F450823

General Info

Members Datasets Scaffolds Average Seq Length
472 301 418 390

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10000919|Ga0207678_1000091922
Length 432
Sequence VRHHLARDSPDPAAAAKRSLSGACRPRGNPTGLPPEGARMTDVYILDAIRTPFGRYGGALAGVRPDDLAATVLKALQDRTDLDPSTVDEVTLGDANGAGEDNRNVARMAALLAGWPTTVPGSTVNRLCGSGLDAAIQASRAIQTGDASLVVAGGVESMTRSPLVMPKPEKAFPTGNQTLYNTALGWRMVNPAMPSQWTISLGESTEQLAERYGIGRDEQDAFAARSHVNAAKAWDEGFYDDLVVPVEGVDLARDEGIRPDSSPGKLAKLKPVFRKENGTVTAGNASPLNDGASALLLGDEKAASRLAKAPLARIAGRGAAGVDPDVFGIGPVRAAEIALERAGIGWDDLAAVELNEAFAAQSLACLRDWKDLDPEIVNTHGGAIAIGHPLGASGGRILGTLAHDLHRRGGGWGLAAICIGVGQGLAVVLEGR

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2582580736 Prauserella sp. Am3 Isolate Unclassified
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
10 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
11 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
12 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
13 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
14 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
15 2808606372 Agromyces sp. 23-23 Isolate Unclassified
16 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
17 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
18 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
19 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
20 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
21 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
22 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
23 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
24 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
25 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
26 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
27 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
28 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
29 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
30 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
31 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
32 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
33 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
34 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
35 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
36 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
37 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
38 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
39 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
40 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
41 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
42 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
43 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
44 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
45 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
46 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
47 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
48 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
49 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
179 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
182 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
183 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
184 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
298 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
299 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
300 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
301 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 0.21
Isolates 11.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0.21
Rhizoplane 6.99
Rhizosphere 80.3
Stem 0
Stem Tuber 0.21
Unclassified 11.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004406 3300000549 Bacteria 1836
2 Ga0070676_10114074 3300005328 Bacteria 1687
3 Ga0070683_100005529 3300005329 Bacteria 10561
4 Ga0070683_100038142 3300005329 Bacteria 4402
5 Ga0070683_100124042 3300005329 Bacteria 2441
6 Ga0070668_100005760 3300005347 Bacteria 9189
7 Ga0070668_100007289 3300005347 Bacteria 8205
8 Ga0070671_100243821 3300005355 Bacteria 1526
9 Ga0070673_100004143 3300005364 Bacteria 9131
10 Ga0070667_100000981 3300005367 Bacteria 26229
11 Ga0070709_10000725 3300005434 Bacteria 18629
12 Ga0070714_100014688 3300005435 Bacteria 6293
13 Ga0070713_100009098 3300005436 Bacteria 7085
14 Ga0070710_10000262 3300005437 Bacteria 25066
15 Ga0070710_10063456 3300005437 Bacteria 2110
16 Ga0070708_100004271 3300005445 Bacteria 11231
17 Ga0070708_100139596 3300005445 Bacteria 2247
18 Ga0070662_100088733 3300005457 Bacteria 2318
19 Ga0070679_100143959 3300005530 Bacteria 2362
20 Ga0070684_100007312 3300005535 Bacteria 8582
21 Ga0070697_100138770 3300005536 Bacteria 2043
22 Ga0068853_100013510 3300005539 Bacteria 6669
23 Ga0070672_100280508 3300005543 Bacteria 1408
24 Ga0068855_100030761 3300005563 Bacteria 6419
25 Ga0068855_100050425 3300005563 Bacteria 4905
26 Ga0070664_100139095 3300005564 Bacteria 2137
27 Ga0068864_100000090 3300005618 Bacteria 96213
28 Ga0068863_100000111 3300005841 Bacteria 86322
29 Ga0068863_100052956 3300005841 Bacteria 3846
30 Ga0068858_100040815 3300005842 Bacteria 4304
31 Ga0068860_100084521 3300005843 Bacteria 3019
32 Ga0068862_100001215 3300005844 Bacteria 24310
33 Ga0081455_10000018 3300005937 Bacteria 173683
34 Ga0081455_10001517 3300005937 Bacteria 28624
35 Ga0081455_10002654 3300005937 Bacteria 21166
36 Ga0081455_10008724 3300005937 Bacteria 10499
37 Ga0081455_10215950 3300005937 Bacteria 1425
38 Ga0081538_10000105 3300005981 Bacteria 83102
39 Ga0081538_10003982 3300005981 Bacteria 13760
40 Ga0081540_1000116 3300005983 Bacteria 84152
41 Ga0070717_10021904 3300006028 Bacteria 5042
42 Ga0075368_10048795 3300006042 Bacteria 1678
43 Ga0075432_10031551 3300006058 Bacteria 1834
44 Ga0070715_10008046 3300006163 Bacteria 3657
45 Ga0070716_100000106 3300006173 Bacteria 33206
46 Ga0070712_100001643 3300006175 Bacteria 13679
47 Ga0075367_10042124 3300006178 Bacteria 2671
48 Ga0097621_100049401 3300006237 Bacteria 3417
49 Ga0068871_100063930 3300006358 Bacteria 3011
50 Ga0075428_100024473 3300006844 Bacteria 6682
51 Ga0075428_100076248 3300006844 Bacteria 3661
52 Ga0075430_100011531 3300006846 Bacteria 7512
53 Ga0075431_100042265 3300006847 Bacteria 4700
54 Ga0075431_100097102 3300006847 Bacteria 3042
55 Ga0075433_10231945 3300006852 Bacteria 1639
56 Ga0075429_100017338 3300006880 Bacteria 6227
57 Ga0075429_100106776 3300006880 Bacteria 2446
58 Ga0105240_10414567 3300009093 Bacteria 1514
59 Ga0114129_10008044 3300009147 Bacteria 15023
60 Ga0114129_10124717 3300009147 Bacteria 3542
61 Ga0114129_10157283 3300009147 Bacteria 3107
62 Ga0114129_10191097 3300009147 Bacteria 2780
63 Ga0105243_10008571 3300009148 Bacteria 7845
64 Ga0105238_10109854 3300009551 Bacteria 2739
65 Ga0105249_10000781 3300009553 Bacteria 28555
66 Ga0105246_10004159 3300011119 Bacteria 8794
67 Ga0157371_10007104 3300013102 Bacteria 9099
68 Ga0157374_10003614 3300013296 Bacteria 13023
69 Ga0157378_10113746 3300013297 Bacteria 2485
70 Ga0157372_10276425 3300013307 Bacteria 1952
71 Ga0157375_10098378 3300013308 Bacteria 3002
72 Ga0182008_10004118 3300014497 Bacteria 8566
73 Ga0182008_10026547 3300014497 Bacteria 2937
74 Ga0157379_10077431 3300014968 Bacteria 2978
75 Ga0157376_10106133 3300014969 Bacteria 2464
76 Ga0182006_1031989 3300015261 Bacteria 2117
77 Ga0182007_10001803 3300015262 Bacteria 11169
78 Ga0206353_11352776 3300020082 Bacteria 3200
79 Ga0213876_10007887 3300021384 Bacteria 5775
