F450834

General Info

Members Datasets Scaffolds Average Seq Length
472 262 944 135

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10027817|Ga0307405_100278173
Length 154
Sequence VQAAASRISVHVVAGWLVWTLIAVALAVGEMFTPGLFFLGPVALAALAAAVTAALGGGVGLALIVFIAGSVASLALIRPIARRHVRMPAISRTGTDALVGSKAVVIRRVDADGGRVRIGGEEWSARSFLEDQVLDEGARVEVVKIEGATALVVE

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
189 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 8.47
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10027817 3300031731 Bacteria 3285
2 JGI24740J21852_10045058 3300001979 Bacteria 1304
3 JGI24739J22299_10031338 3300001989 Bacteria 1838
4 JGI24739J22299_10054057 3300001989 Bacteria 1287
5 JGI24737J22298_10033527 3300001990 Bacteria 1595
6 rootL2_10137172 3300003322 Bacteria 1176
7 Ga0070690_100018530 3300005330 Bacteria 4207
8 Ga0070670_101189632 3300005331 Bacteria 696
9 Ga0068869_100686019 3300005334 Bacteria 872
10 Ga0070680_100155671 3300005336 Bacteria 1920
11 Ga0070680_100922743 3300005336 Bacteria 753
12 Ga0070680_101123982 3300005336 Unclassified 679
13 Ga0070682_100092527 3300005337 Bacteria 1981
14 Ga0068868_100102932 3300005338 Bacteria 2313
15 Ga0068868_100121554 3300005338 Bacteria 2130
16 Ga0070660_100041439 3300005339 Bacteria 3510
17 Ga0070660_100072294 3300005339 Bacteria 2695
18 Ga0070660_100681112 3300005339 Bacteria 862
19 Ga0070689_100092483 3300005340 Bacteria 2386
20 Ga0070691_10144779 3300005341 Bacteria 1214
21 Ga0070687_100057274 3300005343 Bacteria 2043
22 Ga0070661_100086152 3300005344 Bacteria 2322
23 Ga0070692_10024429 3300005345 Bacteria 2969
24 Ga0070675_100293287 3300005354 Bacteria 1432
25 Ga0070671_100282216 3300005355 Bacteria 1412
26 Ga0070674_100081961 3300005356 Bacteria 2306
27 Ga0070688_100015975 3300005365 Bacteria 4282
28 Ga0070659_100024184 3300005366 Bacteria 4655
29 Ga0070659_100043920 3300005366 Bacteria 3496
30 Ga0070703_10013345 3300005406 Bacteria 2333
31 Ga0070709_10082126 3300005434 Bacteria 2105
32 Ga0070714_100079267 3300005435 Bacteria 2855
33 Ga0070714_100810651 3300005435 Bacteria 907
34 Ga0070713_100135211 3300005436 Bacteria 2178
35 Ga0070710_10006612 3300005437 Bacteria 5574
36 Ga0070701_10025402 3300005438 Bacteria 2876
37 Ga0070711_100072673 3300005439 Bacteria 2427
38 Ga0070711_100092306 3300005439 Bacteria 2184
39 Ga0070705_100041164 3300005440 Bacteria 2632
40 Ga0070705_101360071 3300005440 Unclassified 590
41 Ga0070700_100311323 3300005441 Bacteria 1153
42 Ga0070700_100752145 3300005441 Bacteria 780
43 Ga0070694_100445448 3300005444 Bacteria 1021
44 Ga0070694_100537705 3300005444 Bacteria 934
45 Ga0070708_100508462 3300005445 Bacteria 1136
46 Ga0070708_100729616 3300005445 Bacteria 932
47 Ga0070663_100474941 3300005455 Bacteria 1034
48 Ga0070663_101499928 3300005455 Bacteria 599
49 Ga0070662_101800514 3300005457 Bacteria 529
50 Ga0070681_10130947 3300005458 Unclassified 2440
51 Ga0070681_10545080 3300005458 Unclassified 1074
52 Ga0068867_100002259 3300005459 Bacteria 13546
53 Ga0070685_10009756 3300005466 Bacteria 4976
54 Ga0070706_100005941 3300005467 Bacteria 11541
55 Ga0070706_100037596 3300005467 Bacteria 4470
56 Ga0070706_100056651 3300005467 Bacteria 3616
57 Ga0070706_100652584 3300005467 Bacteria 977
58 Ga0070707_100002726 3300005468 Bacteria 16796
59 Ga0070707_100284164 3300005468 Bacteria 1608
60 Ga0070707_100293913 3300005468 Bacteria 1578
61 Ga0070707_101033969 3300005468 Bacteria 787
62 Ga0070707_101539685 3300005468 Bacteria 632
63 Ga0070707_101743135 3300005468 Unclassified 590
64 Ga0070698_100001818 3300005471 Bacteria 23727
65 Ga0070698_100029669 3300005471 Bacteria 5678
66 Ga0070698_100371299 3300005471 Unclassified 1363
67 Ga0070698_100944387 3300005471 Bacteria 809
68 Ga0070699_100019920 3300005518 Bacteria 5782
69 Ga0070699_100047689 3300005518 Bacteria 3707
70 Ga0070699_100152021 3300005518 Bacteria 2048
71 Ga0070699_100161346 3300005518 Bacteria 1984
72 Ga0070679_100051949 3300005530 Bacteria 4083
73 Ga0070679_100942719 3300005530 Bacteria 807
74 Ga0070684_100028777 3300005535 Bacteria 4702
75 Ga0070684_100044712 3300005535 Bacteria 3831
76 Ga0070684_100204376 3300005535 Bacteria 1799
77 Ga0070697_100035028 3300005536 Bacteria 4049
78 Ga0068853_100089165 3300005539 Bacteria 2709
79 Ga0068853_100090062 3300005539 Bacteria 2696
80 Ga0070672_100150912 3300005543 Bacteria 1922
81 Ga0070686_100007321 3300005544 Bacteria 6152
