria 13848
387 Ga0207428_10005048 3300027907 Bacteria 12399
388 Ga0268265_10024852 3300028380 Bacteria 4244
389 Ga0268265_10065135 3300028380 Unclassified 2811
390 Ga0268264_10080862 3300028381 Bacteria 2776
391 Ga0268264_10118112 3300028381 Bacteria 2333
392 Ga0265314_10001424 3300031711 Bacteria 26793
393 Ga0265342_10101778 3300031712 Bacteria 1635
394 Ga0373934_0055666 3300035086 Unclassified 1572
395 Ga0373932_0022557 3300035112 Bacteria 1673
396 Ga0373939_0033556 3300035114 Bacteria 1500
397 Ga0373941_0061140 3300035115 Bacteria 1226
398 Ga0373953_0057508 3300035117 Unclassified 1584
399 Ga0373954_0158110 3300035118 Unclassified 1108
400 Ga0373960_0155650 3300035121 Bacteria 783
401 Ga0373955_0226444 3300035172 Bacteria 1118
402 Ga0373955_0351297 3300035172 Unclassified 893
403 Ga0373961_0062340 3300035241 Bacteria 1135
404 Ga0373935_0262601 3300035692 Bacteria 1211
405 Ga0373927_0246533 3300035695 Bacteria 1174
406 Ga0373937_0020595 3300036401 Bacteria 5912
407 Ga0373937_0023378 3300036401 Bacteria 5565
408 Ga0373937_0571245 3300036401 Unclassified 1074
409 Ga0436364_0196820 3300037853 Bacteria 2023
410 Ga0436364_1152139 3300037853 Bacteria 9130
411 Ga0436365_1048587 3300039437 Bacteria 6392
412 Ga0450918_024450 3300042531 Bacteria 1057
413 Ga0451576_0422146 3300045051 Unclassified 1399
414 Ga0495651_0083016 3300046462 Unclassified 2417
415 Ga0495580_0124039 3300046472 Bacteria 1793
416 Ga0495643_0057316 3300046522 Bacteria 2076
417 Ga0495652_0214580 3300046529 Bacteria 1450
418 Ga0495640_0119096 3300046533 Bacteria 1718
419 Ga0495598_0029606 3300046537 Bacteria 1528
420 Ga0495598_0050426 3300046537 Bacteria 1251
421 Ga0495598_0171498 3300046537 Bacteria 769
422 Ga0495621_0158664 3300046539 Bacteria 894
423 Ga0495667_0225844 3300046559 Bacteria 1194
424 Ga0495656_0058534 3300046615 Bacteria 1673
425 Ga0495635_0382662 3300046663 Unclassified 936
426 Ga0495658_0040326 3300046683 Bacteria 2596
427 Ga0495658_0496451 3300046683 Unclassified 781
428 Ga0495669_0021403 3300046684 Unclassified 2806
429 Ga0495670_0240524 3300046691 Bacteria 964
430 Ga0495675_0283810 3300047444 Unclassified 987
431 Ga0495684_0126244 3300047471 Unclassified 1924
432 Ga0496101_0031173 3300048904 Bacteria 3745
433 Ga0496104_0046802 3300048907 Bacteria 4075
434 Ga0496104_0509784 3300048907 Bacteria 1114
435 Ga0496105_0195014 3300048908 Bacteria 1655
436 Ga0496105_0211466 3300048908 Bacteria 1581
437 Ga0496106_0013598 3300048909 Bacteria 6008
438 Ga0496107_0018892 3300048910 Bacteria 4859
439 Ga0496108_0312369 3300048911 Unclassified 1370
440 Ga0496108_0926467 3300048911 Bacteria 747
441 Ga0496113_0111547 3300048916 Bacteria 2130
442 Ga0496113_0129916 3300048916 Bacteria 1976
443 Ga0496114_0001427 3300048917 Bacteria 18129
444 Ga0501299_063879 3300049522 Bacteria 785
445 nmdc:mga05p37_237398_c1 3300050507 Bacteria 2194
446 nmdc:mga05p37_25734_c1 3300050507 Bacteria 7157
447 nmdc:mga09592_329545_c1 3300050508 Unclassified 1322
448 nmdc:mga09592_84209_c1 3300050508 Bacteria 2711
449 nmdc:mga0qj67_149111_c1 3300050509 Unclassified 1897
450 nmdc:mga0qj67_92492_c1 3300050509 Bacteria 2432
451 nmdc:mga06r32_1073834_c1 3300050510 Unclassified 755
452 nmdc:mga06r32_279376_c1 3300050510 Bacteria 1657
453 nmdc:mga06r32_369987_c1 3300050510 Bacteria 1417
454 nmdc:mga06r32_699307_c1 3300050510 Bacteria 979