80 Ga0213875_10017863 3300021388 Bacteria 3422
81 Ga0213875_10045357 3300021388 Bacteria 2063
82 Ga0207692_10007176 3300025898 Bacteria 4553
83 Ga0207688_10122737 3300025901 Bacteria 1517
84 Ga0207685_10004388 3300025905 Bacteria 3579
85 Ga0207699_10000228 3300025906 Bacteria 32185
86 Ga0207695_10352465 3300025913 Bacteria 1359
87 Ga0207693_10001196 3300025915 Bacteria 23192
88 Ga0207693_10004284 3300025915 Bacteria 12093
89 Ga0207694_10076946 3300025924 Bacteria 2614
90 Ga0207700_10000309 3300025928 Bacteria 28645
91 Ga0207700_10013286 3300025928 Bacteria 5350
92 Ga0207700_10076070 3300025928 Bacteria 2603
93 Ga0207664_10000203 3300025929 Bacteria 44815
94 Ga0207706_10081395 3300025933 Bacteria 2845
95 Ga0207709_10008093 3300025935 Bacteria 5823
96 Ga0207665_10000170 3300025939 Bacteria 44106
97 Ga0207691_10153351 3300025940 Bacteria 2025
98 Ga0207661_10002170 3300025944 Bacteria 13522
99 Ga0207661_10209870 3300025944 Bacteria 1716
100 Ga0207667_10045939 3300025949 Bacteria 4624
101 Ga0207712_10002686 3300025961 Bacteria 11357
102 Ga0207668_10008232 3300025972 Bacteria 6213
103 Ga0207668_10058186 3300025972 Bacteria 2700
104 Ga0207658_10001360 3300025986 Bacteria 19126
105 Ga0207677_10073945 3300026023 Bacteria 2416
106 Ga0207703_10125213 3300026035 Bacteria 2211
107 Ga0207639_10233554 3300026041 Bacteria 1595
108 Ga0207678_10000919 3300026067 Bacteria 26942
109 Ga0207641_10000062 3300026088 Bacteria 159982
110 Ga0207641_10061599 3300026088 Bacteria 3200
111 Ga0207648_10041792 3300026089 Bacteria 4027
112 Ga0207676_10000016 3300026095 Bacteria 311561
113 Ga0207683_10001855 3300026121 Bacteria 18682
114 Ga0207428_10061018 3300027907 Bacteria 2987
115 Ga0268266_10001670 3300028379 Bacteria 25565
116 Ga0268266_10030689 3300028379 Bacteria 4566
117 Ga0268265_10002977 3300028380 Bacteria 12390
118 Ga0307517_10084789 3300028786 Bacteria 2662
119 Ga0307515_10044547 3300028794 Bacteria 6850
120 Ga0316179_1022480 3300030734 Bacteria 1738
121 Ga0307408_100004011 3300031548 Bacteria 10037
122 Ga0307408_100094460 3300031548 Bacteria 2264
123 Ga0307408_100112926 3300031548 Bacteria 2090
124 Ga0265313_10046879 3300031595 Bacteria 2096
125 Ga0307508_10026174 3300031616 Bacteria 5287
126 Ga0307405_10122434 3300031731 Bacteria 1782
127 Ga0307405_10134834 3300031731 Bacteria 1712
128 Ga0307413_10013488 3300031824 Bacteria 4111
129 Ga0307518_10000734 3300031838 Bacteria 24656
130 Ga0307410_10233001 3300031852 Bacteria 1423
131 Ga0307407_10008713 3300031903 Bacteria 4675
132 Ga0307412_10016854 3300031911 Bacteria 4363
133 Ga0307412_10180722 3300031911 Bacteria 1586
134 Ga0307409_100006389 3300031995 Bacteria 6919
135 Ga0307409_100024613 3300031995 Bacteria 4203
136 Ga0307409_100029816 3300031995 Bacteria 3911
137 Ga0307409_100167093 3300031995 Bacteria 1932
138 Ga0307409_100261214 3300031995 Bacteria 1589
139 Ga0307416_100048116 3300032002 Bacteria 3381
140 Ga0307415_100006163 3300032126 Bacteria 6437
141 Ga0307507_10027718 3300033179 Bacteria 6061
142 Ga0307507_10155608 3300033179 Bacteria 1705
143 Ga0307510_10017620 3300033180 Bacteria 8418
144 Ga0373926_0037721 3300035083 Bacteria 1719
145 Ga0373953_0010603 3300035117 Bacteria 3214
146 Ga0373954_0015696 3300035118 Bacteria 3388
147 Ga0373924_0009004 3300035410 Bacteria 3648
148 Ga0373935_0044236 3300035692 Bacteria 2805
149 Ga0373933_0066814 3300035724 Bacteria 2180
150 Ga0373925_0435917 3300037068 Bacteria 1072
151 Ga0395899_0008495 3300037312 Bacteria 7911
152 Ga0395899_0064913 3300037312 Bacteria 2683
153 Ga0395900_0016476 3300037418 Bacteria 7537
154 Ga0395900_0026703 3300037418 Bacteria 5911
155 Ga0395898_0096044 3300037466 Bacteria 2847
156 Ga0395905_0050553 3300037471 Bacteria 3894
157 Ga0436364_0462954 3300037853 Bacteria 21686
158 Ga0436364_0648770 3300037853 Bacteria 1939
159 Ga0436364_0801981 3300037853 Bacteria 2218
160 Ga0436364_0861621 3300037853 Bacteria 10615
161 Ga0436364_1065157 3300037853 Bacteria 8792
162 Ga0395901_0050588 3300038443 Bacteria 4316
163 Ga0436365_0890828 3300039437 Bacteria 3971
164 Ga0436365_1335065 3300039437 Bacteria 10076
165 Ga0436360_0824491 3300039438 Bacteria 3839
166 Ga0436363_1329056 3300039450 Bacteria 4991
167 Ga0436363_1507532 3300039450 Bacteria 1597
168 Ga0436362_0595419 3300039453 Bacteria 2071
169 Ga0439439_0009512 3300041406 Bacteria 2313
170 Ga0439433_0016242 3300041999 Bacteria 1648
171 Ga0439442_000251 3300042002 Bacteria 13066
172 Ga0439442_000621 3300042002 Bacteria 7630
173 Ga0439448_0024848 3300042005 Bacteria 1876
174 Ga0439450_004969 3300042008 Bacteria 2308
175 Ga0439454_006078 3300042011 Bacteria 1470
176 Ga0439457_000678 3300042014 Bacteria 10054
177 Ga0450920_000344 3300042122 Bacteria 7121
178 Ga0450920_006255 3300042122 Bacteria 2137
179 Ga0450894_000535 3300042131 Bacteria 6434
180 Ga0450896_000154 3300042133 Bacteria 5486
181 Ga0450898_000306 3300042134 Bacteria 5523
182 Ga0450899_000813 3300042135 Bacteria 3560
183 Ga0450906_001479 3300042145 Bacteria 5124
184 Ga0450907_000232 3300042146 Bacteria 19464
185 Ga0439434_0000012 3300042435 Bacteria 46644
186 Ga0439464_0016441 3300042439 Bacteria 2000
187 Ga0450918_001397 3300042531 Bacteria 4820
188 Ga0439440_0010197 3300042993 Bacteria 1959
189 Ga0439440_0017038 3300042993 Bacteria 1597
190 Ga0466969_0000729 3300044656 Bacteria 17780
191 Ga0466969_0043791 3300044656 Bacteria 2229
192 Ga0466972_0034437 3300044658 Bacteria 2481
193 Ga0466965_0047051 3300044683 Bacteria 2136
194 Ga0466966_0003315 3300044684 Bacteria 10609
195 Ga0466966_0039702 3300044684 Bacteria 3031
196 Ga0466966_0135051 3300044684 Bacteria 1509
197 Ga0466961_0010333 3300044693 Bacteria 5951
198 Ga0466963_0074860 3300044694 Bacteria 2284
199 Ga0466963_0140653 3300044694 Bacteria 1672
200 Ga0466964_0076712 3300044706 Bacteria 1426
201 Ga0453684_0381709 3300044712 Bacteria 1582
202 Ga0466971_0007606 3300044719 Bacteria 4724
203 Ga0466970_0114017 3300044765 Bacteria 1477
204 Ga0466959_0001482 3300045049 Bacteria 14384
205 Ga0466959_0076542 3300045049 Bacteria 2416
206 Ga0466958_0039763 3300045836 Bacteria 2826
207 Ga0466958_0222097 3300045836 Bacteria 1205
208 Ga0466967_0008798 3300045976 Bacteria 7441
209 Ga0466967_0050556 3300045976 Bacteria 3640
210 Ga0466967_0078473 3300045976 Bacteria 2974
211 Ga0466967_0143766 3300045976 Bacteria 2223
212 Ga0466967_0237750 3300045976 Bacteria 1736
213 Ga0466967_0531574 3300045976 Bacteria 1156
214 Ga0495592_0049050 3300046454 Bacteria 3139
215 Ga0495603_0000304 3300046455 Bacteria 26268
216 Ga0495629_0103473 3300046459 Bacteria 1986
217 Ga0495641_0011916 3300046461 Bacteria 4906
218 Ga0495641_0050489 3300046461 Bacteria 1901
219 Ga0495650_0000321 3300046471 Bacteria 85831
220 Ga0495580_0011554 3300046472 Bacteria 6830
221 Ga0495580_0027418 3300046472 Bacteria 4144
222 Ga0495608_0036454 3300046511 Bacteria 3311
223 Ga0495608_0061653 3300046511 Bacteria 2466
224 Ga0495618_0021602 3300046514 Bacteria 3968
225 Ga0495620_0009288 3300046515 Bacteria 5236
226 Ga0495628_0000664 3300046516 Bacteria 31528
227 Ga0495628_0023178 3300046516 Bacteria 5098
228 Ga0495628_0044660 3300046516 Bacteria 3524
229 Ga0495630_0244637 3300046517 Bacteria 1370
230 Ga0495652_0017610 3300046529 Bacteria 6374
231 Ga0495640_0049268 3300046533 Bacteria 2906
232 Ga0495587_0039473 3300046536 Bacteria 2825
233 Ga0495645_0032507 3300046543 Bacteria 3806
234 Ga0495656_0000008 3300046615 Bacteria 226156
235 Ga0495656_0025556 3300046615 Bacteria 2342
236 Ga0495656_0074406 3300046615 Bacteria 1517
