F450789

General Info

Members Datasets Scaffolds Average Seq Length
472 207 944 146

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10925035|Ga0105245_109250351
Length 166
Sequence LVIGEANERPSGRSLFDTIESMKFTIAATVFIPLAALFALRSTVHAQPPTKSIWDGVYTEAQATRGKALYSQECASCHGGELTGGEMAPPLAGGEFMAGWDGLTIGDLFERVRISMPQNAPGSLSGQQNADILSFMFSSNKFPAGAAELPKEAGILKQIKFEVKKP

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
88 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
89 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.12
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 47.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10925035 3300009098 Bacteria 914
2 Ga0065707_10029534 3300005295 Bacteria 1133
3 Ga0070676_10023250 3300005328 Bacteria 3482
4 Ga0070676_10025485 3300005328 Unclassified 3343
5 Ga0070670_100267898 3300005331 Unclassified 1490
6 Ga0070670_100573896 3300005331 Unclassified 1008
7 Ga0070670_100706706 3300005331 Unclassified 907
8 Ga0070670_100956893 3300005331 Unclassified 778
9 Ga0070677_10074510 3300005333 Unclassified 1436
10 Ga0070677_10930801 3300005333 Unclassified 504
11 Ga0068869_100134419 3300005334 Unclassified 1904
12 Ga0070666_10035379 3300005335 Bacteria 3313
13 Ga0070666_10772993 3300005335 Bacteria 707
14 Ga0070680_100371638 3300005336 Unclassified 1217
15 Ga0068868_100030998 3300005338 Unclassified 4104
16 Ga0068868_100136881 3300005338 Bacteria 2008
17 Ga0070689_100068861 3300005340 Bacteria 2760
18 Ga0070691_10079592 3300005341 Bacteria 1602
19 Ga0070687_100055035 3300005343 Bacteria 2076
20 Ga0070687_100069050 3300005343 Bacteria 1891
21 Ga0070692_10122259 3300005345 Unclassified 1453
22 Ga0070692_10831147 3300005345 Unclassified 633
23 Ga0070668_100056029 3300005347 Unclassified 3043
24 Ga0070668_100355781 3300005347 Unclassified 1240
25 Ga0070668_100617289 3300005347 Unclassified 950
26 Ga0070669_100006387 3300005353 Bacteria 8486
27 Ga0070669_100070099 3300005353 Unclassified 2591
28 Ga0070669_101203174 3300005353 Unclassified 654
29 Ga0070675_100036184 3300005354 Bacteria 4015
30 Ga0070675_100272459 3300005354 Unclassified 1486
31 Ga0070671_100034127 3300005355 Bacteria 4211
32 Ga0070674_100809403 3300005356 Unclassified 810
33 Ga0070673_100175785 3300005364 Unclassified 1830
34 Ga0070673_100190356 3300005364 Bacteria 1762
35 Ga0070688_100021390 3300005365 Unclassified 3779
36 Ga0070688_100671318 3300005365 Unclassified 800
37 Ga0070667_100003137 3300005367 Bacteria 14191
38 Ga0070667_101297413 3300005367 Unclassified 682
39 Ga0070714_100003082 3300005435 Bacteria 12370
40 Ga0070713_100004738 3300005436 Bacteria 9195
41 Ga0070710_10356023 3300005437 Bacteria 970
42 Ga0070701_10126979 3300005438 Bacteria 1444
43 Ga0070701_10372194 3300005438 Unclassified 898
44 Ga0070711_100003909 3300005439 Bacteria 8747
45 Ga0070705_100018429 3300005440 Bacteria 3660
46 Ga0070705_100855641 3300005440 Bacteria 728
47 Ga0070700_100051245 3300005441 Bacteria 2569
48 Ga0070700_100322411 3300005441 Unclassified 1135
49 Ga0070700_100421178 3300005441 Unclassified 1009
50 Ga0070694_100028987 3300005444 Unclassified 3609
51 Ga0070694_100062270 3300005444 Unclassified 2548
52 Ga0070694_100096581 3300005444 Unclassified 2083
53 Ga0070694_100295418 3300005444 Bacteria 1240
54 Ga0070708_100660549 3300005445 Bacteria 985
55 Ga0070708_100726597 3300005445 Unclassified 934
56 Ga0070662_100429446 3300005457 Unclassified 1094
57 Ga0070662_100847863 3300005457 Unclassified 778
58 Ga0068867_100035464 3300005459 Bacteria 3618
59 Ga0068867_100042619 3300005459 Bacteria 3321
60 Ga0068867_100231224 3300005459 Unclassified 1495
61 Ga0070685_10551788 3300005466 Unclassified 823
62 Ga0070706_101235305 3300005467 Unclassified 686
63 Ga0070707_100042061 3300005468 Unclassified 4374
64 Ga0070707_101191035 3300005468 Bacteria 728
65 Ga0070698_100115927 3300005471 Bacteria 2643
66 Ga0070698_100139397 3300005471 Bacteria 2378
67 Ga0070698_100602304 3300005471 Bacteria 1039
68 Ga0070698_100649922 3300005471 Bacteria 996
69 Ga0070698_102098960 3300005471 Unclassified 519
70 Ga0070699_100005664 3300005518 Bacteria 10940
71 Ga0070699_101650078 3300005518 Unclassified 587
72 Ga0070684_100714244 3300005535 Bacteria 935
73 Ga0070697_100247104 3300005536 Unclassified 1525
74 Ga0070697_100274497 3300005536 Unclassified 1445
75 Ga0070697_100534837 3300005536 Unclassified 1027
76 Ga0070697_100803127 3300005536 Unclassified 832
77 Ga0068853_101058159 3300005539 Unclassified 782
78 Ga0070672_100340818 3300005543 Unclassified 1276
79 Ga0070672_100399628 3300005543 Unclassified 1178
80 Ga0070686_100002200 3300005544 Bacteria 10771
81 Ga0070686_100239664 3300005544 Bacteria 1320