82 Ga0070695_100471025 3300005545 Unclassified 966
83 Ga0070696_100027566 3300005546 Bacteria 3872
84 Ga0070696_100085088 3300005546 Bacteria 2244
85 Ga0070696_100242090 3300005546 Bacteria 1361
86 Ga0070693_100331699 3300005547 Bacteria 1036
87 Ga0070665_100289036 3300005548 Bacteria 1642
88 Ga0070665_100323660 3300005548 Bacteria 1546
89 Ga0070704_100022217 3300005549 Bacteria 4125
90 Ga0070704_100698574 3300005549 Bacteria 899
91 Ga0068855_100030544 3300005563 Bacteria 6443
92 Ga0068855_100198181 3300005563 Bacteria 2262
93 Ga0068855_100314952 3300005563 Bacteria 1731
94 Ga0068855_101143048 3300005563 Unclassified 812
95 Ga0070664_100123046 3300005564 Bacteria 2273
96 Ga0070664_100416736 3300005564 Bacteria 1230
97 Ga0068857_100007298 3300005577 Bacteria 9520
98 Ga0068857_100064141 3300005577 Bacteria 3266
99 Ga0068857_100137325 3300005577 Bacteria 2208
100 Ga0068857_100478702 3300005577 Bacteria 1166
101 Ga0068854_100108842 3300005578 Bacteria 2088
102 Ga0068854_100426334 3300005578 Unclassified 1103
103 Ga0068854_100651283 3300005578 Bacteria 904
104 Ga0068854_102274859 3300005578 Bacteria 502
105 Ga0068856_100081553 3300005614 Bacteria 3209
106 Ga0068856_100227251 3300005614 Bacteria 1882
107 Ga0068856_100489468 3300005614 Bacteria 1251
108 Ga0070702_100007496 3300005615 Bacteria 5230
109 Ga0068852_100132049 3300005616 Bacteria 2300
110 Ga0068859_102704204 3300005617 Bacteria 545
111 Ga0068861_100019189 3300005719 Bacteria 4884
112 Ga0068851_10727963 3300005834 Bacteria 612
113 Ga0068863_100376015 3300005841 Bacteria 1387
114 Ga0068863_101573029 3300005841 Bacteria 666
115 Ga0068860_100304401 3300005843 Bacteria 1562
116 Ga0068860_100346472 3300005843 Bacteria 1461
117 Ga0068862_101210297 3300005844 Bacteria 754
118 Ga0081455_10142111 3300005937 Bacteria 1863
119 Ga0081540_1002817 3300005983 Bacteria 14079
120 Ga0070717_11091397 3300006028 Bacteria 727
121 Ga0075365_10018581 3300006038 Bacteria 4276
122 Ga0075364_10181087 3300006051 Bacteria 1426
123 Ga0075432_10036759 3300006058 Bacteria 1703
124 Ga0070716_100084911 3300006173 Bacteria 1900
125 Ga0070716_100365642 3300006173 Bacteria 1026
126 Ga0070712_100076612 3300006175 Bacteria 2408
127 Ga0097621_100048535 3300006237 Bacteria 3444
128 Ga0097621_101790606 3300006237 Bacteria 585
129 Ga0068871_100085977 3300006358 Bacteria 2612
130 Ga0075428_100198511 3300006844 Bacteria 2169
131 Ga0075433_10163320 3300006852 Bacteria 1982
132 Ga0075433_10263492 3300006852 Bacteria 1528
133 Ga0068865_100002937 3300006881 Bacteria 10166
134 Ga0075436_100017642 3300006914 Bacteria 4886
135 Ga0097620_102704191 3300006931 Bacteria 545
136 Ga0075435_100155275 3300007076 Bacteria 1925
137 Ga0105240_10062051 3300009093 Bacteria 4655
138 Ga0105240_10872836 3300009093 Bacteria 970
139 Ga0111539_10425438 3300009094 Bacteria 1547
140 Ga0111539_10489687 3300009094 Bacteria 1432
141 Ga0111539_11792389 3300009094 Bacteria 712
142 Ga0105245_10006470 3300009098 Bacteria 10302
143 Ga0105245_10192131 3300009098 Bacteria 1956
144 Ga0105245_10766161 3300009098 Bacteria 1001
145 Ga0105245_11312358 3300009098 Bacteria 773
146 Ga0114129_10014214 3300009147 Bacteria 11342
147 Ga0114129_10032679 3300009147 Bacteria 7352
148 Ga0114129_10122757 3300009147 Bacteria 3574
149 Ga0105243_10102900 3300009148 Bacteria 2374
150 Ga0105241_10051462 3300009174 Bacteria 3141
151 Ga0105242_10151394 3300009176 Bacteria 2023
152 Ga0105242_10284199 3300009176 Bacteria 1504
153 Ga0105248_10079751 3300009177 Bacteria 3679
154 Ga0105237_10040512 3300009545 Bacteria 4697
155 Ga0105237_10079165 3300009545 Bacteria 3276
156 Ga0105238_10162080 3300009551 Bacteria 2212
157 Ga0105238_10220892 3300009551 Unclassified 1871
158 Ga0105249_10014222 3300009553 Bacteria 7037
159 Ga0105239_10140250 3300010375 Bacteria 2693
160 Ga0105239_10225667 3300010375 Bacteria 2101
161 Ga0105239_10546962 3300010375 Bacteria 1318
162 Ga0105246_10113109 3300011119 Bacteria 1998
163 Ga0157370_10535010 3300013104 Bacteria 1075
164 Ga0157369_10036917 3300013105 Bacteria 5352
165 Ga0157369_10220636 3300013105 Bacteria 1985
166 Ga0157369_11121122 3300013105 Bacteria 804
167 Ga0157374_10104254 3300013296 Bacteria 2722
168 Ga0157374_10148005 3300013296 Bacteria 2282
169 Ga0157378_10056990 3300013297 Bacteria 3482
170 Ga0163162_10004079 3300013306 Bacteria 14016
171 Ga0157372_10032515 3300013307 Bacteria 5722
172 Ga0157372_10098398 3300013307 Bacteria 3337
173 Ga0157372_10202054 3300013307 Bacteria 2302