237 Ga0495659_0002665 3300046664 Bacteria 5747
238 Ga0495657_0038760 3300046675 Bacteria 3277
239 Ga0495623_0021519 3300046679 Bacteria 4164
240 Ga0495646_0020057 3300046680 Bacteria 4227
241 Ga0495624_0000123 3300046690 Bacteria 54291
242 Ga0495670_0001738 3300046691 Bacteria 10726
243 Ga0495671_0043514 3300046692 Bacteria 2254
244 Ga0495671_0084139 3300046692 Bacteria 1559
245 Ga0495600_0077883 3300046809 Bacteria 2165
246 Ga0495674_0037226 3300047319 Bacteria 4372
247 Ga0495672_0047200 3300047320 Bacteria 2563
248 Ga0495680_0068215 3300047322 Bacteria 2718
249 Ga0495675_0082210 3300047444 Bacteria 2028
250 Ga0495677_0058349 3300047445 Bacteria 1428
251 Ga0495685_026462 3300047447 Bacteria 1996
252 Ga0495684_0012449 3300047471 Bacteria 6557
253 Ga0495684_0070233 3300047471 Bacteria 2662
254 Ga0496100_0025279 3300048903 Bacteria 3631
255 Ga0496100_0161577 3300048903 Bacteria 1606
256 Ga0496101_0024168 3300048904 Bacteria 4203
257 Ga0496101_0039130 3300048904 Bacteria 3371
258 Ga0496102_0013717 3300048905 Bacteria 7027
259 Ga0496102_0076521 3300048905 Bacteria 3078
260 Ga0496102_0225984 3300048905 Bacteria 1765
261 Ga0496103_0009887 3300048906 Bacteria 5643
262 Ga0496103_0022626 3300048906 Bacteria 3784
263 Ga0496103_0085698 3300048906 Bacteria 1985
264 Ga0496103_0175301 3300048906 Bacteria 1378
265 Ga0496104_0022225 3300048907 Bacteria 5825
266 Ga0496104_0177477 3300048907 Bacteria 2040
267 Ga0496106_0000042 3300048909 Bacteria 106662
268 Ga0496106_0026972 3300048909 Bacteria 4277
269 Ga0496106_0307617 3300048909 Bacteria 1271
270 Ga0496107_0002875 3300048910 Bacteria 11381
271 Ga0496108_0188530 3300048911 Bacteria 1787
272 Ga0496108_0251197 3300048911 Bacteria 1538
273 Ga0496109_0079086 3300048912 Bacteria 3028
274 Ga0496109_0121093 3300048912 Bacteria 2438
275 Ga0496110_0089281 3300048913 Bacteria 2755
276 Ga0496111_0068672 3300048914 Bacteria 2576
277 Ga0496111_0103506 3300048914 Bacteria 2094
278 Ga0496111_0174485 3300048914 Bacteria 1598
279 Ga0496112_0005596 3300048915 Bacteria 10894
280 Ga0496112_0012906 3300048915 Bacteria 7695
281 Ga0496112_0060109 3300048915 Bacteria 3744
282 Ga0496112_0126291 3300048915 Bacteria 2529
283 Ga0496114_0015458 3300048917 Bacteria 6138
284 Ga0496114_0053377 3300048917 Bacteria 3369
285 Ga0496114_0342669 3300048917 Bacteria 1322
286 Ga0496115_0248743 3300048918 Bacteria 1464
287 Ga0496117_0001190 3300048920 Bacteria 39141
288 Ga0496117_0008134 3300048920 Bacteria 10024
289 Ga0496117_0023217 3300048920 Bacteria 4952
290 Ga0496118_0005181 3300048921 Bacteria 14921
291 Ga0496121_0014807 3300048924 Bacteria 8235
292 Ga0496122_0002381 3300048925 Bacteria 26910
293 Ga0496123_0035917 3300048926 Bacteria 3524
294 Ga0501031_0000031 3300049568 Bacteria 80355
295 Ga0501031_0015388 3300049568 Bacteria 4967
296 Ga0501032_0000095 3300049569 Bacteria 74407
297 Ga0501032_0003309 3300049569 Bacteria 12392
298 Ga0501032_0029977 3300049569 Bacteria 3731
299 Ga0501033_0000107 3300049570 Bacteria 80511
300 Ga0501033_0033843 3300049570 Bacteria 3836
301 Ga0501033_0049053 3300049570 Bacteria 3135
302 Ga0501033_0094600 3300049570 Bacteria 2185
303 Ga0501034_0000038 3300049571 Bacteria 237795
304 Ga0501034_0000070 3300049571 Bacteria 180933
305 Ga0501034_0000265 3300049571 Bacteria 94786
306 Ga0501034_0099761 3300049571 Bacteria 2898
307 Ga0501036_0000029 3300049572 Bacteria 93314
308 Ga0501036_0015155 3300049572 Bacteria 6438
309 Ga0501036_0018782 3300049572 Bacteria 5797
310 Ga0501036_0060776 3300049572 Bacteria 3200
311 Ga0501037_0000102 3300049573 Bacteria 80545
312 Ga0501037_0014005 3300049573 Bacteria 5908
313 Ga0501037_0030162 3300049573 Bacteria 4007
314 Ga0501038_0000084 3300049574 Bacteria 80521
315 Ga0501038_0053976 3300049574 Bacteria 3457
316 Ga0501038_0065898 3300049574 Bacteria 3085
317 Ga0501038_0101095 3300049574 Bacteria 2400
318 Ga0501038_0119493 3300049574 Bacteria 2175
319 Ga0501039_0011205 3300049575 Bacteria 6832
320 Ga0501039_0014212 3300049575 Bacteria 6095
321 Ga0501039_0016572 3300049575 Bacteria 5644
322 Ga0501039_0024371 3300049575 Bacteria 4647
323 Ga0501039_0218813 3300049575 Bacteria 1497
324 Ga0501040_0017468 3300049576 Bacteria 4761
325 Ga0501040_0018795 3300049576 Bacteria 4592
326 Ga0501040_0071619 3300049576 Bacteria 2393
327 Ga0501040_0191005 3300049576 Bacteria 1453
328 Ga0501041_0005186 3300049577 Bacteria 7606
329 Ga0501041_0019440 3300049577 Bacteria 4056
330 Ga0501041_0030512 3300049577 Bacteria 3254
331 Ga0501042_0034247 3300049578 Bacteria 3602
332 Ga0501042_0036950 3300049578 Bacteria 3465
333 Ga0501042_0087168 3300049578 Bacteria 2239
334 Ga0501043_0000094 3300049579 Bacteria 80510
335 Ga0501043_0027485 3300049579 Bacteria 4466
336 Ga0501043_0027897 3300049579 Bacteria 4432
337 Ga0501043_0033679 3300049579 Bacteria 4031
338 Ga0501043_0078642 3300049579 Bacteria 2591
339 Ga0501046_0000131 3300049580 Bacteria 80537
340 Ga0501046_0011997 3300049580 Bacteria 7394
341 Ga0501046_0022538 3300049580 Bacteria 5189
342 Ga0501047_0000125 3300049581 Bacteria 94038
343 Ga0501047_0002455 3300049581 Bacteria 17706
344 Ga0501047_0007969 3300049581 Bacteria 9989
345 Ga0501047_0029327 3300049581 Bacteria 5307
346 Ga0501048_0000011 3300049582 Bacteria 80518
347 Ga0501048_0008491 3300049582 Bacteria 7765
348 Ga0501048_0037883 3300049582 Bacteria 3463
349 Ga0501048_0085006 3300049582 Bacteria 2231
350 Ga0501068_0010772 3300049584 Bacteria 5141
351 Ga0501068_0023401 3300049584 Bacteria 3620
352 Ga0501068_0028230 3300049584 Bacteria 3317
353 Ga0501070_0000037 3300049586 Bacteria 122149
354 Ga0501070_0002235 3300049586 Bacteria 17015
355 Ga0501070_0007310 3300049586 Bacteria 9380
356 Ga0501071_0015674 3300049587 Bacteria 5204
357 Ga0501071_0016171 3300049587 Bacteria 5129
358 Ga0501072_0011407 3300049588 Bacteria 6792
359 Ga0501072_0046873 3300049588 Bacteria 3403
360 Ga0501072_0054095 3300049588 Bacteria 3162
361 Ga0501072_0128971 3300049588 Bacteria 2015
362 Ga0501073_0000138 3300049589 Bacteria 47547
363 Ga0501073_0002689 3300049589 Bacteria 13308
364 Ga0501073_0037342 3300049589 Bacteria 3450
365 Ga0501073_0105831 3300049589 Bacteria 1952
366 Ga0501074_0001652 3300049590 Bacteria 15136
367 Ga0501074_0018206 3300049590 Bacteria 5103
368 Ga0501074_0100993 3300049590 Bacteria 2065
369 Ga0501074_0167574 3300049590 Bacteria 1568
370 Ga0501075_0009579 3300049591 Bacteria 6782
371 Ga0501075_0280332 3300049591 Bacteria 1270
372 Ga0501076_0048833 3300049592 Bacteria 3344
373 Ga0501076_0055789 3300049592 Bacteria 3133
374 Ga0501076_0109799 3300049592 Bacteria 2229
375 Ga0501077_0031456 3300049593 Bacteria 3376
376 Ga0501077_0034289 3300049593 Bacteria 3230
377 Ga0501079_0000668 3300049741 Bacteria 22957
378 Ga0501079_0006802 3300049741 Bacteria 8608
379 Ga0501079_0008058 3300049741 Bacteria 7982
380 Ga0501079_0037797 3300049741 Bacteria 3721
381 Ga0501080_0001646 3300049742 Bacteria 18999
382 Ga0501080_0091075 3300049742 Bacteria 2832
383 Ga0501081_0012997 3300049743 Bacteria 5476
384 Ga0501081_0075712 3300049743 Bacteria 2350
385 Ga0501081_0139896 3300049743 Bacteria 1734
386 Ga0501083_0003381 3300049744 Bacteria 11173
387 Ga0501083_0003955 3300049744 Bacteria 10410
388 Ga0501035_0000166 3300049822 Bacteria 80886
389 Ga0501035_0039072 3300049822 Bacteria 4296
390 Ga0501035_0052948 3300049822 Bacteria 3631
391 Ga0501035_0074338 3300049822 Bacteria 3006
392 Ga0501044_0000169 3300049823 Bacteria 80507
393 Ga0501044_0035142 3300049823 Bacteria 5250
394 Ga0501044_0307514 3300049823 Bacteria 1512