82 Ga0070686_100306463 3300005544 Bacteria 1180
83 Ga0070686_100897021 3300005544 Bacteria 721
84 Ga0070695_100036561 3300005545 Unclassified 3091
85 Ga0070695_100046503 3300005545 Bacteria 2769
86 Ga0070695_100052826 3300005545 Bacteria 2612
87 Ga0070696_100019332 3300005546 Bacteria 4612
88 Ga0070696_100441462 3300005546 Bacteria 1025
89 Ga0070696_100501422 3300005546 Unclassified 966
90 Ga0070696_101830247 3300005546 Unclassified 525
91 Ga0070693_100052879 3300005547 Bacteria 2330
92 Ga0070665_100008205 3300005548 Bacteria 10573
93 Ga0070665_100129117 3300005548 Unclassified 2530
94 Ga0070704_100014697 3300005549 Bacteria 4895
95 Ga0070704_100029380 3300005549 Bacteria 3670
96 Ga0070704_100078552 3300005549 Bacteria 2421
97 Ga0070704_100171267 3300005549 Unclassified 1727
98 Ga0068854_100070344 3300005578 Bacteria 2557
99 Ga0070702_100016361 3300005615 Bacteria 3804
100 Ga0068852_101813072 3300005616 Unclassified 632
101 Ga0068859_100049352 3300005617 Unclassified 4227
102 Ga0068859_100561620 3300005617 Bacteria 1235
103 Ga0068859_100841325 3300005617 Bacteria 1004
104 Ga0068864_100005642 3300005618 Bacteria 10260
105 Ga0068864_100213274 3300005618 Unclassified 1779
106 Ga0068864_100713269 3300005618 Unclassified 980
107 Ga0068864_101280622 3300005618 Unclassified 733
108 Ga0068866_10177848 3300005718 Bacteria 1254
109 Ga0068861_100482739 3300005719 Unclassified 1117
110 Ga0068861_101897355 3300005719 Unclassified 593
111 Ga0068851_10217400 3300005834 Unclassified 1072
112 Ga0068870_10320320 3300005840 Unclassified 985
113 Ga0068863_100052525 3300005841 Unclassified 3862
114 Ga0068863_100141966 3300005841 Unclassified 2296
115 Ga0068863_100428218 3300005841 Unclassified 1297
116 Ga0068863_102532177 3300005841 Bacteria 522
117 Ga0068858_100013098 3300005842 Archaea 7820
118 Ga0068858_100028416 3300005842 Bacteria 5196
119 Ga0068858_100081897 3300005842 Unclassified 3000
120 Ga0068858_100181095 3300005842 Bacteria 1990
121 Ga0068858_100229288 3300005842 Bacteria 1760
122 Ga0068858_100354055 3300005842 Bacteria 1406
123 Ga0068860_100057995 3300005843 Bacteria 3680
124 Ga0068860_100858682 3300005843 Unclassified 923
125 Ga0068860_101012639 3300005843 Unclassified 849
126 Ga0068862_100011027 3300005844 Bacteria 7466
127 Ga0068862_100048140 3300005844 Unclassified 3639
128 Ga0070717_10565902 3300006028 Unclassified 1030
129 Ga0070716_100079588 3300006173 Bacteria 1952
130 Ga0070716_100178174 3300006173 Unclassified 1393
131 Ga0075367_10398522 3300006178 Bacteria 870
132 Ga0097621_100010052 3300006237 Bacteria 6900
133 Ga0097621_100261307 3300006237 Unclassified 1519
134 Ga0097621_100265504 3300006237 Bacteria 1507
135 Ga0097621_101199979 3300006237 Unclassified 715
136 Ga0068871_100033580 3300006358 Bacteria 4065
137 Ga0068871_100195564 3300006358 Bacteria 1744
138 Ga0068871_100755841 3300006358 Unclassified 894
139 Ga0075428_100023947 3300006844 Bacteria 6755
140 Ga0075428_100223357 3300006844 Bacteria 2034
141 Ga0075428_100649517 3300006844 Bacteria 1125
142 Ga0075431_100395336 3300006847 Unclassified 1384
143 Ga0075433_10059227 3300006852 Bacteria 3350
144 Ga0075433_10358816 3300006852 Unclassified 1288
145 Ga0075433_10426400 3300006852 Bacteria 1170
146 Ga0075433_10440791 3300006852 Unclassified 1148
147 Ga0075434_100003769 3300006871 Bacteria 13547
148 Ga0075434_100004739 3300006871 Bacteria 12302
149 Ga0075434_100012664 3300006871 Bacteria 7998
150 Ga0075434_100026934 3300006871 Bacteria 5640
151 Ga0075434_100248331 3300006871 Unclassified 1799
152 Ga0075434_100269564 3300006871 Unclassified 1722
153 Ga0075434_100272419 3300006871 Bacteria 1712
154 Ga0075434_100400181 3300006871 Unclassified 1394
155 Ga0075434_100567589 3300006871 Bacteria 1154
156 Ga0075434_100938611 3300006871 Bacteria 880
157 Ga0075434_101123818 3300006871 Unclassified 799
158 Ga0075429_100643775 3300006880 Unclassified 929
159 Ga0068865_100028656 3300006881 Bacteria 3688
160 Ga0068865_100808665 3300006881 Unclassified 809
161 Ga0075436_100002493 3300006914 Bacteria 12663
162 Ga0075436_100009819 3300006914 Bacteria 6546
163 Ga0075436_100193552 3300006914 Unclassified 1439
164 Ga0075436_100330490 3300006914 Unclassified 1096
165 Ga0075436_100853621 3300006914 Unclassified 680
166 Ga0075436_101261538 3300006914 Unclassified 558
167 Ga0097620_100049350 3300006931 Unclassified 4227
168 Ga0097620_100561604 3300006931 Bacteria 1235
169 Ga0097620_100841401 3300006931 Bacteria 1004
170 Ga0075435_100000907 3300007076 Bacteria 18671
171 Ga0075435_100007866 3300007076 Bacteria 7626
172 Ga0075435_100013918 3300007076 Bacteria 6000
173 Ga0075435_100038732 3300007076 Bacteria 3801
