F450835

General Info

Members Datasets Scaffolds Average Seq Length
472 193 944 162

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10079875|Ga0307405_100798752
Length 182
Sequence VRLKKHYTSREVAGLTGLTARQLQWWDSRRLFKPAVAPHRTEAGGFTERRYTPLDVLELQVLADLRRRGFSIPRLRRLLSALREVFGVRLYEAIGDGGPMTLFIGGDRLYARMEDGRMFDLEQPTQTLLMVGEDLPMRPLTVRRRAARPKGRLPSLSSKRKTAADAPTGSERLSRGRRPDAR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 23.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10079875 3300031731 Bacteria 2134
2 SwRhRL2b_contig_3453121 2162886007 Unclassified 1049
3 JGI24749J21850_1013473 3300002076 Bacteria 1148
4 Ga0065704_10002104 3300005289 Bacteria 6235
5 Ga0065707_10000779 3300005295 Bacteria 11400
6 Ga0065707_10011772 3300005295 Unclassified 4141
7 Ga0070676_10041466 3300005328 Bacteria 2669
8 Ga0070676_10895134 3300005328 Unclassified 661
9 Ga0070683_100142372 3300005329 Bacteria 2272
10 Ga0070690_100006250 3300005330 Bacteria 6754
11 Ga0070690_100131268 3300005330 Unclassified 1692
12 Ga0070690_100182936 3300005330 Unclassified 1449
13 Ga0070690_100463226 3300005330 Bacteria 942
14 Ga0070670_100109160 3300005331 Unclassified 2384
15 Ga0070670_100157989 3300005331 Unclassified 1964
16 Ga0070670_100217468 3300005331 Unclassified 1662
17 Ga0070670_100988813 3300005331 Bacteria 765
18 Ga0070677_10263011 3300005333 Bacteria 862
19 Ga0070677_10330452 3300005333 Bacteria 784
20 Ga0068869_100004693 3300005334 Bacteria 8529
21 Ga0068869_100057864 3300005334 Unclassified 2832
22 Ga0068869_101405434 3300005334 Bacteria 618
23 Ga0070666_10113260 3300005335 Bacteria 1877
24 Ga0070680_100222020 3300005336 Bacteria 1595
25 Ga0070680_100762967 3300005336 Unclassified 833
26 Ga0068868_100486729 3300005338 Bacteria 1078
27 Ga0068868_100526337 3300005338 Bacteria 1039
28 Ga0068868_100551697 3300005338 Bacteria 1016
29 Ga0070689_100019768 3300005340 Bacteria 4984
30 Ga0070689_100071372 3300005340 Bacteria 2713
31 Ga0070689_100086672 3300005340 Bacteria 2463
32 Ga0070691_10033468 3300005341 Bacteria 2419
33 Ga0070691_10088529 3300005341 Bacteria 1524
34 Ga0070687_100006068 3300005343 Bacteria 4929
35 Ga0070661_100048653 3300005344 Bacteria 3104
36 Ga0070692_10138144 3300005345 Bacteria 1376
37 Ga0070669_100060953 3300005353 Bacteria 2772
38 Ga0070669_100172588 3300005353 Unclassified 1687
39 Ga0070669_100184017 3300005353 Bacteria 1636
40 Ga0070669_100641342 3300005353 Bacteria 893
41 Ga0070675_100000179 3300005354 Bacteria 39545
42 Ga0070675_100000385 3300005354 Bacteria 29879
43 Ga0070675_100036995 3300005354 Bacteria 3974
44 Ga0070675_100040445 3300005354 Bacteria 3806
45 Ga0070675_100044497 3300005354 Unclassified 3630
46 Ga0070675_100105558 3300005354 Bacteria 2377
47 Ga0070675_100256174 3300005354 Bacteria 1532
48 Ga0070675_100269475 3300005354 Bacteria 1494
49 Ga0070675_100426287 3300005354 Unclassified 1187
50 Ga0070671_100041554 3300005355 Bacteria 3822
51 Ga0070671_100711561 3300005355 Bacteria 872
52 Ga0070674_100108699 3300005356 Bacteria 2032
53 Ga0070674_100320222 3300005356 Unclassified 1243
54 Ga0070674_100473006 3300005356 Bacteria 1039
55 Ga0070674_100955219 3300005356 Bacteria 750
56 Ga0070673_100011470 3300005364 Bacteria 6047
57 Ga0070673_100068204 3300005364 Unclassified 2848
58 Ga0070673_100075369 3300005364 Unclassified 2721
59 Ga0070673_100104892 3300005364 Bacteria 2335
60 Ga0070673_100119518 3300005364 Bacteria 2196
61 Ga0070673_100472086 3300005364 Bacteria 1131
62 Ga0070673_101371512 3300005364 Bacteria 665
63 Ga0070673_102163147 3300005364 Bacteria 529
64 Ga0070688_100155596 3300005365 Bacteria 1566
65 Ga0070688_100177203 3300005365 Bacteria 1476
66 Ga0070688_100345731 3300005365 Bacteria 1087
67 Ga0070667_100267069 3300005367 Bacteria 1533
68 Ga0070701_10003515 3300005438 Bacteria 6215
69 Ga0070701_10017741 3300005438 Bacteria 3332
70 Ga0070701_10352420 3300005438 Unclassified 920
71 Ga0070701_10467587 3300005438 Bacteria 812
72 Ga0070705_100002416 3300005440 Bacteria 9396
73 Ga0070705_100009832 3300005440 Bacteria 4769
74 Ga0070705_100171474 3300005440 Unclassified 1461
75 Ga0070705_100424163 3300005440 Bacteria 991
76 Ga0070700_100006002 3300005441 Bacteria 6462
77 Ga0070700_100080314 3300005441 Bacteria 2104
78 Ga0070700_100112932 3300005441 Unclassified 1809
79 Ga0070700_100184960 3300005441 Unclassified 1453
80 Ga0070694_100006985 3300005444 Bacteria 6863
81 Ga0070694_100035015 3300005444 Bacteria 3316
82 Ga0070694_100312037 3300005444 Bacteria 1208
83 Ga0070694_100703489 3300005444 Bacteria 822
84 Ga0070663_101224424 3300005455 Unclassified 660