395 Ga0501045_0001423 3300049824 Bacteria 15950
396 Ga0501045_0008357 3300049824 Bacteria 7209
397 Ga0501045_0028386 3300049824 Bacteria 4036
398 nmdc:mga05p37_31157_c1 3300050507 Bacteria 6514
399 nmdc:mga05p37_415260_c1 3300050507 Bacteria 1567
400 nmdc:mga06r32_89860_c1 3300050510 Bacteria 3000
401 nmdc:mga0n895_165302_c1 3300050512 Bacteria 2244
402 nmdc:mga0rr50_24836_c1 3300050513 Bacteria 4157
403 nmdc:mga0rr50_397361_c1 3300050513 Bacteria 1164
404 Ga0495601_0043351 3300053077 Bacteria 2826
405 Ga0495612_0086674 3300053078 Bacteria 1321
406 Ga0495655_0001302 3300053083 Bacteria 3840
407 Ga0495619_0000127 3300053085 Bacteria 55995
408 Ga0495619_0011079 3300053085 Bacteria 5670
409 Ga0500616_0001341 3300053153 Bacteria 24116
410 Ga0501084_0003395 3300054114 Bacteria 12906
411 Ga0501084_0033003 3300054114 Bacteria 4330
412 Ga0501084_0096681 3300054114 Bacteria 2480
413 Ga0501084_0109123 3300054114 Bacteria 2325
414 Ga0501082_0003584 3300060353 Bacteria 13557
415 Ga0501082_0004438 3300060353 Bacteria 12254
416 Ga0501082_0162935 3300060353 Bacteria 1938
417 Ga0530510_0009294 3300061734 Bacteria 6896
418 Ga0530510_0015246 3300061734 Bacteria 5428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0053976 Ga0501038_0053976_2367_3302 308
2 3300045976 Ga0466967_0531574 Ga0466967_0531574_179_1144 319
3 3300037068 Ga0373925_0435917 Ga0373925_0435917_16_987 321
4 3300044684 Ga0466966_0135051 Ga0466966_0135051_526_1497 321
5 3300049574 Ga0501038_0119493 Ga0501038_0119493_1153_2160 329
6 iso_pu_bacteria 2868088558 2868094274 338
7 3300005983 Ga0081540_1000116 Ga0081540_100011611 340
8 3300014497 Ga0182008_10026547 Ga0182008_100265473 341
9 3300048914 Ga0496111_0068672 Ga0496111_0068672_1510_2538 342
10 3300044712 Ga0453684_0381709 Ga0453684_0381709_11_1084 346
11 3300042008 Ga0439450_004969 Ga0439450_004969_1177_2259 347
12 3300042011 Ga0439454_006078 Ga0439454_006078_14_1096 347
13 3300049568 Ga0501031_0015388 Ga0501031_0015388_1269_2438 347
14 3300049591 Ga0501075_0280332 Ga0501075_0280332_151_1245 349
15 3300050513 nmdc:mga0rr50_397361_c1 nmdc:mga0rr50_397361_c1_18_1109 352
16 3300035410 Ga0373924_0009004 Ga0373924_0009004_18_1112 353
17 3300035692 Ga0373935_0044236 Ga0373935_0044236_1700_2794 353
18 3300046517 Ga0495630_0244637 Ga0495630_0244637_259_1353 353
19 3300047471 Ga0495684_0070233 Ga0495684_0070233_18_1112 353
20 3300053085 Ga0495619_0011079 Ga0495619_0011079_1449_2612 354
21 3300045836 Ga0466958_0222097 Ga0466958_0222097_115_1194 357
22 3300049569 Ga0501032_0003309 Ga0501032_0003309_2256_3458 358
23 3300049571 Ga0501034_0099761 Ga0501034_0099761_330_1532 358
24 3300049572 Ga0501036_0060776 Ga0501036_0060776_642_1844 358
25 3300049573 Ga0501037_0030162 Ga0501037_0030162_1928_3130 358
26 3300049574 Ga0501038_0065898 Ga0501038_0065898_1246_2448 358
27 3300049579 Ga0501043_0033679 Ga0501043_0033679_2393_3595 358
28 3300049581 Ga0501047_0029327 Ga0501047_0029327_982_2184 358
29 3300049586 Ga0501070_0007310 Ga0501070_0007310_2244_3446 358
30 3300049822 Ga0501035_0074338 Ga0501035_0074338_1530_2732 358
31 3300005457 Ga0070662_100088733 Ga0070662_1000887332 363
32 3300025933 Ga0207706_10081395 Ga0207706_100813953 363
33 3300048920 Ga0496117_0001190 Ga0496117_0001190_30548_31720 363
34 3300053077 Ga0495601_0043351 Ga0495601_0043351_461_1636 364
35 3300048914 Ga0496111_0174485 Ga0496111_0174485_22_1230 365
36 3300048905 Ga0496102_0076521 Ga0496102_0076521_756_1940 368
37 3300048906 Ga0496103_0009887 Ga0496103_0009887_3910_5094 368
38 3300048917 Ga0496114_0053377 Ga0496114_0053377_2055_3239 368
39 3300021384 Ga0213876_10007887 Ga0213876_100078876 369
40 3300031616 Ga0307508_10026174 Ga0307508_100261741 369
41 3300039437 Ga0436365_0890828 Ga0436365_0890828_146_1318 369
42 3300039453 Ga0436362_0595419 Ga0436362_0595419_140_1312 369
43 3300045976 Ga0466967_0008798 Ga0466967_0008798_5735_6919 369
44 3300048911 Ga0496108_0188530 Ga0496108_0188530_469_1638 369
45 3300049577 Ga0501041_0019440 Ga0501041_0019440_546_1742 369
46 3300049582 Ga0501048_0085006 Ga0501048_0085006_1002_2198 369
47 3300049588 Ga0501072_0046873 Ga0501072_0046873_328_1524 369
48 3300049592 Ga0501076_0048833 Ga0501076_0048833_2128_3324 369
49 3300049743 Ga0501081_0139896 Ga0501081_0139896_21_1217 369
50 3300049824 Ga0501045_0028386 Ga0501045_0028386_1059_2255 369
51 3300054114 Ga0501084_0096681 Ga0501084_0096681_268_1464 369
52 3300044683 Ga0466965_0047051 Ga0466965_0047051_82_1266 370
53 3300044706 Ga0466964_0076712 Ga0466964_0076712_63_1247 370
54 3300032002 Ga0307416_100048116 Ga0307416_1000481163 371
55 3300032126 Ga0307415_100006163 Ga0307415_1000061634 371
56 3300033179 Ga0307507_10155608 Ga0307507_101556082 371
57 3300005937 Ga0081455_10001517 Ga0081455_1000151718 372
58 3300048917 Ga0496114_0015458 Ga0496114_0015458_3026_4231 372
59 3300049570 Ga0501033_0033843 Ga0501033_0033843_1970_3154 372
60 3300049572 Ga0501036_0018782 Ga0501036_0018782_2521_3705 372
61 3300049573 Ga0501037_0014005 Ga0501037_0014005_3014_4198 372
62 3300049575 Ga0501039_0016572 Ga0501039_0016572_1933_3117 372
63 3300049576 Ga0501040_0017468 Ga0501040_0017468_1219_2403 372
64 3300049577 Ga0501041_0005186 Ga0501041_0005186_4472_5656 372
65 3300049578 Ga0501042_0034247 Ga0501042_0034247_605_1789 372
66 3300049579 Ga0501043_0027897 Ga0501043_0027897_10_1194 372
67 3300049580 Ga0501046_0011997 Ga0501046_0011997_1399_2583 372
68 3300049582 Ga0501048_0008491 Ga0501048_0008491_4694_5878 372
69 3300049584 Ga0501068_0028230 Ga0501068_0028230_26_1210 372
70 3300049587 Ga0501071_0016171 Ga0501071_0016171_3450_4634 372
71 3300049588 Ga0501072_0011407 Ga0501072_0011407_3675_4859 372
72 3300049590 Ga0501074_0018206 Ga0501074_0018206_3142_4326 372
73 3300049591 Ga0501075_0009579 Ga0501075_0009579_1952_3136 372
74 3300049592 Ga0501076_0055789 Ga0501076_0055789_1680_2864 372
75 3300049593 Ga0501077_0031456 Ga0501077_0031456_597_1781 372
76 3300049741 Ga0501079_0008058 Ga0501079_0008058_1716_2900 372
77 3300049743 Ga0501081_0012997 Ga0501081_0012997_2018_3202 372
78 3300049822 Ga0501035_0052948 Ga0501035_0052948_943_2127 372
79 3300049824 Ga0501045_0001423 Ga0501045_0001423_13258_14442 372
80 3300054114 Ga0501084_0033003 Ga0501084_0033003_1173_2357 372
81 3300060353 Ga0501082_0004438 Ga0501082_0004438_1950_3134 372
82 3300061734 Ga0530510_0009294 Ga0530510_0009294_2034_3218 372
83 3300005981 Ga0081538_10000105 Ga0081538_1000010566 373
84 3300039450 Ga0436363_1507532 Ga0436363_1507532_387_1556 373
85 3300031595 Ga0265313_10046879 Ga0265313_100468792 374
86 3300039450 Ga0436363_1329056 Ga0436363_1329056_2957_4135 374
87 3300048920 Ga0496117_0008134 Ga0496117_0008134_6972_8144 375
88 3300048920 Ga0496117_0023217 Ga0496117_0023217_286_1458 375
89 3300048921 Ga0496118_0005181 Ga0496118_0005181_3060_4232 375
90 iso_pu_bacteria 2895427314 2895430040 375
91 3300005543 Ga0070672_100280508 Ga0070672_1002805082 376
92 3300006042 Ga0075368_10048795 Ga0075368_100487951 376
93 3300025940 Ga0207691_10153351 Ga0207691_101533512 376
94 3300026089 Ga0207648_10041792 Ga0207648_100417925 376
95 3300005841 Ga0068863_100000111 Ga0068863_1000001113 377
96 3300013296 Ga0157374_10003614 Ga0157374_100036143 377
97 3300026088 Ga0207641_10000062 Ga0207641_10000062117 377
98 3300037853 Ga0436364_0861621 Ga0436364_0861621_3070_4248 377
99 3300046690 Ga0495624_0000123 Ga0495624_0000123_24853_26013 377
100 3300049588 Ga0501072_0128971 Ga0501072_0128971_54_1232 377
101 3300028786 Ga0307517_10084789 Ga0307517_100847892 378