174 Ga0157372_10269612 3300013307 Bacteria 1978
175 Ga0157372_11679110 3300013307 Bacteria 731
176 Ga0157372_12366653 3300013307 Bacteria 610
177 Ga0157380_10013152 3300014326 Bacteria 6026
178 Ga0157377_10147010 3300014745 Bacteria 1454
179 Ga0157377_10373430 3300014745 Bacteria 963
180 Ga0157377_10509318 3300014745 Bacteria 843
181 Ga0157376_10243770 3300014969 Bacteria 1675
182 Ga0206356_11075455 3300020070 Bacteria 1234
183 Ga0206353_10935311 3300020082 Bacteria 1522
184 Ga0213871_10221125 3300021441 Bacteria 595
185 Ga0224712_10118362 3300022467 Bacteria 1144
186 Ga0207653_10008014 3300025885 Bacteria 3292
187 Ga0207688_10136428 3300025901 Bacteria 1441
188 Ga0207680_10044902 3300025903 Bacteria 2602
189 Ga0207647_10006582 3300025904 Bacteria 8441
190 Ga0207647_10050207 3300025904 Bacteria 2584
191 Ga0207699_10005805 3300025906 Bacteria 5939
192 Ga0207705_10007156 3300025909 Bacteria 8224
193 Ga0207684_10008813 3300025910 Bacteria 8956
194 Ga0207684_10015079 3300025910 Bacteria 6653
195 Ga0207684_10035845 3300025910 Bacteria 4211
196 Ga0207684_10343015 3300025910 Bacteria 1286
197 Ga0207684_10409110 3300025910 Bacteria 1166
198 Ga0207654_10146373 3300025911 Bacteria 1512
199 Ga0207707_10123887 3300025912 Bacteria 2260
200 Ga0207695_10198784 3300025913 Bacteria 1920
201 Ga0207695_10838629 3300025913 Bacteria 799
202 Ga0207693_10017111 3300025915 Bacteria 5784
203 Ga0207693_10023693 3300025915 Bacteria 4871
204 Ga0207693_10430443 3300025915 Bacteria 1031
205 Ga0207663_10018347 3300025916 Bacteria 3920
206 Ga0207663_10122184 3300025916 Bacteria 1785
207 Ga0207660_10317246 3300025917 Bacteria 1244
208 Ga0207660_10771846 3300025917 Bacteria 784
209 Ga0207662_10098406 3300025918 Bacteria 1810
210 Ga0207657_10017254 3300025919 Bacteria 6930
211 Ga0207657_10024981 3300025919 Bacteria 5520
212 Ga0207657_10264808 3300025919 Bacteria 1367
213 Ga0207649_10014592 3300025920 Bacteria 4402
214 Ga0207652_10250599 3300025921 Bacteria 1597
215 Ga0207652_10586197 3300025921 Bacteria 1001
216 Ga0207646_10028310 3300025922 Bacteria 5102
217 Ga0207646_10265927 3300025922 Bacteria 1550
218 Ga0207646_10695142 3300025922 Bacteria 910
219 Ga0207646_10725558 3300025922 Bacteria 888
220 Ga0207646_10895166 3300025922 Bacteria 787
221 Ga0207694_10160988 3300025924 Bacteria 1813
222 Ga0207694_10900205 3300025924 Archaea 748
223 Ga0207650_10911109 3300025925 Bacteria 747
224 Ga0207659_10271659 3300025926 Bacteria 1383
225 Ga0207687_10065416 3300025927 Bacteria 2582
226 Ga0207687_10461912 3300025927 Bacteria 1054
227 Ga0207664_10334782 3300025929 Bacteria 1337
228 Ga0207664_10444574 3300025929 Bacteria 1156
229 Ga0207664_10695312 3300025929 Bacteria 914
230 Ga0207644_10017578 3300025931 Bacteria 4834
231 Ga0207644_10532386 3300025931 Bacteria 971
232 Ga0207690_10035871 3300025932 Bacteria 3208
233 Ga0207706_10401187 3300025933 Unclassified 1189
234 Ga0207686_10312364 3300025934 Bacteria 1171
235 Ga0207709_10002251 3300025935 Bacteria 12281
236 Ga0207670_10101472 3300025936 Bacteria 2056
237 Ga0207669_10005600 3300025937 Bacteria 5655
238 Ga0207704_10016942 3300025938 Bacteria 3762
239 Ga0207665_10014953 3300025939 Bacteria 5098
240 Ga0207665_10127948 3300025939 Bacteria 1800
241 Ga0207691_10001755 3300025940 Bacteria 21340
242 Ga0207661_10013257 3300025944 Bacteria 6018
243 Ga0207661_10037204 3300025944 Bacteria 3805
244 Ga0207661_10174105 3300025944 Bacteria 1875
245 Ga0207679_10007330 3300025945 Bacteria 6991
246 Ga0207667_10148129 3300025949 Bacteria 2416
247 Ga0207667_10199265 3300025949 Bacteria 2054
248 Ga0207667_10257304 3300025949 Bacteria 1785
249 Ga0207667_10717998 3300025949 Bacteria 1001
250 Ga0207712_10290365 3300025961 Bacteria 1338
251 Ga0207668_10040602 3300025972 Bacteria 3141
252 Ga0207668_10117994 3300025972 Bacteria 2004
253 Ga0207640_10145485 3300025981 Bacteria 1734
254 Ga0207640_10234778 3300025981 Bacteria 1413
255 Ga0207640_11656351 3300025981 Bacteria 577
256 Ga0207658_10145674 3300025986 Bacteria 1923
257 Ga0207677_10363574 3300026023 Unclassified 1216
258 Ga0207639_10011610 3300026041 Bacteria 6121
259 Ga0207678_10190831 3300026067 Bacteria 1751
260 Ga0207678_10270770 3300026067 Bacteria 1456
261 Ga0207678_10920268 3300026067 Bacteria 773
262 Ga0207708_10001895 3300026075 Bacteria 15451
263 Ga0207708_11299926 3300026075 Bacteria 637
264 Ga0207702_10221434 3300026078 Bacteria 1763
265 Ga0207702_10229464 3300026078 Bacteria 1734