85 Ga0070678_100227617 3300005456 Bacteria 1553
86 Ga0070678_100463924 3300005456 Bacteria 1112
87 Ga0070678_101142933 3300005456 Bacteria 720
88 Ga0070681_10059056 3300005458 Unclassified 3815
89 Ga0070681_10088699 3300005458 Bacteria 3044
90 Ga0070681_11248285 3300005458 Unclassified 665
91 Ga0068867_100001397 3300005459 Bacteria 16695
92 Ga0070706_100262256 3300005467 Bacteria 1613
93 Ga0070706_100325104 3300005467 Bacteria 1434
94 Ga0070706_100410347 3300005467 Bacteria 1261
95 Ga0070706_101191507 3300005467 Bacteria 700
96 Ga0070707_100245471 3300005468 Bacteria 1742
97 Ga0070698_100056751 3300005471 Bacteria 3966
98 Ga0070698_100116770 3300005471 Bacteria 2631
99 Ga0070698_100234325 3300005471 Unclassified 1769
100 Ga0070698_100300070 3300005471 Bacteria 1537
101 Ga0070698_101571753 3300005471 Bacteria 609
102 Ga0070699_100001411 3300005518 Bacteria 22076
103 Ga0070699_100004666 3300005518 Bacteria 12118
104 Ga0070699_100554476 3300005518 Bacteria 1046
105 Ga0070699_100601587 3300005518 Unclassified 1002
106 Ga0070679_100826262 3300005530 Bacteria 870
107 Ga0070684_100132724 3300005535 Unclassified 2247
108 Ga0070684_100720359 3300005535 Unclassified 931
109 Ga0070697_100076187 3300005536 Bacteria 2759
110 Ga0070697_100765855 3300005536 Bacteria 853
111 Ga0070672_100080995 3300005543 Bacteria 2602
112 Ga0070672_100145081 3300005543 Bacteria 1961
113 Ga0070672_100193793 3300005543 Unclassified 1698
114 Ga0070686_100014511 3300005544 Bacteria 4544
115 Ga0070686_100086569 3300005544 Bacteria 2086
116 Ga0070686_100138253 3300005544 Bacteria 1693
117 Ga0070686_100423322 3300005544 Unclassified 1018
118 Ga0070695_100002507 3300005545 Bacteria 10581
119 Ga0070695_100121670 3300005545 Unclassified 1786
120 Ga0070695_100319897 3300005545 Bacteria 1153
121 Ga0070695_100711056 3300005545 Unclassified 798
122 Ga0070696_100002271 3300005546 Bacteria 12669
123 Ga0070696_100008521 3300005546 Bacteria 6865
124 Ga0070696_100699353 3300005546 Bacteria 826
125 Ga0070665_100624067 3300005548 Bacteria 1091
126 Ga0070704_100000234 3300005549 Bacteria 23608
127 Ga0070704_100017244 3300005549 Bacteria 4587
128 Ga0070704_100157446 3300005549 Unclassified 1793
129 Ga0070704_100208500 3300005549 Bacteria 1582
130 Ga0070664_100005188 3300005564 Bacteria 10447
131 Ga0070664_100031280 3300005564 Unclassified 4445
132 Ga0070664_100111904 3300005564 Unclassified 2383
133 Ga0070664_100154958 3300005564 Unclassified 2024
134 Ga0070664_100837207 3300005564 Unclassified 861
135 Ga0068857_100035721 3300005577 Bacteria 4402
136 Ga0068857_100066468 3300005577 Unclassified 3208
137 Ga0068857_100160775 3300005577 Unclassified 2038
138 Ga0068857_100339336 3300005577 Bacteria 1390
139 Ga0068857_101685566 3300005577 Bacteria 620
140 Ga0068854_100159060 3300005578 Bacteria 1748
141 Ga0068854_100525796 3300005578 Bacteria 1000
142 Ga0070702_100024904 3300005615 Bacteria 3199
143 Ga0070702_100070063 3300005615 Bacteria 2068
144 Ga0070702_100281443 3300005615 Bacteria 1142
145 Ga0068859_100068116 3300005617 Bacteria 3594
146 Ga0068859_100084259 3300005617 Bacteria 3224
147 Ga0068859_100180287 3300005617 Unclassified 2195
148 Ga0068859_100595437 3300005617 Bacteria 1199
149 Ga0068859_100890764 3300005617 Bacteria 975
150 Ga0068864_100014662 3300005618 Bacteria 6510
151 Ga0068864_100050135 3300005618 Bacteria 3592
152 Ga0068866_10015220 3300005718 Bacteria 3414
153 Ga0068861_100125230 3300005719 Bacteria 2078
154 Ga0068861_100313615 3300005719 Bacteria 1363
155 Ga0068870_10016718 3300005840 Bacteria 3512
156 Ga0068870_10032235 3300005840 Bacteria 2662
157 Ga0068870_10040307 3300005840 Bacteria 2421
158 Ga0068870_10193668 3300005840 Bacteria 1228
159 Ga0068870_10275866 3300005840 Bacteria 1052
160 Ga0068863_100025032 3300005841 Bacteria 5692
161 Ga0068863_100929257 3300005841 Archaea 871
162 Ga0068863_101072450 3300005841 Bacteria 810
163 Ga0068863_101808355 3300005841 Unclassified 621
164 Ga0068863_101829376 3300005841 Unclassified 617
165 Ga0068858_100020312 3300005842 Bacteria 6212
166 Ga0068858_100115223 3300005842 Bacteria 2511
167 Ga0068858_100134993 3300005842 Bacteria 2315
168 Ga0068860_100008479 3300005843 Bacteria 10242
169 Ga0068860_100042011 3300005843 Bacteria 4369
170 Ga0075432_10119413 3300006058 Bacteria 989
171 Ga0097621_100156671 3300006237 Bacteria 1955
172 Ga0097621_100205853 3300006237 Unclassified 1710
173 Ga0068871_100105025 3300006358 Bacteria 2370
174 Ga0068871_100522479 3300006358 Bacteria 1072
175 Ga0068871_100850959 3300006358 Bacteria 843
176 Ga0075428_100004797 3300006844 Bacteria 14992