174 Ga0075435_100184438 3300007076 Bacteria 1764
175 Ga0075435_100205922 3300007076 Unclassified 1667
176 Ga0075435_100469559 3300007076 Bacteria 1086
177 Ga0075435_100489732 3300007076 Bacteria 1063
178 Ga0075435_100556436 3300007076 Unclassified 994
179 Ga0099794_10135412 3300007265 Bacteria 1246
180 Ga0105240_10600043 3300009093 Bacteria 1212
181 Ga0105240_11039308 3300009093 Unclassified 874
182 Ga0111539_10006920 3300009094 Bacteria 14563
183 Ga0111539_10060543 3300009094 Bacteria 4487
184 Ga0111539_10379607 3300009094 Unclassified 1645
185 Ga0111539_10802072 3300009094 Bacteria 1096
186 Ga0111539_11024218 3300009094 Unclassified 960
187 Ga0105245_10184161 3300009098 Unclassified 1997
188 Ga0105245_10602962 3300009098 Bacteria 1125
189 Ga0105245_11174625 3300009098 Unclassified 815
190 Ga0105245_11694368 3300009098 Unclassified 684
191 Ga0105247_10011868 3300009101 Bacteria 5238
192 Ga0114129_10007514 3300009147 Bacteria 15524
193 Ga0114129_10024200 3300009147 Bacteria 8606
194 Ga0114129_10030309 3300009147 Bacteria 7657
195 Ga0114129_10034589 3300009147 Bacteria 7138
196 Ga0114129_10070696 3300009147 Bacteria 4867
197 Ga0114129_10121726 3300009147 Bacteria 3590
198 Ga0114129_10215531 3300009147 Bacteria 2593
199 Ga0114129_10229212 3300009147 Bacteria 2503
200 Ga0114129_10998606 3300009147 Bacteria 1054
201 Ga0105243_10505583 3300009148 Bacteria 1146
202 Ga0105243_10611970 3300009148 Bacteria 1050
203 Ga0105243_10741738 3300009148 Unclassified 962
204 Ga0105243_11610960 3300009148 Bacteria 676
205 Ga0105243_12061507 3300009148 Unclassified 606
206 Ga0105243_12558055 3300009148 Unclassified 550
207 Ga0105241_10011407 3300009174 Bacteria 6515
208 Ga0105241_10365049 3300009174 Unclassified 1257
209 Ga0105242_10007130 3300009176 Bacteria 8626
210 Ga0105242_10012730 3300009176 Bacteria 6479
211 Ga0105242_10117867 3300009176 Unclassified 2274
212 Ga0105242_10322589 3300009176 Unclassified 1417
213 Ga0105242_10441362 3300009176 Bacteria 1225
214 Ga0105242_10592552 3300009176 Unclassified 1069
215 Ga0105242_10896082 3300009176 Unclassified 887
216 Ga0105248_10006481 3300009177 Bacteria 12836
217 Ga0105248_10042609 3300009177 Bacteria 5091
218 Ga0105248_10066499 3300009177 Bacteria 4047
219 Ga0105248_10131837 3300009177 Bacteria 2820
220 Ga0105248_10188012 3300009177 Bacteria 2327
221 Ga0105248_10413728 3300009177 Bacteria 1518
222 Ga0105248_10642398 3300009177 Bacteria 1197
223 Ga0105248_11803737 3300009177 Unclassified 694
224 Ga0105237_10573582 3300009545 Unclassified 1135
225 Ga0105238_10768299 3300009551 Bacteria 978
226 Ga0105238_11620288 3300009551 Unclassified 677
227 Ga0105238_12188122 3300009551 Unclassified 588
228 Ga0105249_10432221 3300009553 Bacteria 1352
229 Ga0105249_10501266 3300009553 Unclassified 1259
230 Ga0105249_10956762 3300009553 Unclassified 924
231 Ga0105249_12250780 3300009553 Unclassified 618
232 Ga0157337_1020449 3300012483 Bacteria 607
233 Ga0157324_1007754 3300012506 Unclassified 845
234 Ga0157316_1030690 3300012510 Unclassified 649
235 Ga0157374_10224795 3300013296 Unclassified 1843
236 Ga0157378_10342347 3300013297 Bacteria 1459
237 Ga0157378_10477363 3300013297 Unclassified 1242
238 Ga0157378_12880978 3300013297 Unclassified 533
239 Ga0163162_10025148 3300013306 Bacteria 5884
240 Ga0163162_10415336 3300013306 Unclassified 1478
241 Ga0163162_11667547 3300013306 Bacteria 728
242 Ga0157375_10038221 3300013308 Unclassified 4608
243 Ga0157375_10251596 3300013308 Unclassified 1928
244 Ga0157375_10413458 3300013308 Bacteria 1515
245 Ga0157375_11367644 3300013308 Bacteria 834
246 Ga0157375_12796152 3300013308 Bacteria 583
247 Ga0163163_10193451 3300014325 Bacteria 2082
248 Ga0163163_10312491 3300014325 Unclassified 1625
249 Ga0163163_10639492 3300014325 Unclassified 1127
250 Ga0157380_10138997 3300014326 Unclassified 2084
251 Ga0157380_11837559 3300014326 Bacteria 665
252 Ga0157380_12758187 3300014326 Unclassified 558
253 Ga0157379_10062101 3300014968 Bacteria 3341
254 Ga0157379_10110015 3300014968 Unclassified 2475
255 Ga0157379_10208889 3300014968 Bacteria 1767
256 Ga0157379_11479225 3300014968 Unclassified 660
257 Ga0157379_11820618 3300014968 Bacteria 598
258 Ga0157376_10037474 3300014969 Bacteria 3936
259 Ga0157376_10454964 3300014969 Unclassified 1249
260 Ga0157376_11105781 3300014969 Unclassified 818
261 Ga0182007_10073223 3300015262 Bacteria 1122
262 Ga0182005_1117588 3300015265 Bacteria 755
263 Ga0207697_10122628 3300025315 Bacteria 1119
264 Ga0207682_10273453 3300025893 Unclassified 789
265 Ga0207642_10141275 3300025899 Bacteria 1270
266 Ga0207688_10094599 3300025901 Bacteria 1719
267 Ga0207680_10100717 3300025903 Bacteria 1856