102 3300021388 Ga0213875_10017863 Ga0213875_100178633 379
103 3300037853 Ga0436364_0462954 Ga0436364_0462954_5896_7083 379
104 3300049576 Ga0501040_0071619 Ga0501040_0071619_1178_2323 379
105 3300049578 Ga0501042_0087168 Ga0501042_0087168_881_2026 379
106 3300049590 Ga0501074_0100993 Ga0501074_0100993_684_1829 379
107 3300049592 Ga0501076_0109799 Ga0501076_0109799_38_1183 379
108 3300013308 Ga0157375_10098378 Ga0157375_100983781 380
109 3300028794 Ga0307515_10044547 Ga0307515_100445476 380
110 3300044656 Ga0466969_0043791 Ga0466969_0043791_513_1694 380
111 3300046516 Ga0495628_0044660 Ga0495628_0044660_1198_2400 380
112 3300046543 Ga0495645_0032507 Ga0495645_0032507_2119_3321 380
113 3300048903 Ga0496100_0025279 Ga0496100_0025279_410_1621 380
114 3300048910 Ga0496107_0002875 Ga0496107_0002875_9303_10514 380
115 3300005937 Ga0081455_10002654 Ga0081455_100026543 381
116 3300006847 Ga0075431_100042265 Ga0075431_1000422653 381
117 3300006880 Ga0075429_100106776 Ga0075429_1001067762 381
118 3300009147 Ga0114129_10124717 Ga0114129_101247174 381
119 3300020082 Ga0206353_11352776 Ga0206353_113527763 381
120 3300042005 Ga0439448_0024848 Ga0439448_0024848_272_1456 381
121 3300042439 Ga0439464_0016441 Ga0439464_0016441_322_1506 381
122 3300042993 Ga0439440_0010197 Ga0439440_0010197_382_1566 381
123 3300050507 nmdc:mga05p37_415260_c1 nmdc:mga05p37_415260_c1_51_1202 381
124 3300005563 Ga0068855_100030761 Ga0068855_1000307613 382
125 3300006178 Ga0075367_10042124 Ga0075367_100421243 382
126 3300005530 Ga0070679_100143959 Ga0070679_1001439592 383
127 3300009147 Ga0114129_10191097 Ga0114129_101910972 383
128 iso_pu_bacteria 2515154155 2515856836 383
129 3300015262 Ga0182007_10001803 Ga0182007_100018035 384
130 3300046529 Ga0495652_0017610 Ga0495652_0017610_4960_6162 384
131 3300047320 Ga0495672_0047200 Ga0495672_0047200_720_1907 384
132 3300048913 Ga0496110_0089281 Ga0496110_0089281_204_1403 384
133 3300049580 Ga0501046_0022538 Ga0501046_0022538_2872_4038 384
134 3300049823 Ga0501044_0307514 Ga0501044_0307514_160_1326 384
135 iso_pu_bacteria 2808606372 2808899787 384
136 iso_pu_bacteria 8057345674 8057349413 384
137 3300005329 Ga0070683_100038142 Ga0070683_1000381422 385
138 3300005535 Ga0070684_100007312 Ga0070684_1000073126 385
139 3300005564 Ga0070664_100139095 Ga0070664_1001390952 385
140 3300009147 Ga0114129_10008044 Ga0114129_100080444 385
141 3300013102 Ga0157371_10007104 Ga0157371_100071045 385
142 3300025944 Ga0207661_10002170 Ga0207661_1000217013 385
143 3300050507 nmdc:mga05p37_31157_c1 nmdc:mga05p37_31157_c1_4194_5357 385
144 iso_pu_bacteria 2582580736 2583150817 385
145 iso_pu_bacteria 2816332119 2816427121 385
146 iso_pu_bacteria 2899359706 2899362484 385
147 iso_pu_bacteria 2899370129 2899374488 385
148 3300005434 Ga0070709_10000725 Ga0070709_1000072518 386
149 3300005435 Ga0070714_100014688 Ga0070714_1000146885 386
150 3300005436 Ga0070713_100009098 Ga0070713_1000090987 386
151 3300005437 Ga0070710_10000262 Ga0070710_1000026220 386
152 3300006028 Ga0070717_10021904 Ga0070717_100219045 386
153 3300006163 Ga0070715_10008046 Ga0070715_100080465 386
154 3300006173 Ga0070716_100000106 Ga0070716_10000010636 386
155 3300006175 Ga0070712_100001643 Ga0070712_1000016432 386
156 3300013307 Ga0157372_10276425 Ga0157372_102764251 386
157 3300025898 Ga0207692_10007176 Ga0207692_100071764 386
158 3300025905 Ga0207685_10004388 Ga0207685_100043882 386
159 3300025906 Ga0207699_10000228 Ga0207699_100002287 386
160 3300025915 Ga0207693_10001196 Ga0207693_1000119620 386
161 3300025928 Ga0207700_10000309 Ga0207700_100003099 386
162 3300025929 Ga0207664_10000203 Ga0207664_1000020331 386
163 3300025939 Ga0207665_10000170 Ga0207665_1000017010 386
164 3300031995 Ga0307409_100167093 Ga0307409_1001670931 386
165 iso_pu_bacteria 2585427649 2586059206 386
166 iso_pu_bacteria 2808606522 2809592041 386
167 iso_pu_bacteria 2863067949 2863073543 386
168 iso_pu_bacteria 2915768154 2915773262 386
169 iso_pu_bacteria 2917736166 2917738844 386
170 iso_pu_bacteria 8003314358 8003322610 386
171 3300044694 Ga0466963_0074860 Ga0466963_0074860_89_1258 387
172 3300045049 Ga0466959_0076542 Ga0466959_0076542_362_1531 387
173 3300045836 Ga0466958_0039763 Ga0466958_0039763_310_1479 387
174 3300045976 Ga0466967_0078473 Ga0466967_0078473_1590_2759 387
175 3300045976 Ga0466967_0143766 Ga0466967_0143766_628_1797 387
176 3300048915 Ga0496112_0060109 Ga0496112_0060109_801_1970 387
177 3300049581 Ga0501047_0002455 Ga0501047_0002455_16272_17441 387
178 3300049822 Ga0501035_0039072 Ga0501035_0039072_2440_3609 387
179 3300049823 Ga0501044_0035142 Ga0501044_0035142_4035_5204 387
180 iso_pu_bacteria 2551306166 2552108769 387
181 iso_pu_bacteria 2558860280 2559425298 387
182 iso_pu_bacteria 2622736626 2623589739 387
183 iso_pu_bacteria 2622736626 2623590498 387
184 iso_pu_bacteria 2867507094 2867507419 387
185 3300005981 Ga0081538_10003982 Ga0081538_1000398211 388
186 3300006844 Ga0075428_100076248 Ga0075428_1000762481 388
187 3300044694 Ga0466963_0140653 Ga0466963_0140653_239_1411 388
188 3300045976 Ga0466967_0050556 Ga0466967_0050556_206_1378 388
189 3300046471 Ga0495650_0000321 Ga0495650_0000321_10717_11889 388
190 3300046615 Ga0495656_0000008 Ga0495656_0000008_147610_148806 388
191 3300046664 Ga0495659_0002665 Ga0495659_0002665_1262_2458 388
192 3300048904 Ga0496101_0039130 Ga0496101_0039130_770_1966 388
193 3300048925 Ga0496122_0002381 Ga0496122_0002381_18314_19486 388
194 3300048926 Ga0496123_0035917 Ga0496123_0035917_1464_2636 388
195 3300049577 Ga0501041_0030512 Ga0501041_0030512_193_1377 388
196 3300049593 Ga0501077_0034289 Ga0501077_0034289_1720_2904 388
197 3300049741 Ga0501079_0037797 Ga0501079_0037797_440_1624 388
198 3300049743 Ga0501081_0075712 Ga0501081_0075712_1153_2337 388
199 3300053153 Ga0500616_0001341 Ga0500616_0001341_20520_21692 388
200 3300054114 Ga0501084_0109123 Ga0501084_0109123_814_1998 388
201 3300061734 Ga0530510_0015246 Ga0530510_0015246_3651_4835 388
202 3300005329 Ga0070683_100124042 Ga0070683_1001240423 389
203 3300005445 Ga0070708_100139596 Ga0070708_1001395962 389
204 3300005536 Ga0070697_100138770 Ga0070697_1001387701 389
205 3300005937 Ga0081455_10000018 Ga0081455_1000001826 389
206 3300006237 Ga0097621_100049401 Ga0097621_1000494013 389
207 3300006358 Ga0068871_100063930 Ga0068871_1000639302 389
208 3300006852 Ga0075433_10231945 Ga0075433_102319452 389
209 3300014968 Ga0157379_10077431 Ga0157379_100774312 389
210 3300025944 Ga0207661_10209870 Ga0207661_102098701 389
211 3300039438 Ga0436360_0824491 Ga0436360_0824491_2129_3331 389
212 3300042993 Ga0439440_0017038 Ga0439440_0017038_132_1307 389
213 3300049568 Ga0501031_0000031 Ga0501031_0000031_54202_55404 389
214 3300049569 Ga0501032_0000095 Ga0501032_0000095_48212_49414 389
215 3300049570 Ga0501033_0000107 Ga0501033_0000107_54352_55554 389
216 3300049571 Ga0501034_0000265 Ga0501034_0000265_25248_26450 389
217 3300049572 Ga0501036_0000029 Ga0501036_0000029_67113_68315 389
218 3300049573 Ga0501037_0000102 Ga0501037_0000102_54349_55551 389
219 3300049574 Ga0501038_0000084 Ga0501038_0000084_25019_26221 389
220 3300049575 Ga0501039_0014212 Ga0501039_0014212_1905_3107 389
221 3300049576 Ga0501040_0018795 Ga0501040_0018795_3136_4338 389
222 3300049578 Ga0501042_0036950 Ga0501042_0036950_1976_3178 389
223 3300049579 Ga0501043_0000094 Ga0501043_0000094_54352_55554 389
224 3300049580 Ga0501046_0000131 Ga0501046_0000131_54327_55529 389
225 3300049581 Ga0501047_0000125 Ga0501047_0000125_38485_39687 389