266 Ga0207702_10248459 3300026078 Bacteria 1669
267 Ga0207702_10666775 3300026078 Bacteria 1024
268 Ga0207641_11983014 3300026088 Bacteria 583
269 Ga0207648_10001479 3300026089 Bacteria 25851
270 Ga0207676_10572597 3300026095 Bacteria 1082
271 Ga0207674_10000833 3300026116 Bacteria 40230
272 Ga0207674_10055138 3300026116 Bacteria 4044
273 Ga0207674_10113546 3300026116 Bacteria 2682
274 Ga0207674_10166066 3300026116 Bacteria 2161
275 Ga0207675_100023162 3300026118 Bacteria 5775
276 Ga0207675_100637036 3300026118 Bacteria 1071
277 Ga0207683_10000336 3300026121 Bacteria 42739
278 Ga0207698_10042891 3300026142 Bacteria 3385
279 Ga0207698_11856068 3300026142 Bacteria 618
280 Ga0268266_10133511 3300028379 Bacteria 2222
281 Ga0268264_10333448 3300028381 Bacteria 1438
282 Ga0268264_11087774 3300028381 Bacteria 808
283 Ga0265334_10007640 3300028573 Bacteria 4631
284 Ga0265322_10174835 3300028654 Bacteria 614
285 Ga0265338_10013049 3300028800 Bacteria 9420
286 Ga0265338_10026306 3300028800 Bacteria 5873
287 Ga0307406_10773411 3300031901 Bacteria 808
288 Ga0307406_11125746 3300031901 Bacteria 679
289 Ga0307409_100098341 3300031995 Bacteria 2420
290 Ga0307409_101142272 3300031995 Bacteria 801
291 Ga0307416_100927618 3300032002 Bacteria 972
292 Ga0307415_100172020 3300032126 Bacteria 1690
293 Ga0307415_100373017 3300032126 Bacteria 1209
294 Ga0307507_10257155 3300033179 Bacteria 1120
295 Ga0373929_0152538 3300035085 Bacteria 621
296 Ga0373952_0033155 3300035092 Bacteria 1158
297 Ga0373943_0404207 3300035170 Bacteria 789
298 Ga0373946_0314760 3300035171 Bacteria 776
299 Ga0373946_0380032 3300035171 Unclassified 710
300 Ga0373924_0339846 3300035410 Unclassified 669
301 Ga0373931_0386178 3300035691 Bacteria 884
302 Ga0373935_0063129 3300035692 Bacteria 2374
303 Ga0373925_0095289 3300037068 Bacteria 2280
304 Ga0373925_1181267 3300037068 Bacteria 629
305 Ga0395899_0013772 3300037312 Bacteria 6182
306 Ga0395899_0030427 3300037312 Bacteria 4061
307 Ga0395899_0087538 3300037312 Bacteria 2260
308 Ga0395899_0136365 3300037312 Bacteria 1749
309 Ga0395900_0003596 3300037418 Bacteria 16662
310 Ga0395900_0005500 3300037418 Bacteria 13258
311 Ga0395900_0005602 3300037418 Bacteria 13138
312 Ga0395900_0105630 3300037418 Bacteria 2893
313 Ga0395900_0199256 3300037418 Bacteria 2027
314 Ga0395900_0273426 3300037418 Bacteria 1683
315 Ga0395900_0325770 3300037418 Bacteria 1515
316 Ga0395900_0528265 3300037418 Bacteria 1127
317 Ga0395900_0802406 3300037418 Bacteria 869
318 Ga0395900_1021290 3300037418 Bacteria 746
319 Ga0395900_1053309 3300037418 Bacteria 732
320 Ga0395898_0005497 3300037466 Bacteria 13684
321 Ga0395898_0011504 3300037466 Bacteria 9189
322 Ga0395898_0050871 3300037466 Bacteria 4053
323 Ga0395898_0234961 3300037466 Bacteria 1748
324 Ga0395898_0277274 3300037466 Bacteria 1599
325 Ga0395898_0345914 3300037466 Bacteria 1418
326 Ga0395898_0414126 3300037466 Bacteria 1284
327 Ga0395898_0425725 3300037466 Unclassified 1265
328 Ga0395898_0445724 3300037466 Unclassified 1233
329 Ga0395898_0467609 3300037466 Bacteria 1200
330 Ga0395905_0019443 3300037471 Bacteria 6439
331 Ga0395905_0023407 3300037471 Bacteria 5837
332 Ga0395905_0102077 3300037471 Bacteria 2692
333 Ga0395905_0354368 3300037471 Bacteria 1360
334 Ga0395905_1143322 3300037471 Bacteria 682
335 Ga0395901_0002813 3300038443 Bacteria 17572
336 Ga0395901_0007390 3300038443 Bacteria 11084
337 Ga0395901_0016010 3300038443 Bacteria 7639
338 Ga0395901_0037995 3300038443 Bacteria 4980
339 Ga0395901_0102950 3300038443 Bacteria 2996
340 Ga0395901_0120804 3300038443 Bacteria 2753
341 Ga0395901_0179448 3300038443 Bacteria 2221
342 Ga0395901_0255815 3300038443 Bacteria 1824
343 Ga0395901_0263984 3300038443 Bacteria 1791
344 Ga0395901_0272174 3300038443 Bacteria 1761
345 Ga0395901_0374207 3300038443 Bacteria 1467
346 Ga0395901_0478084 3300038443 Bacteria 1271
347 Ga0395901_0709457 3300038443 Bacteria 1003
348 Ga0436360_0723032 3300039438 Bacteria 2733
349 Ga0439453_0030748 3300041408 Bacteria 1016
350 Ga0451833_0019465 3300041491 Bacteria 504
351 Ga0439448_0010186 3300042005 Bacteria 2782
352 Ga0439450_127517 3300042008 Bacteria 658
353 Ga0439451_031642 3300042009 Bacteria 1063
354 Ga0466969_0264570 3300044656 Bacteria 779
355 Ga0466964_0046999 3300044706 Bacteria 1760
356 Ga0466971_0313421 3300044719 Bacteria 755
357 Ga0466970_0652341 3300044765 Unclassified 612
358 Ga0466957_0446361 3300044842 Unclassified 891