268 Ga0207680_10213300 3300025903 Unclassified 1321
269 Ga0207680_10315569 3300025903 Bacteria 1092
270 Ga0207680_10561488 3300025903 Unclassified 815
271 Ga0207685_10503935 3300025905 Unclassified 637
272 Ga0207645_10012298 3300025907 Bacteria 5811
273 Ga0207643_10203833 3300025908 Bacteria 1205
274 Ga0207684_10128048 3300025910 Unclassified 2179
275 Ga0207654_10202681 3300025911 Bacteria 1307
276 Ga0207695_10298916 3300025913 Bacteria 1501
277 Ga0207660_10137406 3300025917 Unclassified 1866
278 Ga0207662_10021490 3300025918 Bacteria 3689
279 Ga0207662_10123311 3300025918 Unclassified 1627
280 Ga0207662_10128443 3300025918 Unclassified 1596
281 Ga0207649_10435966 3300025920 Unclassified 986
282 Ga0207646_10127816 3300025922 Unclassified 2286
283 Ga0207646_10497011 3300025922 Unclassified 1099
284 Ga0207646_10804421 3300025922 Bacteria 837
285 Ga0207681_10091768 3300025923 Unclassified 2170
286 Ga0207681_10211653 3300025923 Bacteria 1494
287 Ga0207650_10243671 3300025925 Bacteria 1453
288 Ga0207659_10194665 3300025926 Bacteria 1615
289 Ga0207659_10283048 3300025926 Unclassified 1356
290 Ga0207687_10335723 3300025927 Bacteria 1227
291 Ga0207687_10632960 3300025927 Bacteria 904
292 Ga0207687_11113507 3300025927 Bacteria 678
293 Ga0207644_10037472 3300025931 Unclassified 3411
294 Ga0207706_10175116 3300025933 Unclassified 1885
295 Ga0207686_10016583 3300025934 Bacteria 4135
296 Ga0207686_10025877 3300025934 Unclassified 3420
297 Ga0207686_10153997 3300025934 Unclassified 1604
298 Ga0207686_10195837 3300025934 Unclassified 1444
299 Ga0207686_10381422 3300025934 Bacteria 1069
300 Ga0207709_10398535 3300025935 Bacteria 1051
301 Ga0207709_10463982 3300025935 Bacteria 981
302 Ga0207669_10108611 3300025937 Unclassified 1853
303 Ga0207704_10017602 3300025938 Bacteria 3710
304 Ga0207704_10043452 3300025938 Unclassified 2654
305 Ga0207704_11127062 3300025938 Unclassified 667
306 Ga0207691_10006641 3300025940 Bacteria 11164
307 Ga0207691_10388889 3300025940 Unclassified 1190
308 Ga0207711_10010861 3300025941 Bacteria 7568
309 Ga0207711_10021648 3300025941 Bacteria 5370
310 Ga0207711_10096000 3300025941 Bacteria 2615
311 Ga0207711_11311369 3300025941 Bacteria 666
312 Ga0207711_11336461 3300025941 Unclassified 659
313 Ga0207711_11539313 3300025941 Bacteria 608
314 Ga0207689_10201562 3300025942 Unclassified 1642
315 Ga0207661_11019540 3300025944 Unclassified 762
316 Ga0207667_11313001 3300025949 Unclassified 700
317 Ga0207651_10234488 3300025960 Unclassified 1492
318 Ga0207651_10433231 3300025960 Unclassified 1125
319 Ga0207712_11030873 3300025961 Unclassified 731
320 Ga0207668_10214827 3300025972 Bacteria 1540
321 Ga0207668_11336844 3300025972 Unclassified 645
322 Ga0207640_10201049 3300025981 Unclassified 1510
323 Ga0207658_10008609 3300025986 Bacteria 6942
324 Ga0207677_10022167 3300026023 Unclassified 3898
325 Ga0207677_10309367 3300026023 Bacteria 1308
326 Ga0207703_10011973 3300026035 Bacteria 6756
327 Ga0207703_10043052 3300026035 Unclassified 3622
328 Ga0207703_10062803 3300026035 Bacteria 3043
329 Ga0207703_10256172 3300026035 Bacteria 1580
330 Ga0207639_11001843 3300026041 Unclassified 782
331 Ga0207639_11137649 3300026041 Bacteria 732
332 Ga0207639_11812864 3300026041 Unclassified 571
333 Ga0207708_10024838 3300026075 Bacteria 4534
334 Ga0207708_10063631 3300026075 Unclassified 2818
335 Ga0207708_10067106 3300026075 Unclassified 2744
336 Ga0207708_10176986 3300026075 Unclassified 1692
337 Ga0207641_10002196 3300026088 Bacteria 18352
338 Ga0207641_10239455 3300026088 Unclassified 1690
339 Ga0207641_10413245 3300026088 Unclassified 1298
340 Ga0207641_10628357 3300026088 Unclassified 1053
341 Ga0207648_10022132 3300026089 Bacteria 5709
342 Ga0207648_10497699 3300026089 Unclassified 1115
343 Ga0207648_11444742 3300026089 Unclassified 646
344 Ga0207676_10037085 3300026095 Bacteria 3712
345 Ga0207676_10064241 3300026095 Unclassified 2918
346 Ga0207676_10400155 3300026095 Unclassified 1283
347 Ga0207676_10682903 3300026095 Unclassified 993
348 Ga0207676_10946378 3300026095 Unclassified 847
349 Ga0207676_11272199 3300026095 Unclassified 730
350 Ga0207674_10438156 3300026116 Bacteria 1263
351 Ga0207675_100004211 3300026118 Bacteria 13923
352 Ga0207675_101008283 3300026118 Bacteria 851
353 Ga0207675_101221546 3300026118 Unclassified 772
354 Ga0207428_10034805 3300027907 Unclassified 4123
355 Ga0268266_10001734 3300028379 Bacteria 24955
356 Ga0268266_10095035 3300028379 Unclassified 2617
357 Ga0268265_10174758 3300028380 Unclassified 1839
358 Ga0268265_10210862 3300028380 Unclassified 1692
359 Ga0268265_11343223 3300028380 Unclassified 716