226 3300049582 Ga0501048_0000011 Ga0501048_0000011_54310_55512 389
227 3300049584 Ga0501068_0010772 Ga0501068_0010772_3423_4625 389
228 3300049584 Ga0501068_0023401 Ga0501068_0023401_636_1829 389
229 3300049586 Ga0501070_0000037 Ga0501070_0000037_78741_79943 389
230 3300049586 Ga0501070_0002235 Ga0501070_0002235_9133_10326 389
231 3300049587 Ga0501071_0015674 Ga0501071_0015674_3855_5057 389
232 3300049588 Ga0501072_0054095 Ga0501072_0054095_1567_2769 389
233 3300049589 Ga0501073_0000138 Ga0501073_0000138_1442_2635 389
234 3300049589 Ga0501073_0002689 Ga0501073_0002689_10556_11758 389
235 3300049590 Ga0501074_0001652 Ga0501074_0001652_13064_14266 389
236 3300049590 Ga0501074_0167574 Ga0501074_0167574_327_1520 389
237 3300049741 Ga0501079_0000668 Ga0501079_0000668_19314_20516 389
238 3300049741 Ga0501079_0006802 Ga0501079_0006802_7026_8219 389
239 3300049742 Ga0501080_0001646 Ga0501080_0001646_16439_17641 389
240 3300049742 Ga0501080_0091075 Ga0501080_0091075_859_2052 389
241 3300049744 Ga0501083_0003381 Ga0501083_0003381_9122_10315 389
242 3300049744 Ga0501083_0003955 Ga0501083_0003955_3306_4508 389
243 3300049822 Ga0501035_0000166 Ga0501035_0000166_54691_55893 389
244 3300049823 Ga0501044_0000169 Ga0501044_0000169_24961_26163 389
245 3300049824 Ga0501045_0008357 Ga0501045_0008357_671_1873 389
246 3300050512 nmdc:mga0n895_165302_c1 nmdc:mga0n895_165302_c1_465_1667 389
247 3300050513 nmdc:mga0rr50_24836_c1 nmdc:mga0rr50_24836_c1_2840_4042 389
248 3300054114 Ga0501084_0003395 Ga0501084_0003395_9131_10324 389
249 3300060353 Ga0501082_0003584 Ga0501082_0003584_2851_4053 389
250 3300005347 Ga0070668_100007289 Ga0070668_1000072895 390
251 3300005364 Ga0070673_100004143 Ga0070673_1000041434 390
252 3300005437 Ga0070710_10063456 Ga0070710_100634562 390
253 3300005539 Ga0068853_100013510 Ga0068853_1000135103 390
254 3300005563 Ga0068855_100050425 Ga0068855_1000504253 390
255 3300005937 Ga0081455_10008724 Ga0081455_100087242 390
256 3300009093 Ga0105240_10414567 Ga0105240_104145671 390
257 3300009551 Ga0105238_10109854 Ga0105238_101098542 390
258 3300013297 Ga0157378_10113746 Ga0157378_101137464 390
259 3300021388 Ga0213875_10045357 Ga0213875_100453572 390
260 3300025913 Ga0207695_10352465 Ga0207695_103524651 390
261 3300025915 Ga0207693_10004284 Ga0207693_100042847 390
262 3300025924 Ga0207694_10076946 Ga0207694_100769462 390
263 3300025928 Ga0207700_10013286 Ga0207700_100132866 390
264 3300025949 Ga0207667_10045939 Ga0207667_100459393 390
265 3300025972 Ga0207668_10058186 Ga0207668_100581863 390
266 3300026023 Ga0207677_10073945 Ga0207677_100739452 390
267 3300026041 Ga0207639_10233554 Ga0207639_102335542 390
268 3300026067 Ga0207678_10000919 Ga0207678_1000091922 390
269 3300031838 Ga0307518_10000734 Ga0307518_1000073416 390
270 3300031852 Ga0307410_10233001 Ga0307410_102330012 390
271 3300033179 Ga0307507_10027718 Ga0307507_100277188 390
272 3300033180 Ga0307510_10017620 Ga0307510_100176201 390
273 3300035083 Ga0373926_0037721 Ga0373926_0037721_326_1531 390
274 3300035117 Ga0373953_0010603 Ga0373953_0010603_1636_2814 390
275 3300035118 Ga0373954_0015696 Ga0373954_0015696_1854_3032 390
276 3300035724 Ga0373933_0066814 Ga0373933_0066814_384_1562 390
277 3300037853 Ga0436364_0648770 Ga0436364_0648770_353_1531 390
278 3300037853 Ga0436364_0801981 Ga0436364_0801981_950_2128 390
279 3300037853 Ga0436364_1065157 Ga0436364_1065157_6522_7700 390
280 3300039437 Ga0436365_1335065 Ga0436365_1335065_1552_2730 390
281 3300044656 Ga0466969_0000729 Ga0466969_0000729_6521_7702 390
282 3300044658 Ga0466972_0034437 Ga0466972_0034437_54_1235 390
283 3300044684 Ga0466966_0003315 Ga0466966_0003315_2781_3962 390
284 3300044693 Ga0466961_0010333 Ga0466961_0010333_2457_3638 390
285 3300044719 Ga0466971_0007606 Ga0466971_0007606_1329_2507 390
286 3300044765 Ga0466970_0114017 Ga0466970_0114017_253_1434 390
287 3300045049 Ga0466959_0001482 Ga0466959_0001482_9075_10256 390
288 3300046454 Ga0495592_0049050 Ga0495592_0049050_697_1875 390
289 3300046455 Ga0495603_0000304 Ga0495603_0000304_23738_24937 390
290 3300046459 Ga0495629_0103473 Ga0495629_0103473_167_1369 390
291 3300046461 Ga0495641_0011916 Ga0495641_0011916_453_1655 390
292 3300046511 Ga0495608_0036454 Ga0495608_0036454_1204_2382 390
293 3300046514 Ga0495618_0021602 Ga0495618_0021602_1861_3039 390
294 3300046516 Ga0495628_0000664 Ga0495628_0000664_27357_28556 390
295 3300046516 Ga0495628_0023178 Ga0495628_0023178_694_1872 390
296 3300046533 Ga0495640_0049268 Ga0495640_0049268_697_1875 390
297 3300046536 Ga0495587_0039473 Ga0495587_0039473_520_1698 390
298 3300046675 Ga0495657_0038760 Ga0495657_0038760_1561_2739 390
299 3300046679 Ga0495623_0021519 Ga0495623_0021519_2057_3235 390
300 3300046680 Ga0495646_0020057 Ga0495646_0020057_988_2166 390
301 3300046809 Ga0495600_0077883 Ga0495600_0077883_279_1457 390
302 3300047319 Ga0495674_0037226 Ga0495674_0037226_1096_2274 390
303 3300047444 Ga0495675_0082210 Ga0495675_0082210_828_2006 390
304 3300047471 Ga0495684_0012449 Ga0495684_0012449_4558_5736 390
305 3300048903 Ga0496100_0161577 Ga0496100_0161577_175_1353 390
306 3300048904 Ga0496101_0024168 Ga0496101_0024168_1644_2822 390
307 3300048905 Ga0496102_0013717 Ga0496102_0013717_80_1258 390
308 3300048906 Ga0496103_0085698 Ga0496103_0085698_183_1361 390
309 3300048909 Ga0496106_0000042 Ga0496106_0000042_42105_43304 390
310 3300048909 Ga0496106_0026972 Ga0496106_0026972_3064_4242 390
311 3300048914 Ga0496111_0103506 Ga0496111_0103506_789_1970 390
312 3300048915 Ga0496112_0005596 Ga0496112_0005596_3708_4886 390
313 3300048918 Ga0496115_0248743 Ga0496115_0248743_253_1431 390
314 3300048924 Ga0496121_0014807 Ga0496121_0014807_5679_6857 390
315 3300049576 Ga0501040_0191005 Ga0501040_0191005_237_1436 390
316 3300049582 Ga0501048_0037883 Ga0501048_0037883_648_1832 390
317 3300053078 Ga0495612_0086674 Ga0495612_0086674_35_1213 390
318 3300053085 Ga0495619_0000127 Ga0495619_0000127_18628_19827 390
319 iso_pu_bacteria 2758568621 2760625878 390
320 iso_pu_bacteria 2831935698 2831936840 390
321 iso_pu_bacteria 2867346516 2867351356 390
322 iso_pu_bacteria 2891395885 2891399342 390
323 iso_pu_bacteria 8056579771 8056584261 390
324 3300005329 Ga0070683_100005529 Ga0070683_1000055297 391
325 3300005347 Ga0070668_100005760 Ga0070668_1000057602 391
326 3300005355 Ga0070671_100243821 Ga0070671_1002438212 391
327 3300005367 Ga0070667_100000981 Ga0070667_1000009818 391
328 3300005618 Ga0068864_100000090 Ga0068864_10000009058 391
329 3300005841 Ga0068863_100052956 Ga0068863_1000529562 391
330 3300005842 Ga0068858_100040815 Ga0068858_1000408154 391
331 3300005843 Ga0068860_100084521 Ga0068860_1000845212 391
332 3300005844 Ga0068862_100001215 Ga0068862_1000012157 391
333 3300006844 Ga0075428_100024473 Ga0075428_1000244732 391
334 3300006846 Ga0075430_100011531 Ga0075430_1000115317 391
335 3300006847 Ga0075431_100097102 Ga0075431_1000971022 391
336 3300006880 Ga0075429_100017338 Ga0075429_1000173382 391
337 3300009147 Ga0114129_10157283 Ga0114129_101572831 391
338 3300009553 Ga0105249_10000781 Ga0105249_1000078117 391
339 3300014969 Ga0157376_10106133 Ga0157376_101061333 391
340 3300025961 Ga0207712_10002686 Ga0207712_100026868 391
341 3300025972 Ga0207668_10008232 Ga0207668_100082322 391
342 3300025986 Ga0207658_10001360 Ga0207658_1000136015 391
343 3300026035 Ga0207703_10125213 Ga0207703_101252132 391
344 3300026088 Ga0207641_10061599 Ga0207641_100615993 391
345 3300026095 Ga0207676_10000016 Ga0207676_10000016272 391