359 Ga0466967_0375109 3300045976 Bacteria 1380
360 Ga0466967_0535838 3300045976 Bacteria 1151
361 Ga0466967_0598482 3300045976 Bacteria 1088
362 Ga0466967_0779632 3300045976 Bacteria 949
363 Ga0466967_1408821 3300045976 Bacteria 694
364 Ga0495603_0040692 3300046455 Bacteria 2781
365 Ga0495641_0068475 3300046461 Bacteria 1596
366 Ga0495641_0106501 3300046461 Bacteria 1251
367 Ga0495580_0088173 3300046472 Bacteria 2161
368 Ga0495582_0119466 3300046473 Bacteria 1484
369 Ga0495582_0193594 3300046473 Bacteria 1160
370 Ga0495605_0236917 3300046474 Bacteria 784
371 Ga0495584_0132223 3300046491 Unclassified 1266
372 Ga0495584_0223410 3300046491 Bacteria 957
373 Ga0495584_0249839 3300046491 Bacteria 902
374 Ga0495585_0057138 3300046492 Bacteria 2154
375 Ga0495594_0033716 3300046499 Bacteria 2785
376 Ga0495596_0022835 3300046500 Bacteria 2544
377 Ga0495607_0319659 3300046501 Bacteria 725
378 Ga0495608_0201407 3300046511 Bacteria 1254
379 Ga0495608_0212670 3300046511 Unclassified 1215
380 Ga0495616_0256462 3300046513 Unclassified 750
381 Ga0495630_0010545 3300046517 Bacteria 6677
382 Ga0495630_0550091 3300046517 Bacteria 885
383 Ga0495637_0080620 3300046520 Unclassified 1298
384 Ga0495644_0190410 3300046523 Bacteria 790
385 Ga0495663_0009484 3300046525 Bacteria 2701
386 Ga0495663_0059511 3300046525 Bacteria 1199
387 Ga0495663_0152279 3300046525 Bacteria 790
388 Ga0495642_0124026 3300046528 Bacteria 1109
389 Ga0495642_0259851 3300046528 Bacteria 759
390 Ga0495665_0016807 3300046531 Bacteria 3939
391 Ga0495665_0517422 3300046531 Unclassified 600
392 Ga0495587_0132235 3300046536 Bacteria 1426
393 Ga0495656_0012078 3300046615 Bacteria 3182
394 Ga0495656_0048827 3300046615 Bacteria 1800
395 Ga0495668_0061346 3300046616 Bacteria 2074
396 Ga0495611_0138162 3300046648 Bacteria 1138
397 Ga0495659_0081976 3300046664 Bacteria 1225
398 Ga0495588_0230726 3300046674 Bacteria 977
399 Ga0495647_0031722 3300046681 Bacteria 1966
400 Ga0495658_0219270 3300046683 Bacteria 1190
401 Ga0495624_0256695 3300046690 Bacteria 1057
402 Ga0495624_0400206 3300046690 Bacteria 824
403 Ga0495671_0185658 3300046692 Bacteria 1010
404 Ga0495589_0034697 3300046794 Bacteria 2531
405 Ga0495589_0306284 3300046794 Bacteria 736
406 Ga0495581_0005821 3300047315 Bacteria 7148
407 Ga0495672_0047347 3300047320 Bacteria 2558
408 Ga0495676_0035458 3300047321 Bacteria 4172
409 Ga0495677_0014121 3300047445 Bacteria 2909
410 Ga0495685_051900 3300047447 Unclassified 1390
411 Ga0496100_0159616 3300048903 Bacteria 1615
412 Ga0496100_0725275 3300048903 Bacteria 776
413 Ga0496101_0020097 3300048904 Bacteria 4566
414 Ga0496101_0360317 3300048904 Bacteria 1143
415 Ga0496101_0517515 3300048904 Bacteria 943
416 Ga0496101_0947868 3300048904 Bacteria 677
417 Ga0496102_0010580 3300048905 Bacteria 7946
418 Ga0496102_0235985 3300048905 Bacteria 1724
419 Ga0496102_1185956 3300048905 Bacteria 683
420 Ga0496103_0003123 3300048906 Bacteria 10187
421 Ga0496103_0008734 3300048906 Bacteria 6012
422 Ga0496104_0469693 3300048907 Bacteria 1169
423 Ga0496104_1278794 3300048907 Bacteria 637
424 Ga0496105_0762187 3300048908 Bacteria 738
425 Ga0496106_0029743 3300048909 Bacteria 4072
426 Ga0496107_0012261 3300048910 Bacteria 5982
427 Ga0496108_0680548 3300048911 Bacteria 893
428 Ga0496109_0188401 3300048912 Bacteria 1938
429 Ga0496109_0206644 3300048912 Bacteria 1846
430 Ga0496109_0382668 3300048912 Bacteria 1329
431 Ga0496109_0442648 3300048912 Bacteria 1228
432 Ga0496109_1014810 3300048912 Bacteria 767
433 Ga0496110_0058426 3300048913 Bacteria 3397
434 Ga0496110_0082897 3300048913 Bacteria 2860
435 Ga0496110_0423805 3300048913 Bacteria 1213
436 Ga0496110_0461599 3300048913 Bacteria 1157
437 Ga0496111_0036806 3300048914 Bacteria 3500
438 Ga0496111_0040793 3300048914 Bacteria 3330
439 Ga0496111_0099690 3300048914 Bacteria 2134
440 Ga0496111_1244155 3300048914 Bacteria 526
441 Ga0496112_0049447 3300048915 Bacteria 4122
442 Ga0496112_0063085 3300048915 Bacteria 3655
443 Ga0496112_0098484 3300048915 Bacteria 2893
444 Ga0496112_0159202 3300048915 Bacteria 2224
445 Ga0496112_0598707 3300048915 Bacteria 1034
446 Ga0496113_0259620 3300048916 Bacteria 1388
447 Ga0496114_0015759 3300048917 Bacteria 6082
448 Ga0496114_0163505 3300048917 Bacteria 1937
449 Ga0496114_0255014 3300048917 Bacteria 1544
450 Ga0496115_0035618 3300048918 Bacteria 3938
451 Ga0501041_0682906 3300049577 Unclassified 657
452 Ga0501067_0224966 3300049583 Bacteria 1045