360 Ga0268264_10025748 3300028381 Unclassified 4805
361 Ga0268264_10675070 3300028381 Unclassified 1024
362 Ga0268264_11489100 3300028381 Unclassified 687
363 Ga0268264_12202484 3300028381 Bacteria 559
364 Ga0373930_0172437 3300034816 Bacteria 552
365 Ga0373948_0011841 3300034817 Bacteria 1550
366 Ga0373950_0008237 3300034818 Bacteria 1635
367 Ga0373959_0012262 3300034820 Bacteria 1527
368 Ga0373938_0066581 3300034957 Bacteria 853
369 Ga0373929_0000806 3300035085 Bacteria 6102
370 Ga0373929_0190686 3300035085 Unclassified 570
371 Ga0373940_0092187 3300035088 Bacteria 909
372 Ga0373944_0075202 3300035089 Bacteria 1107
373 Ga0373949_0009252 3300035090 Bacteria 2159
374 Ga0373949_0091371 3300035090 Bacteria 824
375 Ga0373951_0000753 3300035091 Bacteria 8855
376 Ga0373939_0003763 3300035114 Bacteria 3576
377 Ga0373941_0004053 3300035115 Bacteria 3359
378 Ga0373956_0451056 3300035119 Unclassified 614
379 Ga0373960_0001118 3300035121 Bacteria 5790
380 Ga0373946_0789224 3300035171 Unclassified 500
381 Ga0373955_0284740 3300035172 Unclassified 995
382 Ga0373955_0370357 3300035172 Unclassified 869
383 Ga0373942_0002661 3300035207 Bacteria 4292
384 Ga0373961_0000537 3300035241 Bacteria 14427
385 Ga0373961_0162453 3300035241 Unclassified 768
386 Ga0373962_0002405 3300035242 Bacteria 4455
387 Ga0373924_0444051 3300035410 Bacteria 581
388 Ga0373931_0000529 3300035691 Bacteria 15644
389 Ga0373931_0146664 3300035691 Unclassified 1372
390 Ga0373931_0624536 3300035691 Unclassified 706
391 Ga0373927_0834725 3300035695 Unclassified 608
392 Ga0373947_0059070 3300035725 Unclassified 2325
393 Ga0373947_0929936 3300035725 Unclassified 593
394 Ga0373937_0366976 3300036401 Bacteria 1365
395 Ga0373925_0174985 3300037068 Bacteria 1696
396 Ga0373925_0336767 3300037068 Unclassified 1223
397 Ga0466963_1278875 3300044694 Unclassified 515
398 Ga0451576_0006295 3300045051 Bacteria 14601
399 Ga0451576_1103838 3300045051 Bacteria 830
400 Ga0466967_0582315 3300045976 Bacteria 1103
401 Ga0495603_0174163 3300046455 Unclassified 1246
402 Ga0495582_0279503 3300046473 Unclassified 959
403 Ga0495630_0204572 3300046517 Unclassified 1507
404 Ga0495586_0257125 3300046535 Bacteria 997
405 Ga0495588_0468368 3300046674 Unclassified 661
406 Ga0495647_0053789 3300046681 Unclassified 1571
407 Ga0495669_0438824 3300046684 Bacteria 634
408 Ga0495613_0751561 3300046689 Unclassified 639
409 Ga0495624_0932127 3300046690 Unclassified 511
410 Ga0495674_0327947 3300047319 Unclassified 1246
411 Ga0496101_0237915 3300048904 Unclassified 1417
412 Ga0496102_0536333 3300048905 Bacteria 1093
413 Ga0496102_1423594 3300048905 Unclassified 612
414 Ga0496104_0839217 3300048907 Unclassified 824
415 Ga0496109_0921323 3300048912 Bacteria 812
416 Ga0496109_0960946 3300048912 Unclassified 792
417 Ga0496111_0398686 3300048914 Bacteria 1017
418 Ga0496112_0981726 3300048915 Unclassified 765
419 Ga0496113_0034676 3300048916 Bacteria 3684
420 Ga0496114_0646967 3300048917 Bacteria 930
421 Ga0501034_0023637 3300049571 Bacteria 6261
422 Ga0501043_0110167 3300049579 Bacteria 2162
423 Ga0501047_0627336 3300049581 Bacteria 895
424 Ga0501044_0661724 3300049823 Bacteria 933
425 nmdc:mga05p37_102584_c1 3300050507 Bacteria 3523
426 nmdc:mga05p37_115545_c2 3300050507 Bacteria 2430
427 nmdc:mga05p37_16490_c1 3300050507 Bacteria 6852
428 nmdc:mga05p37_178741_c1 3300050507 Unclassified 2583
429 nmdc:mga05p37_4083_c1 3300050507 Bacteria 17066
430 nmdc:mga05p37_43613_c1 3300050507 Bacteria 5518
431 nmdc:mga05p37_623189_c1 3300050507 Unclassified 1213
432 nmdc:mga05p37_86699_c1 3300050507 Bacteria 3859
433 nmdc:mga09592_1619855_c1 3300050508 Bacteria 524
434 nmdc:mga09592_767978_c1 3300050508 Unclassified 817
435 nmdc:mga08y16_289485_c1 3300050511 Unclassified 1689
436 nmdc:mga08y16_39037_c1 3300050511 Unclassified 4983
437 nmdc:mga08y16_5285_c1 3300050511 Bacteria 13499
438 nmdc:mga0n895_1028696_c1 3300050512 Bacteria 804
439 nmdc:mga0n895_105586_c1 3300050512 Bacteria 2829
440 nmdc:mga0n895_125967_c1 3300050512 Unclassified 2585
441 nmdc:mga0n895_13882_c1 3300050512 Bacteria 7293
442 nmdc:mga0n895_165193_c1 3300050512 Unclassified 2245
443 nmdc:mga0n895_177_c1 3300050512 Bacteria 39316
444 nmdc:mga0n895_268929_c1 3300050512 Bacteria 1729
445 nmdc:mga0n895_463745_c1 3300050512 Unclassified 1278
446 nmdc:mga0n895_6024_c1 3300050512 Bacteria 10219
447 nmdc:mga0n895_670701_c1 3300050512 Bacteria 1034
448 nmdc:mga0n895_814660_c1 3300050512 Unclassified 923
449 nmdc:mga0n895_9301_c1 3300050512 Bacteria 8585
450 nmdc:mga0n895_99548_c1 3300050512 Bacteria 2915
451 nmdc:mga0rr50_1010_c1 3300050513 Bacteria 15272
452 nmdc:mga0rr50_112984_c1 3300050513 Bacteria 2152