177 Ga0075428_100005791 3300006844 Bacteria 13721
178 Ga0075428_100046978 3300006844 Unclassified 4742
179 Ga0075430_100043062 3300006846 Unclassified 3816
180 Ga0075430_100133597 3300006846 Bacteria 2068
181 Ga0075431_100023210 3300006847 Bacteria 6345
182 Ga0075431_100103491 3300006847 Unclassified 2939
183 Ga0075433_10262662 3300006852 Bacteria 1530
184 Ga0075433_10906094 3300006852 Bacteria 769
185 Ga0075434_100005962 3300006871 Bacteria 11154
186 Ga0075434_100070794 3300006871 Bacteria 3478
187 Ga0075434_100562838 3300006871 Bacteria 1159
188 Ga0075429_100021057 3300006880 Bacteria 5657
189 Ga0075429_100145348 3300006880 Bacteria 2076
190 Ga0075429_101286685 3300006880 Bacteria 638
191 Ga0068865_100045457 3300006881 Bacteria 3010
192 Ga0068865_100318394 3300006881 Bacteria 1250
193 Ga0068865_100385832 3300006881 Unclassified 1144
194 Ga0097620_100068116 3300006931 Bacteria 3594
195 Ga0097620_100084257 3300006931 Bacteria 3224
196 Ga0097620_100180296 3300006931 Unclassified 2195
197 Ga0097620_100595523 3300006931 Bacteria 1199
198 Ga0097620_100890795 3300006931 Bacteria 975
199 Ga0075435_100007149 3300007076 Bacteria 7935
200 Ga0075435_100021144 3300007076 Unclassified 4999
201 Ga0075435_100025329 3300007076 Bacteria 4618
202 Ga0111539_10057049 3300009094 Bacteria 4639
203 Ga0111539_10291050 3300009094 Bacteria 1901
204 Ga0105245_11390309 3300009098 Unclassified 752
205 Ga0114129_10000428 3300009147 Bacteria 49983
206 Ga0114129_10003809 3300009147 Bacteria 21256
207 Ga0114129_10022531 3300009147 Bacteria 8937
208 Ga0114129_10035929 3300009147 Bacteria 6997
209 Ga0114129_10056610 3300009147 Bacteria 5491
210 Ga0105243_10037657 3300009148 Bacteria 3761
211 Ga0105243_10132561 3300009148 Bacteria 2116
212 Ga0105243_10284329 3300009148 Bacteria 1491
213 Ga0105243_10878343 3300009148 Bacteria 890
214 Ga0105242_10003459 3300009176 Bacteria 12280
215 Ga0105242_10177493 3300009176 Bacteria 1877
216 Ga0105242_10292096 3300009176 Unclassified 1485
217 Ga0105242_10578559 3300009176 Bacteria 1081
218 Ga0105248_10150882 3300009177 Bacteria 2622
219 Ga0105248_10574432 3300009177 Bacteria 1272
220 Ga0105238_10214976 3300009551 Bacteria 1899
221 Ga0105249_10771234 3300009553 Bacteria 1024
222 Ga0105249_11127015 3300009553 Bacteria 855
223 Ga0105246_10410615 3300011119 Bacteria 1127
224 Ga0157374_10975159 3300013296 Bacteria 866
225 Ga0157374_12090485 3300013296 Unclassified 593
226 Ga0157378_10783930 3300013297 Bacteria 978
227 Ga0157375_10049405 3300013308 Bacteria 4121
228 Ga0157375_10156208 3300013308 Bacteria 2420
229 Ga0157375_10322254 3300013308 Bacteria 1710
230 Ga0157375_11406092 3300013308 Unclassified 822
231 Ga0163163_10084117 3300014325 Bacteria 3187
232 Ga0163163_10305943 3300014325 Bacteria 1642
233 Ga0157380_10003246 3300014326 Bacteria 11131
234 Ga0157380_10048247 3300014326 Bacteria 3353
235 Ga0157380_10106861 3300014326 Bacteria 2343
236 Ga0157380_10114697 3300014326 Bacteria 2271
237 Ga0157380_10171891 3300014326 Unclassified 1894
238 Ga0157380_10267794 3300014326 Unclassified 1555
239 Ga0157380_10360139 3300014326 Unclassified 1364
240 Ga0157380_10497764 3300014326 Bacteria 1183
241 Ga0157380_10653945 3300014326 Unclassified 1049
242 Ga0157380_11092318 3300014326 Bacteria 836
243 Ga0157377_10018614 3300014745 Unclassified 3612
244 Ga0157377_10151914 3300014745 Unclassified 1432
245 Ga0157377_10377249 3300014745 Bacteria 959
246 Ga0157377_10721054 3300014745 Bacteria 726
247 Ga0157376_10117185 3300014969 Bacteria 2354
248 Ga0157376_10383128 3300014969 Bacteria 1355
249 Ga0157376_10420363 3300014969 Bacteria 1297
250 Ga0163161_10298232 3300017792 Bacteria 1269
251 Ga0207697_10513909 3300025315 Bacteria 528
252 Ga0207682_10023239 3300025893 Unclassified 2447
253 Ga0207682_10216504 3300025893 Bacteria 885
254 Ga0207642_10383256 3300025899 Bacteria 837
255 Ga0207710_10135681 3300025900 Bacteria 1185
256 Ga0207688_10069292 3300025901 Bacteria 1999
257 Ga0207688_10611252 3300025901 Unclassified 687
258 Ga0207680_10362170 3300025903 Bacteria 1020
259 Ga0207680_10871860 3300025903 Unclassified 645
260 Ga0207645_10004581 3300025907 Bacteria 10193
261 Ga0207645_10940971 3300025907 Unclassified 586
262 Ga0207643_10039612 3300025908 Bacteria 2651
263 Ga0207643_10096066 3300025908 Bacteria 1733
264 Ga0207643_10118780 3300025908 Unclassified 1564
265 Ga0207643_10169405 3300025908 Bacteria 1317
266 Ga0207684_10355238 3300025910 Bacteria 1261
267 Ga0207684_10476932 3300025910 Bacteria 1070
268 Ga0207707_10133164 3300025912 Unclassified 2174
269 Ga0207707_11051179 3300025912 Unclassified 666