455 nmdc:mga08y16_23045_c1 3300050511 Bacteria 6573
456 nmdc:mga08y16_237678_c1 3300050511 Bacteria 1884
457 nmdc:mga08y16_23770_c1 3300050511 Bacteria 6471
458 nmdc:mga08y16_2581_c1 3300050511 Bacteria 18625
459 nmdc:mga08y16_5014_c1 3300050511 Bacteria 13847
460 nmdc:mga08y16_61693_c1 3300050511 Bacteria 3915
461 nmdc:mga08y16_9103_c1 3300050511 Bacteria 10426
462 nmdc:mga0n895_23093_c1 3300050512 Bacteria 5842
463 nmdc:mga0n895_28852_c1 3300050512 Bacteria 5284
464 nmdc:mga0n895_648530_c1 3300050512 Unclassified 1055
465 nmdc:mga0n895_97185_c1 3300050512 Unclassified 2950
466 nmdc:mga0rr50_141337_c1 3300050513 Bacteria 1937
467 nmdc:mga0rr50_180152_c1 3300050513 Bacteria 1727
468 nmdc:mga0a205_13901_c1 3300050515 Bacteria 7505
469 nmdc:mga0a205_26448_c1 3300050515 Bacteria 5534
470 nmdc:mga0a205_8581_c1 3300050515 Bacteria 9298
471 Ga0495619_0153318 3300053085 Bacteria 1589
472 Ga0500641_0103629 3300053096 Bacteria 1221
473 Ga0373937_0482115
474 JGI24746J21847_1005887
475 Ga0065714_10236806
476 Ga0065712_10088375
477 Ga0065707_10117702
478 Ga0065707_10157868
479 Ga0070658_10220068
480 Ga0070676_10097878
481 Ga0070676_10104664
482 Ga0070676_10294652
483 Ga0070683_100398442
484 Ga0070690_100051648
485 Ga0070690_100057425
486 Ga0070690_100394144
487 Ga0070670_100003224
488 Ga0070670_100033138
489 Ga0070677_10032736
490 Ga0070677_10039232
491 Ga0070677_10093008
492 Ga0068869_100005684
493 Ga0068869_100032433
494 Ga0068869_100047507
495 Ga0070666_10003973
496 Ga0070666_10012290
497 Ga0070666_10086232
498 Ga0070666_10468545
499 Ga0070680_100169407
500 Ga0070680_100260450
501 Ga0068868_100014502
502 Ga0068868_100791894
503 Ga0070689_100030882
504 Ga0070689_100128547
505 Ga0070687_100072679
506 Ga0070661_100056046
507 Ga0070661_100090583
508 Ga0070692_10417969
509 Ga0070668_100044388
510 Ga0070668_100362106
511 Ga0070668_100836107
512 Ga0070669_100004616
513 Ga0070669_100038115
514 Ga0070669_100098246
515 Ga0070669_100122771
516 Ga0070669_100194699
517 Ga0070675_100030478
518 Ga0070675_100050542
519 Ga0070675_100068388
520 Ga0070675_100228119
521 Ga0070675_100475157
522 Ga0070675_100581626
523 Ga0070671_100094029
524 Ga0070671_100595839
525 Ga0070674_100009570
526 Ga0070674_100053637
527 Ga0070674_100081510
528 Ga0070674_100350572
529 Ga0070673_100022128
530 Ga0070673_100204036
531 Ga0070673_100209242
532 Ga0070673_100420718
533 Ga0070688_100003798
534 Ga0070688_100041955
535 Ga0070688_100644675
536 Ga0070667_100008209
537 Ga0070667_100080351
538 Ga0070701_10033018
539 Ga0070701_10151500
540 Ga0070705_100256132
541 Ga0070700_100014745
542 Ga0070700_100039160
543 Ga0070700_100869205
544 Ga0070694_100170609
545 Ga0070678_100066020
546 Ga0070678_100160139
547 Ga0070678_100199053
548 Ga0070678_100261636
549 Ga0070678_100533423
550 Ga0070662_100014714
551 Ga0070662_100295618
552 Ga0070662_100381786
553 Ga0070662_100514237
554 Ga0070681_10000457
555 Ga0070681_10111437
556 Ga0068867_100008173
557 Ga0068867_100038283
558 Ga0068867_100287801
559 Ga0068867_100319040
560 Ga0068867_100559365
561 Ga0070685_10037118
562 Ga0070685_10105932
563 Ga0070707_100580474
564 Ga0070698_100115259
565 Ga0070698_100294798
566 Ga0070679_100006598
567 Ga0070679_100203431
568 Ga0068853_100001835
569 Ga0070672_100024118
570 Ga0070672_100050203
571 Ga0070672_100483508
572 Ga0070672_100556136