453 nmdc:mga0rr50_15674_c1 3300050513 Bacteria 5009
454 nmdc:mga0rr50_181072_c1 3300050513 Bacteria 1723
455 nmdc:mga0rr50_2813_c1 3300050513 Bacteria 9888
456 nmdc:mga0rr50_28735_c1 3300050513 Unclassified 3913
457 nmdc:mga0rr50_335176_c1 3300050513 Bacteria 1270
458 nmdc:mga0rr50_419694_c1 3300050513 Bacteria 1132
459 nmdc:mga0rr50_470414_c1 3300050513 Bacteria 1067
460 nmdc:mga0rr50_590516_c1 3300050513 Unclassified 947
461 nmdc:mga08x19_16993_c1 3300050514 Bacteria 4446
462 nmdc:mga08x19_180453_c1 3300050514 Unclassified 1441
463 nmdc:mga08x19_287812_c1 3300050514 Unclassified 1139
464 nmdc:mga08x19_53695_c1 3300050514 Unclassified 2593
465 nmdc:mga08x19_973_c1 3300050514 Bacteria 17919
466 nmdc:mga0a205_106489_c1 3300050515 Bacteria 2701
467 nmdc:mga0a205_464698_c1 3300050515 Unclassified 1125
468 nmdc:mga0a205_507543_c1 3300050515 Unclassified 1063
469 nmdc:mga0a205_7453_c1 3300050515 Bacteria 9906
470 Ga0495619_0295690 3300053085 Unclassified 1122
471 Ga0500658_0335862 3300053134 Bacteria 694
472 Ga0587092_140502 3300059512 Unclassified 532
473 Ga0105245_10925035
474 Ga0065707_10029534
475 Ga0070676_10023250
476 Ga0070676_10025485
477 Ga0070670_100267898
478 Ga0070670_100573896
479 Ga0070670_100706706
480 Ga0070670_100956893
481 Ga0070677_10074510
482 Ga0070677_10930801
483 Ga0068869_100134419
484 Ga0070666_10035379
485 Ga0070666_10772993
486 Ga0070680_100371638
487 Ga0068868_100030998
488 Ga0068868_100136881
489 Ga0070689_100068861
490 Ga0070691_10079592
491 Ga0070687_100055035
492 Ga0070687_100069050
493 Ga0070692_10122259
494 Ga0070692_10831147
495 Ga0070668_100056029
496 Ga0070668_100355781
497 Ga0070668_100617289
498 Ga0070669_100006387
499 Ga0070669_100070099
500 Ga0070669_101203174
501 Ga0070675_100036184
502 Ga0070675_100272459
503 Ga0070671_100034127
504 Ga0070674_100809403
505 Ga0070673_100175785
506 Ga0070673_100190356
507 Ga0070688_100021390
508 Ga0070688_100671318
509 Ga0070667_100003137
510 Ga0070667_101297413
511 Ga0070714_100003082
512 Ga0070713_100004738
513 Ga0070710_10356023
514 Ga0070701_10126979
515 Ga0070701_10372194
516 Ga0070711_100003909
517 Ga0070705_100018429
518 Ga0070705_100855641
519 Ga0070700_100051245
520 Ga0070700_100322411
521 Ga0070700_100421178
522 Ga0070694_100028987
523 Ga0070694_100062270
524 Ga0070694_100096581
525 Ga0070694_100295418
526 Ga0070708_100660549
527 Ga0070708_100726597
528 Ga0070662_100429446
529 Ga0070662_100847863
530 Ga0068867_100035464
531 Ga0068867_100042619
532 Ga0068867_100231224
533 Ga0070685_10551788
534 Ga0070706_101235305
535 Ga0070707_100042061
536 Ga0070707_101191035
537 Ga0070698_100115927
538 Ga0070698_100139397
539 Ga0070698_100602304
540 Ga0070698_100649922
541 Ga0070698_102098960
542 Ga0070699_100005664
543 Ga0070699_101650078
544 Ga0070684_100714244
545 Ga0070697_100247104
546 Ga0070697_100274497
547 Ga0070697_100534837
548 Ga0070697_100803127
549 Ga0068853_101058159
550 Ga0070672_100340818
551 Ga0070672_100399628
552 Ga0070686_100002200
553 Ga0070686_100239664
554 Ga0070686_100306463
555 Ga0070686_100897021
556 Ga0070695_100036561
557 Ga0070695_100046503
558 Ga0070695_100052826
559 Ga0070696_100019332
560 Ga0070696_100441462
561 Ga0070696_100501422
562 Ga0070696_101830247
563 Ga0070693_100052879
564 Ga0070665_100008205
565 Ga0070665_100129117
566 Ga0070704_100014697
567 Ga0070704_100029380
568 Ga0070704_100078552
569 Ga0070704_100171267
570 Ga0068854_100070344
571 Ga0070702_100016361
572 Ga0068852_101813072
573 Ga0068859_100049352
574 Ga0068859_100561620
575 Ga0068859_100841325
576 Ga0068864_100005642
577 Ga0068864_100213274
578 Ga0068864_100713269
579 Ga0068864_101280622
580 Ga0068866_10177848
581 Ga0068861_100482739
582 Ga0068861_101897355
583 Ga0068851_10217400
584 Ga0068870_10320320
585 Ga0068863_100052525
586 Ga0068863_100141966
587 Ga0068863_100428218
588 Ga0068863_102532177
589 Ga0068858_100013098
590 Ga0068858_100028416
591 Ga0068858_100081897
592 Ga0068858_100181095
593 Ga0068858_100229288
594 Ga0068858_100354055
595 Ga0068860_100057995
596 Ga0068860_100858682
597 Ga0068860_101012639
598 Ga0068862_100011027
599 Ga0068862_100048140
600 Ga0070717_10565902
601 Ga0070716_100079588
602 Ga0070716_100178174
603 Ga0075367_10398522
604 Ga0097621_100010052
605 Ga0097621_100261307
606 Ga0097621_100265504
607 Ga0097621_101199979
608 Ga0068871_100033580
609 Ga0068871_100195564
610 Ga0068871_100755841
611 Ga0075428_100023947
612 Ga0075428_100223357
613 Ga0075428_100649517
614 Ga0075431_100395336
615 Ga0075433_10059227
616 Ga0075433_10358816
617 Ga0075433_10426400
618 Ga0075433_10440791
619 Ga0075434_100003769
620 Ga0075434_100004739
621 Ga0075434_100012664
622 Ga0075434_100026934