346 3300028379 Ga0268266_10001670 Ga0268266_1000167017 391
347 3300028379 Ga0268266_10030689 Ga0268266_100306893 391
348 3300028380 Ga0268265_10002977 Ga0268265_100029772 391
349 3300046511 Ga0495608_0061653 Ga0495608_0061653_371_1573 391
350 3300053083 Ga0495655_0001302 Ga0495655_0001302_2152_3354 391
351 iso_pu_bacteria 2818991318 2819426009 391
352 iso_pu_bacteria 2818991458 2819665063 391
353 3300049570 Ga0501033_0049053 Ga0501033_0049053_284_1477 392
354 3300049581 Ga0501047_0007969 Ga0501047_0007969_422_1615 392
355 iso_pu_bacteria 8055412473 8055418187 392
356 3300044684 Ga0466966_0039702 Ga0466966_0039702_815_2005 393
357 3300048915 Ga0496112_0126291 Ga0496112_0126291_201_1382 393
358 3300050510 nmdc:mga06r32_89860_c1 nmdc:mga06r32_89860_c1_339_1529 393
359 iso_pu_bacteria 2582581314 2585317192 393
360 iso_pu_bacteria 2643221714 2644630173 393
361 iso_pu_bacteria 2758568522 2760307628 393
362 iso_pu_bacteria 2784746763 2785340305 393
363 iso_pu_bacteria 2786546132 2786666874 393
364 iso_pu_bacteria 2811994917 2812483448 393
365 iso_pu_bacteria 2857479173 2857481069 393
366 iso_pu_bacteria 2870801768 2870804176 393
367 iso_pu_bacteria 2877676314 2877676327 393
368 iso_pu_bacteria 2946072368 2946079423 393
369 iso_pu_bacteria 2954673503 2954681960 393
370 iso_pu_bacteria 2954682443 2954690965 393
371 3300005937 Ga0081455_10215950 Ga0081455_102159502 394
372 3300030734 Ga0316179_1022480 Ga0316179_10224802 394
373 3300031995 Ga0307409_100024613 Ga0307409_1000246133 394
374 3300046461 Ga0495641_0050489 Ga0495641_0050489_590_1777 394
375 3300046692 Ga0495671_0043514 Ga0495671_0043514_960_2144 394
376 3300047322 Ga0495680_0068215 Ga0495680_0068215_214_1401 394
377 iso_pu_bacteria 2775506735 2775657161 394
378 iso_pu_bacteria 2844849076 2844850745 394
379 iso_pu_bacteria 2919059106 2919061155 394
380 iso_pu_bacteria 2939647034 2939649794 394
381 3300005445 Ga0070708_100004271 Ga0070708_1000042717 395
382 3300025928 Ga0207700_10076070 Ga0207700_100760703 395
383 3300031995 Ga0307409_100029816 Ga0307409_1000298164 395
384 3300048907 Ga0496104_0177477 Ga0496104_0177477_72_1271 395
385 3300048917 Ga0496114_0342669 Ga0496114_0342669_39_1229 395
386 iso_pu_bacteria 2818991462 2819692759 395
387 iso_pu_bacteria 2818991469 2819727164 395
388 iso_pu_bacteria 2893684298 2893685212 395
389 iso_pu_bacteria 2945941187 2945945395 395
390 iso_pu_bacteria 2904497146 2904498883 396
391 iso_pu_bacteria 2919391150 2919392707 396
392 iso_pu_bacteria 8004021418 8004025127 396
393 3300014497 Ga0182008_10004118 Ga0182008_100041186 397
394 3300015261 Ga0182006_1031989 Ga0182006_10319892 397
395 3300031903 Ga0307407_10008713 Ga0307407_100087131 397
396 3300041406 Ga0439439_0009512 Ga0439439_0009512_145_1350 397
397 3300041999 Ga0439433_0016242 Ga0439433_0016242_182_1387 397
398 3300042014 Ga0439457_000678 Ga0439457_000678_886_2091 397
399 3300042131 Ga0450894_000535 Ga0450894_000535_2168_3373 397
400 3300042133 Ga0450896_000154 Ga0450896_000154_3867_5072 397
401 3300042134 Ga0450898_000306 Ga0450898_000306_943_2148 397
402 3300042135 Ga0450899_000813 Ga0450899_000813_504_1709 397
403 3300042145 Ga0450906_001479 Ga0450906_001479_85_1290 397
404 3300045976 Ga0466967_0237750 Ga0466967_0237750_116_1321 397
405 3300046515 Ga0495620_0009288 Ga0495620_0009288_1328_2530 397
406 3300046615 Ga0495656_0074406 Ga0495656_0074406_96_1298 397
407 3300047445 Ga0495677_0058349 Ga0495677_0058349_81_1283 397
408 3300047447 Ga0495685_026462 Ga0495685_026462_731_1933 397
409 3300009148 Ga0105243_10008571 Ga0105243_100085718 398
410 3300025935 Ga0207709_10008093 Ga0207709_100080933 398
411 3300026121 Ga0207683_10001855 Ga0207683_1000185518 398
412 3300031824 Ga0307413_10013488 Ga0307413_100134882 398
413 3300037471 Ga0395905_0050553 Ga0395905_0050553_2650_3864 398
414 3300048906 Ga0496103_0175301 Ga0496103_0175301_82_1296 398
415 3300048909 Ga0496106_0307617 Ga0496106_0307617_60_1259 398
416 3300048911 Ga0496108_0251197 Ga0496108_0251197_131_1330 398
417 3300048912 Ga0496109_0079086 Ga0496109_0079086_38_1237 398
418 3300049571 Ga0501034_0000038 Ga0501034_0000038_15207_16421 398
419 3300049574 Ga0501038_0101095 Ga0501038_0101095_880_2076 398
420 3300049575 Ga0501039_0024371 Ga0501039_0024371_598_1794 398
421 3300049575 Ga0501039_0218813 Ga0501039_0218813_242_1456 398
422 3300049579 Ga0501043_0078642 Ga0501043_0078642_48_1262 398
423 3300049589 Ga0501073_0037342 Ga0501073_0037342_799_2013 398
424 3300060353 Ga0501082_0162935 Ga0501082_0162935_410_1624 398
425 3300005328 Ga0070676_10114074 Ga0070676_101140741 399
426 3300011119 Ga0105246_10004159 Ga0105246_100041596 399
427 3300031548 Ga0307408_100004011 Ga0307408_10000401110 399
428 3300031731 Ga0307405_10134834 Ga0307405_101348342 399
429 3300031911 Ga0307412_10016854 Ga0307412_100168542 399
430 3300042002 Ga0439442_000251 Ga0439442_000251_6073_7272 399
431 3300042002 Ga0439442_000621 Ga0439442_000621_4962_6161 399
432 3300042122 Ga0450920_000344 Ga0450920_000344_5795_6994 399
433 3300042122 Ga0450920_006255 Ga0450920_006255_56_1255 399
434 3300042146 Ga0450907_000232 Ga0450907_000232_10043_11242 399
435 3300042435 Ga0439434_0000012 Ga0439434_0000012_9983_11182 399
436 3300042531 Ga0450918_001397 Ga0450918_001397_3503_4702 399
437 3300049571 Ga0501034_0000070 Ga0501034_0000070_132523_133740 399
438 3300049579 Ga0501043_0027485 Ga0501043_0027485_3000_4229 399
439 iso_pu_bacteria 2690315906 2691511917 399
440 iso_pu_bacteria 2939598168 2939601816 399
441 iso_pu_bacteria 2974302888 2974304919 399
442 3300006058 Ga0075432_10031551 Ga0075432_100315511 400
443 3300027907 Ga0207428_10061018 Ga0207428_100610182 400
444 3300037312 Ga0395899_0064913 Ga0395899_0064913_106_1338 400
445 3300037418 Ga0395900_0026703 Ga0395900_0026703_4676_5878 400
446 3300046472 Ga0495580_0027418 Ga0495580_0027418_2334_3536 400
447 3300048905 Ga0496102_0225984 Ga0496102_0225984_468_1691 400
448 3300048906 Ga0496103_0022626 Ga0496103_0022626_969_2186 400
449 3300048915 Ga0496112_0012906 Ga0496112_0012906_2816_4039 400
450 3300049570 Ga0501033_0094600 Ga0501033_0094600_264_1466 400
451 3300031995 Ga0307409_100261214 Ga0307409_1002612142 401
452 3300000549 LJQas_1004406 LJQas_10044062 403
453 3300025901 Ga0207688_10122737 Ga0207688_101227371 403
454 3300031548 Ga0307408_100094460 Ga0307408_1000944603 403
455 3300031548 Ga0307408_100112926 Ga0307408_1001129262 403
456 3300031731 Ga0307405_10122434 Ga0307405_101224342 403
457 3300031911 Ga0307412_10180722 Ga0307412_101807221 403
458 3300031995 Ga0307409_100006389 Ga0307409_1000063897 403
459 3300037312 Ga0395899_0008495 Ga0395899_0008495_4565_5779 403
460 3300037418 Ga0395900_0016476 Ga0395900_0016476_5937_7151 403
461 3300037466 Ga0395898_0096044 Ga0395898_0096044_1491_2705 403
462 3300038443 Ga0395901_0050588 Ga0395901_0050588_301_1515 403
463 3300046472 Ga0495580_0011554 Ga0495580_0011554_804_2048 403
464 3300046615 Ga0495656_0025556 Ga0495656_0025556_1036_2250 403
465 3300046691 Ga0495670_0001738 Ga0495670_0001738_8159_9373 403
466 3300046692 Ga0495671_0084139 Ga0495671_0084139_207_1433 403
467 3300048907 Ga0496104_0022225 Ga0496104_0022225_2224_3453 403
468 3300048912 Ga0496109_0121093 Ga0496109_0121093_314_1543 403
469 3300049569 Ga0501032_0029977 Ga0501032_0029977_222_1433 403
470 3300049572 Ga0501036_0015155 Ga0501036_0015155_992_2203 403
471 3300049575 Ga0501039_0011205 Ga0501039_0011205_654_1865 403
472 3300049589 Ga0501073_0105831 Ga0501073_0105831_388_1599 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