453 Ga0501074_0013143 3300049590 Bacteria 6020
454 Ga0501080_0415181 3300049742 Bacteria 1209
455 Ga0501083_0000346 3300049744 Bacteria 29280
456 nmdc:mga03n38_388227_c1 3300050490 Viruses 766
457 nmdc:mga00v17_242979_c1 3300050491 Bacteria 1167
458 nmdc:mga0yw44_19978_c1 3300050492 Bacteria 3707
459 nmdc:mga05p37_13294_c1 3300050507 Bacteria 9857
460 nmdc:mga05p37_35577_c1 3300050507 Bacteria 6107
461 nmdc:mga05p37_69637_c1 3300050507 Bacteria 4327
462 nmdc:mga09592_243533_c1 3300050508 Bacteria 1558
463 nmdc:mga08y16_1743103_c1 3300050511 Bacteria 577
464 nmdc:mga08y16_691842_c1 3300050511 Bacteria 1020
465 nmdc:mga0rr50_117209_c1 3300050513 Bacteria 2115
466 nmdc:mga08x19_171971_c1 3300050514 Bacteria 1476
467 nmdc:mga0a205_165917_c1 3300050515 Bacteria 2104
468 nmdc:mga0a205_166556_c1 3300050515 Bacteria 1262
469 nmdc:mga0a205_680234_c1 3300050515 Bacteria 879
470 Ga0495655_0087266 3300053083 Bacteria 903
471 Ga0501084_0224051 3300054114 Bacteria 1587
472 Ga0587113_005725 3300059625 Bacteria 1034
473 Ga0307405_10027817
474 JGI24740J21852_10045058
475 JGI24739J22299_10031338
476 JGI24739J22299_10054057
477 JGI24737J22298_10033527
478 rootL2_10137172
479 Ga0070690_100018530
480 Ga0070670_101189632
481 Ga0068869_100686019
482 Ga0070680_100155671
483 Ga0070680_100922743
484 Ga0070680_101123982
485 Ga0070682_100092527
486 Ga0068868_100102932
487 Ga0068868_100121554
488 Ga0070660_100041439
489 Ga0070660_100072294
490 Ga0070660_100681112
491 Ga0070689_100092483
492 Ga0070691_10144779
493 Ga0070687_100057274
494 Ga0070661_100086152
495 Ga0070692_10024429
496 Ga0070675_100293287
497 Ga0070671_100282216
498 Ga0070674_100081961
499 Ga0070688_100015975
500 Ga0070659_100024184
501 Ga0070659_100043920
502 Ga0070703_10013345
503 Ga0070709_10082126
504 Ga0070714_100079267
505 Ga0070714_100810651
506 Ga0070713_100135211
507 Ga0070710_10006612
508 Ga0070701_10025402
509 Ga0070711_100072673
510 Ga0070711_100092306
511 Ga0070705_100041164
512 Ga0070705_101360071
513 Ga0070700_100311323
514 Ga0070700_100752145
515 Ga0070694_100445448
516 Ga0070694_100537705
517 Ga0070708_100508462
518 Ga0070708_100729616
519 Ga0070663_100474941
520 Ga0070663_101499928
521 Ga0070662_101800514
522 Ga0070681_10130947
523 Ga0070681_10545080
524 Ga0068867_100002259
525 Ga0070685_10009756
526 Ga0070706_100005941
527 Ga0070706_100037596
528 Ga0070706_100056651
529 Ga0070706_100652584
530 Ga0070707_100002726
531 Ga0070707_100284164
532 Ga0070707_100293913
533 Ga0070707_101033969
534 Ga0070707_101539685
535 Ga0070707_101743135
536 Ga0070698_100001818
537 Ga0070698_100029669
538 Ga0070698_100371299
539 Ga0070698_100944387
540 Ga0070699_100019920
541 Ga0070699_100047689
542 Ga0070699_100152021
543 Ga0070699_100161346
544 Ga0070679_100051949
545 Ga0070679_100942719
546 Ga0070684_100028777
547 Ga0070684_100044712
548 Ga0070684_100204376
549 Ga0070697_100035028
550 Ga0068853_100089165
551 Ga0068853_100090062
552 Ga0070672_100150912
553 Ga0070686_100007321
554 Ga0070695_100471025
555 Ga0070696_100027566
556 Ga0070696_100085088
557 Ga0070696_100242090
558 Ga0070693_100331699
559 Ga0070665_100289036
560 Ga0070665_100323660
561 Ga0070704_100022217
562 Ga0070704_100698574
563 Ga0068855_100030544
564 Ga0068855_100198181
565 Ga0068855_100314952
566 Ga0068855_101143048
567 Ga0070664_100123046
568 Ga0070664_100416736
569 Ga0068857_100007298
570 Ga0068857_100064141
571 Ga0068857_100137325
572 Ga0068857_100478702
573 Ga0068854_100108842
574 Ga0068854_100426334
575 Ga0068854_100651283
576 Ga0068854_102274859
577 Ga0068856_100081553
578 Ga0068856_100227251
579 Ga0068856_100489468
580 Ga0070702_100007496
581 Ga0068852_100132049
582 Ga0068859_102704204
583 Ga0068861_100019189
584 Ga0068851_10727963
585 Ga0068863_100376015
586 Ga0068863_101573029
587 Ga0068860_100304401
588 Ga0068860_100346472
589 Ga0068862_101210297
590 Ga0081455_10142111
591 Ga0081540_1002817
592 Ga0070717_11091397
593 Ga0075365_10018581
594 Ga0075364_10181087
595 Ga0075432_10036759
596 Ga0070716_100084911
597 Ga0070716_100365642
598 Ga0070712_100076612
599 Ga0097621_100048535
600 Ga0097621_101790606
601 Ga0068871_100085977
602 Ga0075428_100198511
603 Ga0075433_10163320
604 Ga0075433_10263492
605 Ga0068865_100002937
606 Ga0075436_100017642
607 Ga0097620_102704191
608 Ga0075435_100155275
609 Ga0105240_10062051
610 Ga0105240_10872836
611 Ga0111539_10425438
612 Ga0111539_10489687
613 Ga0111539_11792389