270 Ga0207660_10029667 3300025917 Bacteria 3755
271 Ga0207660_11298398 3300025917 Bacteria 591
272 Ga0207662_10003217 3300025918 Bacteria 8365
273 Ga0207662_10004389 3300025918 Bacteria 7409
274 Ga0207662_10079409 3300025918 Bacteria 1999
275 Ga0207646_10696287 3300025922 Bacteria 909
276 Ga0207681_10034378 3300025923 Bacteria 3332
277 Ga0207681_10045352 3300025923 Bacteria 2951
278 Ga0207681_10101807 3300025923 Unclassified 2073
279 Ga0207681_10970143 3300025923 Unclassified 713
280 Ga0207694_10135372 3300025924 Bacteria 1978
281 Ga0207650_10164321 3300025925 Bacteria 1760
282 Ga0207659_10000228 3300025926 Bacteria 34204
283 Ga0207659_10003371 3300025926 Bacteria 9577
284 Ga0207659_10004480 3300025926 Bacteria 8452
285 Ga0207659_10017165 3300025926 Unclassified 4726
286 Ga0207659_10021326 3300025926 Bacteria 4298
287 Ga0207659_10032413 3300025926 Bacteria 3586
288 Ga0207659_10049868 3300025926 Bacteria 2971
289 Ga0207659_10061178 3300025926 Bacteria 2713
290 Ga0207659_10128374 3300025926 Bacteria 1953
291 Ga0207644_10028084 3300025931 Bacteria 3891
292 Ga0207644_10132364 3300025931 Bacteria 1911
293 Ga0207690_10362679 3300025932 Bacteria 1148
294 Ga0207706_10003779 3300025933 Bacteria 14441
295 Ga0207706_10055348 3300025933 Bacteria 3499
296 Ga0207706_10598231 3300025933 Bacteria 947
297 Ga0207686_10095103 3300025934 Bacteria 1976
298 Ga0207709_10042376 3300025935 Bacteria 2737
299 Ga0207709_10049682 3300025935 Bacteria 2562
300 Ga0207670_10007475 3300025936 Bacteria 6098
301 Ga0207670_10021611 3300025936 Bacteria 3974
302 Ga0207670_10082469 3300025936 Bacteria 2254
303 Ga0207669_10052573 3300025937 Bacteria 2448
304 Ga0207669_10090220 3300025937 Bacteria 1993
305 Ga0207669_10593596 3300025937 Bacteria 899
306 Ga0207704_10017217 3300025938 Bacteria 3739
307 Ga0207704_10341462 3300025938 Bacteria 1162
308 Ga0207704_10495125 3300025938 Bacteria 984
309 Ga0207704_11402781 3300025938 Unclassified 599
310 Ga0207691_10008762 3300025940 Bacteria 9705
311 Ga0207691_10018655 3300025940 Bacteria 6573
312 Ga0207691_10021671 3300025940 Bacteria 6065
313 Ga0207691_10074984 3300025940 Bacteria 3051
314 Ga0207691_10089482 3300025940 Bacteria 2760
315 Ga0207691_10092269 3300025940 Unclassified 2712
316 Ga0207691_10097245 3300025940 Bacteria 2631
317 Ga0207691_10123893 3300025940 Bacteria 2288
318 Ga0207691_10245358 3300025940 Bacteria 1547
319 Ga0207691_11314592 3300025940 Bacteria 597
320 Ga0207711_10740969 3300025941 Bacteria 916
321 Ga0207689_10002683 3300025942 Bacteria 16455
322 Ga0207689_10089207 3300025942 Unclassified 2533
323 Ga0207689_10184954 3300025942 Bacteria 1718
324 Ga0207689_10225630 3300025942 Bacteria 1548
325 Ga0207689_10669190 3300025942 Bacteria 875
326 Ga0207661_10414427 3300025944 Bacteria 1223
327 Ga0207679_10019254 3300025945 Bacteria 4583
328 Ga0207679_10474961 3300025945 Unclassified 1112
329 Ga0207679_10637464 3300025945 Bacteria 963
330 Ga0207679_10778491 3300025945 Unclassified 871
331 Ga0207651_10093401 3300025960 Bacteria 2209
332 Ga0207651_10193663 3300025960 Bacteria 1623
333 Ga0207651_10202920 3300025960 Bacteria 1590
334 Ga0207651_10210063 3300025960 Bacteria 1566
335 Ga0207651_10394254 3300025960 Bacteria 1176
336 Ga0207651_10595856 3300025960 Unclassified 965
337 Ga0207651_11146945 3300025960 Bacteria 697
338 Ga0207712_10250949 3300025961 Bacteria 1430
339 Ga0207712_10358784 3300025961 Bacteria 1214
340 Ga0207668_10302826 3300025972 Unclassified 1320
341 Ga0207640_10224266 3300025981 Bacteria 1441
342 Ga0207658_10391992 3300025986 Unclassified 1219
343 Ga0207677_10481054 3300026023 Bacteria 1070
344 Ga0207677_12038962 3300026023 Unclassified 533
345 Ga0207703_10024969 3300026035 Bacteria 4701
346 Ga0207703_10037653 3300026035 Bacteria 3854
347 Ga0207703_10073578 3300026035 Bacteria 2827
348 Ga0207703_10243108 3300026035 Bacteria 1619
349 Ga0207678_10689299 3300026067 Bacteria 899
350 Ga0207708_10004413 3300026075 Bacteria 10368
351 Ga0207708_10020511 3300026075 Bacteria 4985
352 Ga0207708_10116975 3300026075 Bacteria 2074
353 Ga0207708_10131395 3300026075 Bacteria 1958
354 Ga0207708_10207494 3300026075 Bacteria 1565
355 Ga0207708_10607443 3300026075 Bacteria 927
356 Ga0207641_10220698 3300026088 Bacteria 1758
357 Ga0207641_10512193 3300026088 Bacteria 1166
358 Ga0207641_11460738 3300026088 Unclassified 685
359 Ga0207641_11707798 3300026088 Unclassified 631
360 Ga0207648_10000163 3300026089 Bacteria 68352
361 Ga0207648_10739813 3300026089 Bacteria 913
362 Ga0207676_10057118 3300026095 Bacteria 3072