308

431

0.97

PF00108

Thiolase_N

Thiolase, N-terminal domain

43

301

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vtr-assembly1.cif.gz_C-2 3-ketoacyl-coa thiolase tfu_0875 0.9774 1 392
7vtr-assembly1.cif.gz_C-2 3-ketoacyl-coa thiolase tfu_0875 0.9749 1 392
6pcd-assembly1.cif.gz_B crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a 0.9659 1 393
6pcc-assembly1.cif.gz_C crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.9643 1 393
6pca-assembly1.cif.gz_D crystal structure of beta-ketoadipyl-coa thiolase 0.9625 1 393
ID Description Score Start End Superfamily
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9867 278 387 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9746 278 387 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9709 269 393 3.40.47.10
af_P0C7L2_1_401_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9678 1 393 3.40.47.10
4b3jC02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9661 158 389 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7Y3CCX7-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9859 274 392 GO:0003985
GO:0006635
AF-A0A7V4PRG6-F1-model_v4 acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9835 272 394 GO:0003988
GO:0006635
GO:0010124
AF-A0A7S2EGS6-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9807 275 392 GO:0003988
GO:0006635
GO:0010124
AF-A0A7K0V331-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9796 1 121 GO:0003985
AF-A0A6V8KZ75-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9788 260 397 GO:0003985
GO:0006635

Feature Viewer

pLDDT pTM Quality
94.58 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map