623 Ga0075434_100248331
624 Ga0075434_100269564
625 Ga0075434_100272419
626 Ga0075434_100400181
627 Ga0075434_100567589
628 Ga0075434_100938611
629 Ga0075434_101123818
630 Ga0075429_100643775
631 Ga0068865_100028656
632 Ga0068865_100808665
633 Ga0075436_100002493
634 Ga0075436_100009819
635 Ga0075436_100193552
636 Ga0075436_100330490
637 Ga0075436_100853621
638 Ga0075436_101261538
639 Ga0097620_100049350
640 Ga0097620_100561604
641 Ga0097620_100841401
642 Ga0075435_100000907
643 Ga0075435_100007866
644 Ga0075435_100013918
645 Ga0075435_100038732
646 Ga0075435_100184438
647 Ga0075435_100205922
648 Ga0075435_100469559
649 Ga0075435_100489732
650 Ga0075435_100556436
651 Ga0099794_10135412
652 Ga0105240_10600043
653 Ga0105240_11039308
654 Ga0111539_10006920
655 Ga0111539_10060543
656 Ga0111539_10379607
657 Ga0111539_10802072
658 Ga0111539_11024218
659 Ga0105245_10184161
660 Ga0105245_10602962
661 Ga0105245_11174625
662 Ga0105245_11694368
663 Ga0105247_10011868
664 Ga0114129_10007514
665 Ga0114129_10024200
666 Ga0114129_10030309
667 Ga0114129_10034589
668 Ga0114129_10070696
669 Ga0114129_10121726
670 Ga0114129_10215531
671 Ga0114129_10229212
672 Ga0114129_10998606
673 Ga0105243_10505583
674 Ga0105243_10611970
675 Ga0105243_10741738
676 Ga0105243_11610960
677 Ga0105243_12061507
678 Ga0105243_12558055
679 Ga0105241_10011407
680 Ga0105241_10365049
681 Ga0105242_10007130
682 Ga0105242_10012730
683 Ga0105242_10117867
684 Ga0105242_10322589
685 Ga0105242_10441362
686 Ga0105242_10592552
687 Ga0105242_10896082
688 Ga0105248_10006481
689 Ga0105248_10042609
690 Ga0105248_10066499
691 Ga0105248_10131837
692 Ga0105248_10188012
693 Ga0105248_10413728
694 Ga0105248_10642398
695 Ga0105248_11803737
696 Ga0105237_10573582
697 Ga0105238_10768299
698 Ga0105238_11620288
699 Ga0105238_12188122
700 Ga0105249_10432221
701 Ga0105249_10501266
702 Ga0105249_10956762
703 Ga0105249_12250780
704 Ga0157337_1020449
705 Ga0157324_1007754
706 Ga0157316_1030690
707 Ga0157374_10224795
708 Ga0157378_10342347
709 Ga0157378_10477363
710 Ga0157378_12880978
711 Ga0163162_10025148
712 Ga0163162_10415336
713 Ga0163162_11667547
714 Ga0157375_10038221
715 Ga0157375_10251596
716 Ga0157375_10413458
717 Ga0157375_11367644
718 Ga0157375_12796152
719 Ga0163163_10193451
720 Ga0163163_10312491
721 Ga0163163_10639492
722 Ga0157380_10138997
723 Ga0157380_11837559
724 Ga0157380_12758187
725 Ga0157379_10062101
726 Ga0157379_10110015
727 Ga0157379_10208889
728 Ga0157379_11479225
729 Ga0157379_11820618
730 Ga0157376_10037474
731 Ga0157376_10454964
732 Ga0157376_11105781
733 Ga0182007_10073223
734 Ga0182005_1117588
735 Ga0207697_10122628
736 Ga0207682_10273453
737 Ga0207642_10141275
738 Ga0207688_10094599
739 Ga0207680_10100717
740 Ga0207680_10213300
741 Ga0207680_10315569
742 Ga0207680_10561488
743 Ga0207685_10503935
744 Ga0207645_10012298
745 Ga0207643_10203833
746 Ga0207684_10128048
747 Ga0207654_10202681
748 Ga0207695_10298916
749 Ga0207660_10137406
750 Ga0207662_10021490
751 Ga0207662_10123311
752 Ga0207662_10128443
753 Ga0207649_10435966
754 Ga0207646_10127816
755 Ga0207646_10497011
756 Ga0207646_10804421
757 Ga0207681_10091768
758 Ga0207681_10211653
759 Ga0207650_10243671
760 Ga0207659_10194665
761 Ga0207659_10283048
762 Ga0207687_10335723
763 Ga0207687_10632960
764 Ga0207687_11113507
765 Ga0207644_10037472
766 Ga0207706_10175116
767 Ga0207686_10016583
768 Ga0207686_10025877
769 Ga0207686_10153997
770 Ga0207686_10195837
771 Ga0207686_10381422
772 Ga0207709_10398535
773 Ga0207709_10463982
774 Ga0207669_10108611
775 Ga0207704_10017602
776 Ga0207704_10043452
777 Ga0207704_11127062
778 Ga0207691_10006641
779 Ga0207691_10388889
780 Ga0207711_10010861
781 Ga0207711_10021648
782 Ga0207711_10096000
783 Ga0207711_11311369
784 Ga0207711_11336461
785 Ga0207711_11539313
786 Ga0207689_10201562
787 Ga0207661_11019540
788 Ga0207667_11313001
789 Ga0207651_10234488
790 Ga0207651_10433231
791 Ga0207712_11030873
792 Ga0207668_10214827
793 Ga0207668_11336844
794 Ga0207640_10201049
795 Ga0207658_10008609
796 Ga0207677_10022167
797 Ga0207677_10309367
798 Ga0207703_10011973
799 Ga0207703_10043052
800 Ga0207703_10062803
801 Ga0207703_10256172
802 Ga0207639_11001843
803 Ga0207639_11137649
804 Ga0207639_11812864
805 Ga0207708_10024838
806 Ga0207708_10063631
807 Ga0207708_10067106
808 Ga0207708_10176986
809 Ga0207641_10002196
810 Ga0207641_10239455
811 Ga0207641_10413245
812 Ga0207641_10628357
813 Ga0207648_10022132
814 Ga0207648_10497699
815 Ga0207648_11444742
816 Ga0207676_10037085
817 Ga0207676_10064241
818 Ga0207676_10400155
819 Ga0207676_10682903
820 Ga0207676_10946378
821 Ga0207676_11272199
822 Ga0207674_10438156