363 Ga0207674_10212610 3300026116 Unclassified 1883
364 Ga0207674_10234044 3300026116 Unclassified 1785
365 Ga0207674_10905405 3300026116 Bacteria 850
366 Ga0207675_100067702 3300026118 Bacteria 3338
367 Ga0207683_10020507 3300026121 Bacteria 5653
368 Ga0207683_10332832 3300026121 Bacteria 1392
369 Ga0207683_10421144 3300026121 Bacteria 1230
370 Ga0207683_10633777 3300026121 Bacteria 990
371 Ga0207428_10068167 3300027907 Unclassified 2799
372 Ga0207428_10575902 3300027907 Unclassified 813
373 Ga0268266_10700475 3300028379 Bacteria 976
374 Ga0268265_10001766 3300028380 Bacteria 17361
375 Ga0268265_10055807 3300028380 Bacteria 3003
376 Ga0268264_10012144 3300028381 Bacteria 7091
377 Ga0268264_10065174 3300028381 Bacteria 3068
378 Ga0307408_100028493 3300031548 Bacteria 3859
379 Ga0307408_100435405 3300031548 Bacteria 1134
380 Ga0307408_100703147 3300031548 Bacteria 909
381 Ga0307405_10003284 3300031731 Bacteria 7391
382 Ga0307413_11581679 3300031824 Bacteria 582
383 Ga0307410_10007953 3300031852 Bacteria 5846
384 Ga0307410_10120643 3300031852 Bacteria 1911
385 Ga0307410_10319662 3300031852 Bacteria 1231
386 Ga0307406_10004525 3300031901 Bacteria 7573
387 Ga0307406_10068766 3300031901 Unclassified 2313
388 Ga0307406_10190251 3300031901 Bacteria 1502
389 Ga0307407_10040713 3300031903 Bacteria 2593
390 Ga0307412_10039812 3300031911 Bacteria 3037
391 Ga0307412_10409078 3300031911 Bacteria 1107
392 Ga0307409_100011949 3300031995 Bacteria 5504
393 Ga0307409_100017865 3300031995 Bacteria 4744
394 Ga0307416_100053070 3300032002 Bacteria 3250
395 Ga0307416_101862953 3300032002 Unclassified 705
396 Ga0307414_10070353 3300032004 Bacteria 2519
397 Ga0307411_10032184 3300032005 Bacteria 3237
398 Ga0307411_10060230 3300032005 Bacteria 2520
399 Ga0307411_10145212 3300032005 Bacteria 1755
400 Ga0307415_100008041 3300032126 Bacteria 5819
401 Ga0307415_100049232 3300032126 Bacteria 2848
402 Ga0307415_100307509 3300032126 Bacteria 1316
403 Ga0373930_0061462 3300034816 Bacteria 839
404 Ga0373932_0029468 3300035112 Bacteria 1515
405 Ga0373931_0085690 3300035691 Bacteria 1747
406 Ga0373935_0471031 3300035692 Bacteria 909
407 Ga0373935_0523233 3300035692 Unclassified 863
408 Ga0373937_0056847 3300036401 Bacteria 3593
409 Ga0373925_0128041 3300037068 Unclassified 1977
410 Ga0373925_0580157 3300037068 Unclassified 923
411 Ga0439439_0047462 3300041406 Bacteria 1122
412 Ga0451853_0716243 3300041512 Unclassified 605
413 Ga0439446_0134070 3300042156 Unclassified 805
414 Ga0451577_0233274 3300042876 Bacteria 1664
415 Ga0453683_0168532 3300044673 Unclassified 1387
416 Ga0451576_0017464 3300045051 Bacteria 7888
417 Ga0451576_0083459 3300045051 Bacteria 3324
418 Ga0495639_0353914 3300046475 Unclassified 737
419 Ga0495584_0093839 3300046491 Bacteria 1514
420 Ga0495594_0822250 3300046499 Bacteria 523
421 Ga0495607_0434439 3300046501 Unclassified 592
422 Ga0495644_0177578 3300046523 Bacteria 818
423 Ga0495663_0198565 3300046525 Unclassified 699
424 Ga0495642_0018400 3300046528 Bacteria 2735
425 Ga0495642_0168505 3300046528 Bacteria 951
426 Ga0495598_0021029 3300046537 Unclassified 1730
427 Ga0495598_0100706 3300046537 Bacteria 956
428 Ga0495598_0131620 3300046537 Unclassified 858
429 Ga0495621_0115543 3300046539 Bacteria 1033
430 Ga0495621_0391849 3300046539 Bacteria 588
431 Ga0495621_0552694 3300046539 Bacteria 500
432 Ga0495645_0401766 3300046543 Bacteria 873
433 Ga0495659_0006671 3300046664 Bacteria 3647
434 Ga0495659_0083000 3300046664 Bacteria 1219
435 Ga0495588_0023061 3300046674 Bacteria 3078
436 Ga0495647_0175171 3300046681 Unclassified 931
437 Ga0495658_0007615 3300046683 Bacteria 5367
438 Ga0495669_0428718 3300046684 Unclassified 642
439 Ga0495636_0006501 3300047318 Bacteria 4594
440 Ga0495636_0252786 3300047318 Unclassified 815
441 Ga0495675_0364937 3300047444 Bacteria 847
442 Ga0495685_021159 3300047447 Bacteria 2237
443 Ga0495593_0356306 3300047673 Bacteria 731
444 Ga0495615_0132048 3300048090 Bacteria 731
445 Ga0496100_1102813 3300048903 Bacteria 625
446 Ga0496110_0497730 3300048913 Bacteria 1110
447 Ga0501041_0354946 3300049577 Unclassified 927
448 Ga0501249_095009 3300049679 Bacteria 710
449 Ga0501081_1429774 3300049743 Unclassified 525
450 nmdc:mga05p37_239985_c1 3300050507 Bacteria 2180
451 nmdc:mga05p37_240733_c1 3300050507 Bacteria 2176
452 nmdc:mga05p37_4324_c1 3300050507 Bacteria 16595
453 nmdc:mga05p37_55453_c1 3300050507 Unclassified 4877
454 nmdc:mga05p37_78691_c1 3300050507 Bacteria 4060
455 nmdc:mga0qj67_10090_c1 3300050509 Bacteria 7047
456 nmdc:mga0qj67_40459_c1 3300050509 Bacteria 3663