614 Ga0105245_10006470
615 Ga0105245_10192131
616 Ga0105245_10766161
617 Ga0105245_11312358
618 Ga0114129_10014214
619 Ga0114129_10032679
620 Ga0114129_10122757
621 Ga0105243_10102900
622 Ga0105241_10051462
623 Ga0105242_10151394
624 Ga0105242_10284199
625 Ga0105248_10079751
626 Ga0105237_10040512
627 Ga0105237_10079165
628 Ga0105238_10162080
629 Ga0105238_10220892
630 Ga0105249_10014222
631 Ga0105239_10140250
632 Ga0105239_10225667
633 Ga0105239_10546962
634 Ga0105246_10113109
635 Ga0157370_10535010
636 Ga0157369_10036917
637 Ga0157369_10220636
638 Ga0157369_11121122
639 Ga0157374_10104254
640 Ga0157374_10148005
641 Ga0157378_10056990
642 Ga0163162_10004079
643 Ga0157372_10032515
644 Ga0157372_10098398
645 Ga0157372_10202054
646 Ga0157372_10269612
647 Ga0157372_11679110
648 Ga0157372_12366653
649 Ga0157380_10013152
650 Ga0157377_10147010
651 Ga0157377_10373430
652 Ga0157377_10509318
653 Ga0157376_10243770
654 Ga0206356_11075455
655 Ga0206353_10935311
656 Ga0213871_10221125
657 Ga0224712_10118362
658 Ga0207653_10008014
659 Ga0207688_10136428
660 Ga0207680_10044902
661 Ga0207647_10006582
662 Ga0207647_10050207
663 Ga0207699_10005805
664 Ga0207705_10007156
665 Ga0207684_10008813
666 Ga0207684_10015079
667 Ga0207684_10035845
668 Ga0207684_10343015
669 Ga0207684_10409110
670 Ga0207654_10146373
671 Ga0207707_10123887
672 Ga0207695_10198784
673 Ga0207695_10838629
674 Ga0207693_10017111
675 Ga0207693_10023693
676 Ga0207693_10430443
677 Ga0207663_10018347
678 Ga0207663_10122184
679 Ga0207660_10317246
680 Ga0207660_10771846
681 Ga0207662_10098406
682 Ga0207657_10017254
683 Ga0207657_10024981
684 Ga0207657_10264808
685 Ga0207649_10014592
686 Ga0207652_10250599
687 Ga0207652_10586197
688 Ga0207646_10028310
689 Ga0207646_10265927
690 Ga0207646_10695142
691 Ga0207646_10725558
692 Ga0207646_10895166
693 Ga0207694_10160988
694 Ga0207694_10900205
695 Ga0207650_10911109
696 Ga0207659_10271659
697 Ga0207687_10065416
698 Ga0207687_10461912
699 Ga0207664_10334782
700 Ga0207664_10444574
701 Ga0207664_10695312
702 Ga0207644_10017578
703 Ga0207644_10532386
704 Ga0207690_10035871
705 Ga0207706_10401187
706 Ga0207686_10312364
707 Ga0207709_10002251
708 Ga0207670_10101472
709 Ga0207669_10005600
710 Ga0207704_10016942
711 Ga0207665_10014953
712 Ga0207665_10127948
713 Ga0207691_10001755
714 Ga0207661_10013257
715 Ga0207661_10037204
716 Ga0207661_10174105
717 Ga0207679_10007330
718 Ga0207667_10148129
719 Ga0207667_10199265
720 Ga0207667_10257304
721 Ga0207667_10717998
722 Ga0207712_10290365
723 Ga0207668_10040602
724 Ga0207668_10117994
725 Ga0207640_10145485
726 Ga0207640_10234778
727 Ga0207640_11656351
728 Ga0207658_10145674
729 Ga0207677_10363574
730 Ga0207639_10011610
731 Ga0207678_10190831
732 Ga0207678_10270770
733 Ga0207678_10920268
734 Ga0207708_10001895
735 Ga0207708_11299926
736 Ga0207702_10221434
737 Ga0207702_10229464
738 Ga0207702_10248459
739 Ga0207702_10666775
740 Ga0207641_11983014
741 Ga0207648_10001479
742 Ga0207676_10572597
743 Ga0207674_10000833
744 Ga0207674_10055138
745 Ga0207674_10113546
746 Ga0207674_10166066
747 Ga0207675_100023162
748 Ga0207675_100637036
749 Ga0207683_10000336
750 Ga0207698_10042891
751 Ga0207698_11856068
752 Ga0268266_10133511
753 Ga0268264_10333448
754 Ga0268264_11087774
755 Ga0265334_10007640
756 Ga0265322_10174835
757 Ga0265338_10013049
758 Ga0265338_10026306
759 Ga0307406_10773411
760 Ga0307406_11125746
761 Ga0307409_100098341
762 Ga0307409_101142272
763 Ga0307416_100927618
764 Ga0307415_100172020
765 Ga0307415_100373017
766 Ga0307507_10257155
767 Ga0373929_0152538
768 Ga0373952_0033155
769 Ga0373943_0404207
770 Ga0373946_0314760
771 Ga0373946_0380032
772 Ga0373924_0339846
773 Ga0373931_0386178
774 Ga0373935_0063129
775 Ga0373925_0095289
776 Ga0373925_1181267
777 Ga0395899_0013772
778 Ga0395899_0030427
779 Ga0395899_0087538
780 Ga0395899_0136365
781 Ga0395900_0003596
782 Ga0395900_0005500
783 Ga0395900_0005602
784 Ga0395900_0105630
785 Ga0395900_0199256
786 Ga0395900_0273426
787 Ga0395900_0325770
788 Ga0395900_0528265
789 Ga0395900_0802406
790 Ga0395900_1021290
791 Ga0395900_1053309
792 Ga0395898_0005497
793 Ga0395898_0011504
794 Ga0395898_0050871
795 Ga0395898_0234961
796 Ga0395898_0277274
797 Ga0395898_0345914
798 Ga0395898_0414126
799 Ga0395898_0425725
800 Ga0395898_0445724
801 Ga0395898_0467609
802 Ga0395905_0019443
803 Ga0395905_0023407
804 Ga0395905_0102077
805 Ga0395905_0354368
806 Ga0395905_1143322
807 Ga0395901_0002813