573 Ga0070686_100002942
574 Ga0070686_100120731
575 Ga0070686_100957019
576 Ga0070696_100069569
577 Ga0070696_100655746
578 Ga0070665_100080375
579 Ga0070664_100085304
580 Ga0068857_100065634
581 Ga0068857_100973354
582 Ga0068854_100034334
583 Ga0068854_100448910
584 Ga0068859_100000580
585 Ga0068859_100045961
586 Ga0068859_100649146
587 Ga0068864_100057468
588 Ga0068864_100138933
589 Ga0068866_10085751
590 Ga0068866_10388781
591 Ga0068861_100038785
592 Ga0068861_100234904
593 Ga0068861_100615192
594 Ga0068861_100989153
595 Ga0068851_10028628
596 Ga0068870_10020476
597 Ga0068870_10023614
598 Ga0068870_10075973
599 Ga0068870_10267319
600 Ga0068870_10280306
601 Ga0068870_10366236
602 Ga0068863_100042810
603 Ga0068863_100087255
604 Ga0068863_100210429
605 Ga0068858_100028289
606 Ga0068858_100043561
607 Ga0068858_100045869
608 Ga0068858_100203199
609 Ga0068858_100392951
610 Ga0068860_100005752
611 Ga0068860_100010654
612 Ga0068860_100224597
613 Ga0068860_100248439
614 Ga0068862_100047474
615 Ga0068862_100061762
616 Ga0068862_100246431
617 Ga0068862_100265952
618 Ga0081539_10033573
619 Ga0081539_10125385
620 Ga0097621_100010183
621 Ga0097621_100068834
622 Ga0097621_100094201
623 Ga0097621_100158197
624 Ga0097621_100404358
625 Ga0097621_100455549
626 Ga0068871_100002665
627 Ga0068871_100025719
628 Ga0068871_100180894
629 Ga0068871_100332225
630 Ga0068871_100560057
631 Ga0075428_100006820
632 Ga0075428_100093552
633 Ga0075428_100543563
634 Ga0075430_100038218
635 Ga0075430_100146063
636 Ga0075431_100637329
637 Ga0075433_10000460
638 Ga0075433_10002304
639 Ga0075434_100003682
640 Ga0075434_100012919
641 Ga0075434_100693118
642 Ga0075429_100020030
643 Ga0075429_100031069
644 Ga0075429_100535928
645 Ga0068865_100005988
646 Ga0068865_100057308
647 Ga0068865_100145005
648 Ga0068865_100519516
649 Ga0097620_100000580
650 Ga0097620_100045959
651 Ga0097620_100649263
652 Ga0075435_100039406
653 Ga0075435_100088424
654 Ga0075435_100521413
655 Ga0105240_10017379
656 Ga0111539_10000151
657 Ga0111539_10000810
658 Ga0111539_10002719
659 Ga0111539_10295426
660 Ga0105245_10008455
661 Ga0105245_10031978
662 Ga0105245_10044601
663 Ga0105247_10039815
664 Ga0105247_10123039
665 Ga0105247_10284397
666 Ga0114129_10040182
667 Ga0114129_10096941
668 Ga0114129_10583927
669 Ga0114129_11694752
670 Ga0105243_10015829
671 Ga0105243_10204623
672 Ga0105243_10694294
673 Ga0105241_10009085
674 Ga0105242_10015852
675 Ga0105242_10040355
676 Ga0105242_10050119
677 Ga0105248_10007062
678 Ga0105248_10011887
679 Ga0105248_10092272
680 Ga0105248_10122601
681 Ga0105248_10268840
682 Ga0105248_10349997
683 Ga0105248_10492757
684 Ga0105238_10009581
685 Ga0105238_10032203
686 Ga0105238_10322473
687 Ga0105249_10088187
688 Ga0105239_10010656
689 Ga0105246_10080635
690 Ga0105246_10405547
691 Ga0157371_10076664
692 Ga0157370_10020303
693 Ga0157369_10006278
694 Ga0157369_10014855
695 Ga0157374_10026139
696 Ga0157378_10445631
697 Ga0157378_10500365
698 Ga0163162_10010532
699 Ga0163162_10093960
700 Ga0163162_10200022
701 Ga0157372_10013849
702 Ga0157372_10085649
703 Ga0157372_10647475
704 Ga0157372_11170424
705 Ga0157375_10048063
706 Ga0157375_10127193
707 Ga0157375_10333746
708 Ga0157375_10385663
709 Ga0157375_11008935
710 Ga0157375_11538779
711 Ga0163163_10008254
712 Ga0163163_10017363
713 Ga0163163_10022330
714 Ga0163163_10048425