457 nmdc:mga0qj67_57699_c1 3300050509 Bacteria 3078
458 nmdc:mga06r32_108499_c1 3300050510 Unclassified 2729
459 nmdc:mga06r32_85101_c1 3300050510 Bacteria 3083
460 nmdc:mga08y16_159531_c1 3300050511 Unclassified 2343
461 nmdc:mga08y16_641152_c1 3300050511 Bacteria 1067
462 nmdc:mga08y16_8801_c1 3300050511 Bacteria 10596
463 nmdc:mga0n895_160137_c1 3300050512 Unclassified 2282
464 nmdc:mga0n895_21954_c1 3300050512 Bacteria 5979
465 nmdc:mga0n895_243169_c1 3300050512 Bacteria 1827
466 nmdc:mga0n895_469119_c1 3300050512 Unclassified 1270
467 nmdc:mga0rr50_42736_c1 3300050513 Bacteria 3312
468 nmdc:mga0rr50_510349_c1 3300050513 Bacteria 1023
469 nmdc:mga0a205_35723_c1 3300050515 Unclassified 4772
470 nmdc:mga0a205_760382_c1 3300050515 Bacteria 817
471 nmdc:mga0a205_92938_c1 3300050515 Unclassified 2915
472 Ga0590077_058768 3300059426 Unclassified 870
473 Ga0307405_10079875
474 SwRhRL2b_contig_3453121
475 JGI24749J21850_1013473
476 Ga0065704_10002104
477 Ga0065707_10000779
478 Ga0065707_10011772
479 Ga0070676_10041466
480 Ga0070676_10895134
481 Ga0070683_100142372
482 Ga0070690_100006250
483 Ga0070690_100131268
484 Ga0070690_100182936
485 Ga0070690_100463226
486 Ga0070670_100109160
487 Ga0070670_100157989
488 Ga0070670_100217468
489 Ga0070670_100988813
490 Ga0070677_10263011
491 Ga0070677_10330452
492 Ga0068869_100004693
493 Ga0068869_100057864
494 Ga0068869_101405434
495 Ga0070666_10113260
496 Ga0070680_100222020
497 Ga0070680_100762967
498 Ga0068868_100486729
499 Ga0068868_100526337
500 Ga0068868_100551697
501 Ga0070689_100019768
502 Ga0070689_100071372
503 Ga0070689_100086672
504 Ga0070691_10033468
505 Ga0070691_10088529
506 Ga0070687_100006068
507 Ga0070661_100048653
508 Ga0070692_10138144
509 Ga0070669_100060953
510 Ga0070669_100172588
511 Ga0070669_100184017
512 Ga0070669_100641342
513 Ga0070675_100000179
514 Ga0070675_100000385
515 Ga0070675_100036995
516 Ga0070675_100040445
517 Ga0070675_100044497
518 Ga0070675_100105558
519 Ga0070675_100256174
520 Ga0070675_100269475
521 Ga0070675_100426287
522 Ga0070671_100041554
523 Ga0070671_100711561
524 Ga0070674_100108699
525 Ga0070674_100320222
526 Ga0070674_100473006
527 Ga0070674_100955219
528 Ga0070673_100011470
529 Ga0070673_100068204
530 Ga0070673_100075369
531 Ga0070673_100104892
532 Ga0070673_100119518
533 Ga0070673_100472086
534 Ga0070673_101371512
535 Ga0070673_102163147
536 Ga0070688_100155596
537 Ga0070688_100177203
538 Ga0070688_100345731
539 Ga0070667_100267069
540 Ga0070701_10003515
541 Ga0070701_10017741
542 Ga0070701_10352420
543 Ga0070701_10467587
544 Ga0070705_100002416
545 Ga0070705_100009832
546 Ga0070705_100171474
547 Ga0070705_100424163
548 Ga0070700_100006002
549 Ga0070700_100080314
550 Ga0070700_100112932
551 Ga0070700_100184960
552 Ga0070694_100006985
553 Ga0070694_100035015
554 Ga0070694_100312037
555 Ga0070694_100703489
556 Ga0070663_101224424
557 Ga0070678_100227617
558 Ga0070678_100463924
559 Ga0070678_101142933
560 Ga0070681_10059056
561 Ga0070681_10088699
562 Ga0070681_11248285
563 Ga0068867_100001397
564 Ga0070706_100262256
565 Ga0070706_100325104
566 Ga0070706_100410347
567 Ga0070706_101191507
568 Ga0070707_100245471
569 Ga0070698_100056751
570 Ga0070698_100116770
571 Ga0070698_100234325
572 Ga0070698_100300070
573 Ga0070698_101571753
574 Ga0070699_100001411
575 Ga0070699_100004666
576 Ga0070699_100554476
577 Ga0070699_100601587
578 Ga0070679_100826262
579 Ga0070684_100132724
580 Ga0070684_100720359
581 Ga0070697_100076187
582 Ga0070697_100765855
583 Ga0070672_100080995
584 Ga0070672_100145081
585 Ga0070672_100193793
586 Ga0070686_100014511
587 Ga0070686_100086569
588 Ga0070686_100138253
589 Ga0070686_100423322
590 Ga0070695_100002507
591 Ga0070695_100121670
592 Ga0070695_100319897
593 Ga0070695_100711056
594 Ga0070696_100002271
595 Ga0070696_100008521
596 Ga0070696_100699353
597 Ga0070665_100624067
598 Ga0070704_100000234
599 Ga0070704_100017244
600 Ga0070704_100157446
601 Ga0070704_100208500
602 Ga0070664_100005188
603 Ga0070664_100031280
604 Ga0070664_100111904
605 Ga0070664_100154958
606 Ga0070664_100837207
607 Ga0068857_100035721
608 Ga0068857_100066468
609 Ga0068857_100160775
610 Ga0068857_100339336
611 Ga0068857_101685566
612 Ga0068854_100159060
613 Ga0068854_100525796
614 Ga0070702_100024904
615 Ga0070702_100070063
616 Ga0070702_100281443
617 Ga0068859_100068116
618 Ga0068859_100084259
619 Ga0068859_100180287
620 Ga0068859_100595437
621 Ga0068859_100890764
622 Ga0068864_100014662
623 Ga0068864_100050135
624 Ga0068866_10015220
625 Ga0068861_100125230
626 Ga0068861_100313615
627 Ga0068870_10016718