823 Ga0207675_100004211
824 Ga0207675_101008283
825 Ga0207675_101221546
826 Ga0207428_10034805
827 Ga0268266_10001734
828 Ga0268266_10095035
829 Ga0268265_10174758
830 Ga0268265_10210862
831 Ga0268265_11343223
832 Ga0268264_10025748
833 Ga0268264_10675070
834 Ga0268264_11489100
835 Ga0268264_12202484
836 Ga0373930_0172437
837 Ga0373948_0011841
838 Ga0373950_0008237
839 Ga0373959_0012262
840 Ga0373938_0066581
841 Ga0373929_0000806
842 Ga0373929_0190686
843 Ga0373940_0092187
844 Ga0373944_0075202
845 Ga0373949_0009252
846 Ga0373949_0091371
847 Ga0373951_0000753
848 Ga0373939_0003763
849 Ga0373941_0004053
850 Ga0373956_0451056
851 Ga0373960_0001118
852 Ga0373946_0789224
853 Ga0373955_0284740
854 Ga0373955_0370357
855 Ga0373942_0002661
856 Ga0373961_0000537
857 Ga0373961_0162453
858 Ga0373962_0002405
859 Ga0373924_0444051
860 Ga0373931_0000529
861 Ga0373931_0146664
862 Ga0373931_0624536
863 Ga0373927_0834725
864 Ga0373947_0059070
865 Ga0373947_0929936
866 Ga0373937_0366976
867 Ga0373925_0174985
868 Ga0373925_0336767
869 Ga0466963_1278875
870 Ga0451576_0006295
871 Ga0451576_1103838
872 Ga0466967_0582315
873 Ga0495603_0174163
874 Ga0495582_0279503
875 Ga0495630_0204572
876 Ga0495586_0257125
877 Ga0495588_0468368
878 Ga0495647_0053789
879 Ga0495669_0438824
880 Ga0495613_0751561
881 Ga0495624_0932127
882 Ga0495674_0327947
883 Ga0496101_0237915
884 Ga0496102_0536333
885 Ga0496102_1423594
886 Ga0496104_0839217
887 Ga0496109_0921323
888 Ga0496109_0960946
889 Ga0496111_0398686
890 Ga0496112_0981726
891 Ga0496113_0034676
892 Ga0496114_0646967
893 Ga0501034_0023637
894 Ga0501043_0110167
895 Ga0501047_0627336
896 Ga0501044_0661724
897 nmdc:mga05p37_102584_c1
898 nmdc:mga05p37_115545_c2
899 nmdc:mga05p37_16490_c1
900 nmdc:mga05p37_178741_c1
901 nmdc:mga05p37_4083_c1
902 nmdc:mga05p37_43613_c1
903 nmdc:mga05p37_623189_c1
904 nmdc:mga05p37_86699_c1
905 nmdc:mga09592_1619855_c1
906 nmdc:mga09592_767978_c1
907 nmdc:mga08y16_289485_c1
908 nmdc:mga08y16_39037_c1
909 nmdc:mga08y16_5285_c1
910 nmdc:mga0n895_1028696_c1
911 nmdc:mga0n895_105586_c1
912 nmdc:mga0n895_125967_c1
913 nmdc:mga0n895_13882_c1
914 nmdc:mga0n895_165193_c1
915 nmdc:mga0n895_177_c1
916 nmdc:mga0n895_268929_c1
917 nmdc:mga0n895_463745_c1
918 nmdc:mga0n895_6024_c1
919 nmdc:mga0n895_670701_c1
920 nmdc:mga0n895_814660_c1
921 nmdc:mga0n895_9301_c1
922 nmdc:mga0n895_99548_c1
923 nmdc:mga0rr50_1010_c1
924 nmdc:mga0rr50_112984_c1
925 nmdc:mga0rr50_15674_c1
926 nmdc:mga0rr50_181072_c1
927 nmdc:mga0rr50_2813_c1
928 nmdc:mga0rr50_28735_c1
929 nmdc:mga0rr50_335176_c1
930 nmdc:mga0rr50_419694_c1
931 nmdc:mga0rr50_470414_c1
932 nmdc:mga0rr50_590516_c1
933 nmdc:mga08x19_16993_c1
934 nmdc:mga08x19_180453_c1
935 nmdc:mga08x19_287812_c1
936 nmdc:mga08x19_53695_c1
937 nmdc:mga08x19_973_c1
938 nmdc:mga0a205_106489_c1
939 nmdc:mga0a205_464698_c1
940 nmdc:mga0a205_507543_c1
941 nmdc:mga0a205_7453_c1
942 Ga0495619_0295690
943 Ga0500658_0335862
944 Ga0587092_140502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

61

136

0.87

PF00034

Cytochrom_C

Cytochrome c

63

140

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lo9-assembly1.cif.gz_A "thiosulfate dehydrogenase (tsdba) from marichromatium purpuratum - ""as isolated"" form" 0.6796 42 117
2xts-assembly1.cif.gz_B crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.6523 42 139
7c90-assembly1.cif.gz_C crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.6493 40 117
7r2u-assembly1.cif.gz_A crystal structure of as-isolated q262n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii 0.6461 39 132
1cty-assembly1.cif.gz_A mutation of tyrosine-67 in cytochrome c significantly alters the local heme environment 0.6448 42 118
ID Description Score Start End Superfamily
1ls9A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7039 38 117 1.10.760.10
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6711 40 116 1.10.760.10
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6513 42 139 1.10.760.10
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6392 37 116 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6344 45 117 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2V9GIT3-F1-model_v4 Class I cytochrome c 0.9352 27 145 GO:0009055
GO:0020037
GO:0046872
AF-A0A257EPL5-F1-model_v4 Class I cytochrome c 0.9344 30 145 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E7BK32-F1-model_v4 Cytochrome c domain-containing protein 0.9326 29 140 GO:0009055
GO:0020037
GO:0046872
AF-A0A328B140-F1-model_v4 Cytochrome c 0.9315 27 139 GO:0009055
GO:0020037
GO:0046872
AF-A0A1F2TB80-F1-model_v4 Cytochrome c domain-containing protein 0.9291 29 141 GO:0009055
GO:0020037
GO:0046872

Map