715 Ga0163163_10099117
716 Ga0163163_10175182
717 Ga0163163_11379952
718 Ga0157380_10027274
719 Ga0157380_10057582
720 Ga0157380_10148472
721 Ga0157380_10264122
722 Ga0157380_10551971
723 Ga0157377_10009854
724 Ga0157377_10108073
725 Ga0157377_10218790
726 Ga0157379_10011768
727 Ga0157379_10042572
728 Ga0157376_10016802
729 Ga0157376_10154985
730 Ga0157376_10408185
731 Ga0157376_10432964
732 Ga0157376_10439939
733 Ga0163161_10067748
734 Ga0163161_10166503
735 Ga0163161_10729668
736 Ga0213876_10075405
737 Ga0213875_10007862
738 Ga0207673_1002320
739 Ga0207697_10001629
740 Ga0207682_10000836
741 Ga0207682_10015373
742 Ga0207682_10018673
743 Ga0207682_10100238
744 Ga0207642_10109943
745 Ga0207710_10090193
746 Ga0207710_10132657
747 Ga0207688_10003748
748 Ga0207680_10026099
749 Ga0207680_10283485
750 Ga0207680_10693608
751 Ga0207645_10030350
752 Ga0207645_10107413
753 Ga0207645_10176215
754 Ga0207643_10000951
755 Ga0207643_10064440
756 Ga0207643_10118500
757 Ga0207643_10318824
758 Ga0207643_10431604
759 Ga0207705_10173992
760 Ga0207707_10003104
761 Ga0207707_10046695
762 Ga0207695_10006879
763 Ga0207663_10379965
764 Ga0207660_10504694
765 Ga0207662_10189791
766 Ga0207662_10203616
767 Ga0207649_10232499
768 Ga0207681_10010051
769 Ga0207681_10173791
770 Ga0207681_10246862
771 Ga0207681_10282453
772 Ga0207681_10357204
773 Ga0207681_10550573
774 Ga0207694_10003061
775 Ga0207694_10060132
776 Ga0207650_10255775
777 Ga0207659_10007235
778 Ga0207659_10033088
779 Ga0207659_10063406
780 Ga0207659_10456101
781 Ga0207659_10592826
782 Ga0207687_10008422
783 Ga0207687_10509825
784 Ga0207644_10072848
785 Ga0207644_10657464
786 Ga0207706_10053091
787 Ga0207706_10114025
788 Ga0207706_10248933
789 Ga0207706_10464185
790 Ga0207686_10055389
791 Ga0207686_10385803
792 Ga0207709_10035611
793 Ga0207709_10196375
794 Ga0207669_10252270
795 Ga0207704_10011439
796 Ga0207704_10047719
797 Ga0207704_10332578
798 Ga0207704_10475757
799 Ga0207704_10715801
800 Ga0207704_10729613
801 Ga0207691_10039742
802 Ga0207691_10057887
803 Ga0207691_10215555
804 Ga0207691_10254835
805 Ga0207711_10126113
806 Ga0207711_10148681
807 Ga0207711_10278472
808 Ga0207711_10506967
809 Ga0207689_10002108
810 Ga0207689_10024978
811 Ga0207689_10043587
812 Ga0207689_10656444
813 Ga0207679_10404767
814 Ga0207667_10453881
815 Ga0207651_10016555
816 Ga0207651_10033321
817 Ga0207651_10121844
818 Ga0207651_10199740
819 Ga0207651_10207677
820 Ga0207651_10538068
821 Ga0207651_10746252
822 Ga0207712_10264798
823 Ga0207668_10085839
824 Ga0207668_10357219
825 Ga0207640_10312065
826 Ga0207658_10398989
827 Ga0207677_10596902
828 Ga0207703_10010948
829 Ga0207703_10030152
830 Ga0207678_10058858
831 Ga0207678_10402297
832 Ga0207708_10018346
833 Ga0207708_10043743
834 Ga0207708_10073428
835 Ga0207641_10087596
836 Ga0207641_10122857
837 Ga0207641_10724676
838 Ga0207648_10006985
839 Ga0207648_10010574
840 Ga0207648_10153916
841 Ga0207648_10186550
842 Ga0207648_10395338
843 Ga0207676_10178375
844 Ga0207674_10045621
845 Ga0207674_10410656
846 Ga0207675_100016876
847 Ga0207675_100366371
848 Ga0207675_100458226
849 Ga0207675_100563635
850 Ga0207675_100577379
851 Ga0207683_10006350
852 Ga0207683_10026537
853 Ga0207683_10075221
854 Ga0207683_10132992
855 Ga0207683_10381371
856 Ga0207698_10538368
857 Ga0207428_10000144
858 Ga0207428_10004171