628 Ga0068870_10032235
629 Ga0068870_10040307
630 Ga0068870_10193668
631 Ga0068870_10275866
632 Ga0068863_100025032
633 Ga0068863_100929257
634 Ga0068863_101072450
635 Ga0068863_101808355
636 Ga0068863_101829376
637 Ga0068858_100020312
638 Ga0068858_100115223
639 Ga0068858_100134993
640 Ga0068860_100008479
641 Ga0068860_100042011
642 Ga0075432_10119413
643 Ga0097621_100156671
644 Ga0097621_100205853
645 Ga0068871_100105025
646 Ga0068871_100522479
647 Ga0068871_100850959
648 Ga0075428_100004797
649 Ga0075428_100005791
650 Ga0075428_100046978
651 Ga0075430_100043062
652 Ga0075430_100133597
653 Ga0075431_100023210
654 Ga0075431_100103491
655 Ga0075433_10262662
656 Ga0075433_10906094
657 Ga0075434_100005962
658 Ga0075434_100070794
659 Ga0075434_100562838
660 Ga0075429_100021057
661 Ga0075429_100145348
662 Ga0075429_101286685
663 Ga0068865_100045457
664 Ga0068865_100318394
665 Ga0068865_100385832
666 Ga0097620_100068116
667 Ga0097620_100084257
668 Ga0097620_100180296
669 Ga0097620_100595523
670 Ga0097620_100890795
671 Ga0075435_100007149
672 Ga0075435_100021144
673 Ga0075435_100025329
674 Ga0111539_10057049
675 Ga0111539_10291050
676 Ga0105245_11390309
677 Ga0114129_10000428
678 Ga0114129_10003809
679 Ga0114129_10022531
680 Ga0114129_10035929
681 Ga0114129_10056610
682 Ga0105243_10037657
683 Ga0105243_10132561
684 Ga0105243_10284329
685 Ga0105243_10878343
686 Ga0105242_10003459
687 Ga0105242_10177493
688 Ga0105242_10292096
689 Ga0105242_10578559
690 Ga0105248_10150882
691 Ga0105248_10574432
692 Ga0105238_10214976
693 Ga0105249_10771234
694 Ga0105249_11127015
695 Ga0105246_10410615
696 Ga0157374_10975159
697 Ga0157374_12090485
698 Ga0157378_10783930
699 Ga0157375_10049405
700 Ga0157375_10156208
701 Ga0157375_10322254
702 Ga0157375_11406092
703 Ga0163163_10084117
704 Ga0163163_10305943
705 Ga0157380_10003246
706 Ga0157380_10048247
707 Ga0157380_10106861
708 Ga0157380_10114697
709 Ga0157380_10171891
710 Ga0157380_10267794
711 Ga0157380_10360139
712 Ga0157380_10497764
713 Ga0157380_10653945
714 Ga0157380_11092318
715 Ga0157377_10018614
716 Ga0157377_10151914
717 Ga0157377_10377249
718 Ga0157377_10721054
719 Ga0157376_10117185
720 Ga0157376_10383128
721 Ga0157376_10420363
722 Ga0163161_10298232
723 Ga0207697_10513909
724 Ga0207682_10023239
725 Ga0207682_10216504
726 Ga0207642_10383256
727 Ga0207710_10135681
728 Ga0207688_10069292
729 Ga0207688_10611252
730 Ga0207680_10362170
731 Ga0207680_10871860
732 Ga0207645_10004581
733 Ga0207645_10940971
734 Ga0207643_10039612
735 Ga0207643_10096066
736 Ga0207643_10118780
737 Ga0207643_10169405
738 Ga0207684_10355238
739 Ga0207684_10476932
740 Ga0207707_10133164
741 Ga0207707_11051179
742 Ga0207660_10029667
743 Ga0207660_11298398
744 Ga0207662_10003217
745 Ga0207662_10004389
746 Ga0207662_10079409
747 Ga0207646_10696287
748 Ga0207681_10034378
749 Ga0207681_10045352
750 Ga0207681_10101807
751 Ga0207681_10970143
752 Ga0207694_10135372
753 Ga0207650_10164321
754 Ga0207659_10000228
755 Ga0207659_10003371
756 Ga0207659_10004480
757 Ga0207659_10017165
758 Ga0207659_10021326
759 Ga0207659_10032413
760 Ga0207659_10049868
761 Ga0207659_10061178
762 Ga0207659_10128374
763 Ga0207644_10028084
764 Ga0207644_10132364
765 Ga0207690_10362679
766 Ga0207706_10003779
767 Ga0207706_10055348
768 Ga0207706_10598231
769 Ga0207686_10095103
770 Ga0207709_10042376
771 Ga0207709_10049682
772 Ga0207670_10007475
773 Ga0207670_10021611
774 Ga0207670_10082469
775 Ga0207669_10052573
776 Ga0207669_10090220
777 Ga0207669_10593596
778 Ga0207704_10017217
779 Ga0207704_10341462
780 Ga0207704_10495125
781 Ga0207704_11402781
782 Ga0207691_10008762
783 Ga0207691_10018655
784 Ga0207691_10021671
785 Ga0207691_10074984
786 Ga0207691_10089482
787 Ga0207691_10092269
788 Ga0207691_10097245
789 Ga0207691_10123893
790 Ga0207691_10245358
791 Ga0207691_11314592
792 Ga0207711_10740969
793 Ga0207689_10002683
794 Ga0207689_10089207
795 Ga0207689_10184954
796 Ga0207689_10225630
797 Ga0207689_10669190
798 Ga0207661_10414427
799 Ga0207679_10019254
800 Ga0207679_10474961
801 Ga0207679_10637464
802 Ga0207679_10778491
803 Ga0207651_10093401
804 Ga0207651_10193663
805 Ga0207651_10202920
806 Ga0207651_10210063
807 Ga0207651_10394254
808 Ga0207651_10595856
809 Ga0207651_11146945
810 Ga0207712_10250949
811 Ga0207712_10358784
812 Ga0207668_10302826
813 Ga0207640_10224266
814 Ga0207658_10391992
815 Ga0207677_10481054
816 Ga0207677_12038962
817 Ga0207703_10024969
818 Ga0207703_10037653
819 Ga0207703_10073578
820 Ga0207703_10243108
821 Ga0207678_10689299
822 Ga0207708_10004413
823 Ga0207708_10020511