808 Ga0395901_0007390
809 Ga0395901_0016010
810 Ga0395901_0037995
811 Ga0395901_0102950
812 Ga0395901_0120804
813 Ga0395901_0179448
814 Ga0395901_0255815
815 Ga0395901_0263984
816 Ga0395901_0272174
817 Ga0395901_0374207
818 Ga0395901_0478084
819 Ga0395901_0709457
820 Ga0436360_0723032
821 Ga0439453_0030748
822 Ga0451833_0019465
823 Ga0439448_0010186
824 Ga0439450_127517
825 Ga0439451_031642
826 Ga0466969_0264570
827 Ga0466964_0046999
828 Ga0466971_0313421
829 Ga0466970_0652341
830 Ga0466957_0446361
831 Ga0466967_0375109
832 Ga0466967_0535838
833 Ga0466967_0598482
834 Ga0466967_0779632
835 Ga0466967_1408821
836 Ga0495603_0040692
837 Ga0495641_0068475
838 Ga0495641_0106501
839 Ga0495580_0088173
840 Ga0495582_0119466
841 Ga0495582_0193594
842 Ga0495605_0236917
843 Ga0495584_0132223
844 Ga0495584_0223410
845 Ga0495584_0249839
846 Ga0495585_0057138
847 Ga0495594_0033716
848 Ga0495596_0022835
849 Ga0495607_0319659
850 Ga0495608_0201407
851 Ga0495608_0212670
852 Ga0495616_0256462
853 Ga0495630_0010545
854 Ga0495630_0550091
855 Ga0495637_0080620
856 Ga0495644_0190410
857 Ga0495663_0009484
858 Ga0495663_0059511
859 Ga0495663_0152279
860 Ga0495642_0124026
861 Ga0495642_0259851
862 Ga0495665_0016807
863 Ga0495665_0517422
864 Ga0495587_0132235
865 Ga0495656_0012078
866 Ga0495656_0048827
867 Ga0495668_0061346
868 Ga0495611_0138162
869 Ga0495659_0081976
870 Ga0495588_0230726
871 Ga0495647_0031722
872 Ga0495658_0219270
873 Ga0495624_0256695
874 Ga0495624_0400206
875 Ga0495671_0185658
876 Ga0495589_0034697
877 Ga0495589_0306284
878 Ga0495581_0005821
879 Ga0495672_0047347
880 Ga0495676_0035458
881 Ga0495677_0014121
882 Ga0495685_051900
883 Ga0496100_0159616
884 Ga0496100_0725275
885 Ga0496101_0020097
886 Ga0496101_0360317
887 Ga0496101_0517515
888 Ga0496101_0947868
889 Ga0496102_0010580
890 Ga0496102_0235985
891 Ga0496102_1185956
892 Ga0496103_0003123
893 Ga0496103_0008734
894 Ga0496104_0469693
895 Ga0496104_1278794
896 Ga0496105_0762187
897 Ga0496106_0029743
898 Ga0496107_0012261
899 Ga0496108_0680548
900 Ga0496109_0188401
901 Ga0496109_0206644
902 Ga0496109_0382668
903 Ga0496109_0442648
904 Ga0496109_1014810
905 Ga0496110_0058426
906 Ga0496110_0082897
907 Ga0496110_0423805
908 Ga0496110_0461599
909 Ga0496111_0036806
910 Ga0496111_0040793
911 Ga0496111_0099690
912 Ga0496111_1244155
913 Ga0496112_0049447
914 Ga0496112_0063085
915 Ga0496112_0098484
916 Ga0496112_0159202
917 Ga0496112_0598707
918 Ga0496113_0259620
919 Ga0496114_0015759
920 Ga0496114_0163505
921 Ga0496114_0255014
922 Ga0496115_0035618
923 Ga0501041_0682906
924 Ga0501067_0224966
925 Ga0501074_0013143
926 Ga0501080_0415181
927 Ga0501083_0000346
928 nmdc:mga03n38_388227_c1
929 nmdc:mga00v17_242979_c1
930 nmdc:mga0yw44_19978_c1
931 nmdc:mga05p37_13294_c1
932 nmdc:mga05p37_35577_c1
933 nmdc:mga05p37_69637_c1
934 nmdc:mga09592_243533_c1
935 nmdc:mga08y16_1743103_c1
936 nmdc:mga08y16_691842_c1
937 nmdc:mga0rr50_117209_c1
938 nmdc:mga08x19_171971_c1
939 nmdc:mga0a205_165917_c1
940 nmdc:mga0a205_166556_c1
941 nmdc:mga0a205_680234_c1
942 Ga0495655_0087266
943 Ga0501084_0224051
944 Ga0587113_005725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

65

154

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.9368 55 121
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.8936 55 121
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.876 59 124
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.8633 59 124
2exd-assembly1.cif.gz_A the solution structure of the c-terminal domain of a nfed homolog from pyrococcus horikoshii 0.8344 65 121
ID Description Score Start End Superfamily
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9876 64 121 2.40.50.140
3cp0A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9359 55 121 2.40.50.140
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9103 64 121 2.40.50.140
af_Q2FXZ8_166_227_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9035 59 121 2.40.50.140
3cp0A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8921 55 121 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6I5F7R2-F1-model_v4 deleted 0.9828 60 120
AF-A0A7R7DQG5-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.982 64 121
AF-A0A7G1IET6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9802 60 120
AF-A0A251WCY5-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9592 67 122 GO:0005886
AF-A0A256BL57-F1-model_v4 Uncharacterized protein 0.9548 65 123

Map