859 Ga0207428_10005048
860 Ga0268265_10024852
861 Ga0268265_10065135
862 Ga0268264_10080862
863 Ga0268264_10118112
864 Ga0265314_10001424
865 Ga0265342_10101778
866 Ga0373934_0055666
867 Ga0373932_0022557
868 Ga0373939_0033556
869 Ga0373941_0061140
870 Ga0373953_0057508
871 Ga0373954_0158110
872 Ga0373960_0155650
873 Ga0373955_0226444
874 Ga0373955_0351297
875 Ga0373961_0062340
876 Ga0373935_0262601
877 Ga0373927_0246533
878 Ga0373937_0020595
879 Ga0373937_0023378
880 Ga0373937_0571245
881 Ga0436364_0196820
882 Ga0436364_1152139
883 Ga0436365_1048587
884 Ga0450918_024450
885 Ga0451576_0422146
886 Ga0495651_0083016
887 Ga0495580_0124039
888 Ga0495643_0057316
889 Ga0495652_0214580
890 Ga0495640_0119096
891 Ga0495598_0029606
892 Ga0495598_0050426
893 Ga0495598_0171498
894 Ga0495621_0158664
895 Ga0495667_0225844
896 Ga0495656_0058534
897 Ga0495635_0382662
898 Ga0495658_0040326
899 Ga0495658_0496451
900 Ga0495669_0021403
901 Ga0495670_0240524
902 Ga0495675_0283810
903 Ga0495684_0126244
904 Ga0496101_0031173
905 Ga0496104_0046802
906 Ga0496104_0509784
907 Ga0496105_0195014
908 Ga0496105_0211466
909 Ga0496106_0013598
910 Ga0496107_0018892
911 Ga0496108_0312369
912 Ga0496108_0926467
913 Ga0496113_0111547
914 Ga0496113_0129916
915 Ga0496114_0001427
916 Ga0501299_063879
917 nmdc:mga05p37_237398_c1
918 nmdc:mga05p37_25734_c1
919 nmdc:mga09592_329545_c1
920 nmdc:mga09592_84209_c1
921 nmdc:mga0qj67_149111_c1
922 nmdc:mga0qj67_92492_c1
923 nmdc:mga06r32_1073834_c1
924 nmdc:mga06r32_279376_c1
925 nmdc:mga06r32_369987_c1
926 nmdc:mga06r32_699307_c1
927 nmdc:mga08y16_23045_c1
928 nmdc:mga08y16_237678_c1
929 nmdc:mga08y16_23770_c1
930 nmdc:mga08y16_2581_c1
931 nmdc:mga08y16_5014_c1
932 nmdc:mga08y16_61693_c1
933 nmdc:mga08y16_9103_c1
934 nmdc:mga0n895_23093_c1
935 nmdc:mga0n895_28852_c1
936 nmdc:mga0n895_648530_c1
937 nmdc:mga0n895_97185_c1
938 nmdc:mga0rr50_141337_c1
939 nmdc:mga0rr50_180152_c1
940 nmdc:mga0a205_13901_c1
941 nmdc:mga0a205_26448_c1
942 nmdc:mga0a205_8581_c1
943 Ga0495619_0153318
944 Ga0500641_0103629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

90

167

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.7817 81 194
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.751 72 198
3lvy-assembly3.cif.gz_E crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.7241 45 199
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.705 77 199
3lvy-assembly2.cif.gz_D crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.6782 45 199
ID Description Score Start End Superfamily
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.812 87 194 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7848 75 203 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.755 77 194 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7533 72 198 1.20.1290.10
af_P9WLB7_127_269_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7128 87 202 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A3D6CUL7-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9045 80 206
AF-A0A2V6V1I0-F1-model_v4 Carboxymuconolactone decarboxylase 0.8999 71 206
AF-A0A1Q7PHK0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8958 84 206 GO:0051920
AF-A0A3C0JSB4-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8873 74 205
AF-A0A382LG47-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8844 74 206

Map