824 Ga0207708_10116975
825 Ga0207708_10131395
826 Ga0207708_10207494
827 Ga0207708_10607443
828 Ga0207641_10220698
829 Ga0207641_10512193
830 Ga0207641_11460738
831 Ga0207641_11707798
832 Ga0207648_10000163
833 Ga0207648_10739813
834 Ga0207676_10057118
835 Ga0207674_10212610
836 Ga0207674_10234044
837 Ga0207674_10905405
838 Ga0207675_100067702
839 Ga0207683_10020507
840 Ga0207683_10332832
841 Ga0207683_10421144
842 Ga0207683_10633777
843 Ga0207428_10068167
844 Ga0207428_10575902
845 Ga0268266_10700475
846 Ga0268265_10001766
847 Ga0268265_10055807
848 Ga0268264_10012144
849 Ga0268264_10065174
850 Ga0307408_100028493
851 Ga0307408_100435405
852 Ga0307408_100703147
853 Ga0307405_10003284
854 Ga0307413_11581679
855 Ga0307410_10007953
856 Ga0307410_10120643
857 Ga0307410_10319662
858 Ga0307406_10004525
859 Ga0307406_10068766
860 Ga0307406_10190251
861 Ga0307407_10040713
862 Ga0307412_10039812
863 Ga0307412_10409078
864 Ga0307409_100011949
865 Ga0307409_100017865
866 Ga0307416_100053070
867 Ga0307416_101862953
868 Ga0307414_10070353
869 Ga0307411_10032184
870 Ga0307411_10060230
871 Ga0307411_10145212
872 Ga0307415_100008041
873 Ga0307415_100049232
874 Ga0307415_100307509
875 Ga0373930_0061462
876 Ga0373932_0029468
877 Ga0373931_0085690
878 Ga0373935_0471031
879 Ga0373935_0523233
880 Ga0373937_0056847
881 Ga0373925_0128041
882 Ga0373925_0580157
883 Ga0439439_0047462
884 Ga0451853_0716243
885 Ga0439446_0134070
886 Ga0451577_0233274
887 Ga0453683_0168532
888 Ga0451576_0017464
889 Ga0451576_0083459
890 Ga0495639_0353914
891 Ga0495584_0093839
892 Ga0495594_0822250
893 Ga0495607_0434439
894 Ga0495644_0177578
895 Ga0495663_0198565
896 Ga0495642_0018400
897 Ga0495642_0168505
898 Ga0495598_0021029
899 Ga0495598_0100706
900 Ga0495598_0131620
901 Ga0495621_0115543
902 Ga0495621_0391849
903 Ga0495621_0552694
904 Ga0495645_0401766
905 Ga0495659_0006671
906 Ga0495659_0083000
907 Ga0495588_0023061
908 Ga0495647_0175171
909 Ga0495658_0007615
910 Ga0495669_0428718
911 Ga0495636_0006501
912 Ga0495636_0252786
913 Ga0495675_0364937
914 Ga0495685_021159
915 Ga0495593_0356306
916 Ga0495615_0132048
917 Ga0496100_1102813
918 Ga0496110_0497730
919 Ga0501041_0354946
920 Ga0501249_095009
921 Ga0501081_1429774
922 nmdc:mga05p37_239985_c1
923 nmdc:mga05p37_240733_c1
924 nmdc:mga05p37_4324_c1
925 nmdc:mga05p37_55453_c1
926 nmdc:mga05p37_78691_c1
927 nmdc:mga0qj67_10090_c1
928 nmdc:mga0qj67_40459_c1
929 nmdc:mga0qj67_57699_c1
930 nmdc:mga06r32_108499_c1
931 nmdc:mga06r32_85101_c1
932 nmdc:mga08y16_159531_c1
933 nmdc:mga08y16_641152_c1
934 nmdc:mga08y16_8801_c1
935 nmdc:mga0n895_160137_c1
936 nmdc:mga0n895_21954_c1
937 nmdc:mga0n895_243169_c1
938 nmdc:mga0n895_469119_c1
939 nmdc:mga0rr50_42736_c1
940 nmdc:mga0rr50_510349_c1
941 nmdc:mga0a205_35723_c1
942 nmdc:mga0a205_760382_c1
943 nmdc:mga0a205_92938_c1
944 Ga0590077_058768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

7

82

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v9p-assembly1.cif.gz_A crystal structure of the transposition protein tniq 0.8839 6 34
6jni-assembly3.cif.gz_E crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8451 7 79
5gpe-assembly1.cif.gz_B crystal structure of the transcription regulator pbrr691 from ralstonia metallidurans ch34 in complex with lead(ii) 0.8339 7 88
6jgw-assembly1.cif.gz_A crystal structure of the transcriptional regulator cadr from p. putida in complex with dna 0.8295 7 85
6jgw-assembly1.cif.gz_B crystal structure of the transcriptional regulator cadr from p. putida in complex with dna 0.8292 7 85
ID Description Score Start End Superfamily
af_Q2G2L8_2_138_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8555 6 80 1.10.1660.10
1exjA02 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8344 4 77 1.10.1660.10
af_A0A0G2L4M0_217_291_3.30.720.50 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8039 98 120 3.30.720.50
af_P0ACS5_1_128_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8019 7 90 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8015 6 78 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A521SY93-F1-model_v4 MerR family transcriptional regulator 0.9295 1 149 GO:0003677
GO:0006355
AF-A0A7W1YS96-F1-model_v4 MerR family transcriptional regulator 0.9159 1 149 GO:0003677
GO:0003700
AF-A0A1F2TAN1-F1-model_v4 HTH merR-type domain-containing protein 0.9146 1 156 GO:0003677
GO:0003700
AF-A0A521SY93-F1-model_v4 MerR family transcriptional regulator 0.9119 1 149 GO:0003677
GO:0006355
AF-A0A7W1YS96-F1-model_v4 MerR family transcriptional regulator 0.91 1 149 GO:0003677
GO:0003700

Map