F450773

General Info

Members Datasets Scaffolds Average Seq Length
472 239 944 102

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10078289|Ga0075370_100782892
Length 119
Sequence MPDFNSASTGAMAAFQAAHDGFVQTALAVSAFLFVLGALGVFLRRNVITVMMCIELMLNAVNLAFVAFSRAHGTIDGQILVFFVFTVAAAEAAVGLAIVIALQRGKEDLDVDSFNLLKG

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
234 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0
Rhizoplane 2.33
Rhizosphere 92.37
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10078289 3300006353 Bacteria 1898
2 JGI25406J46586_10006995 3300003203 Bacteria 5177
3 JGI25407J50210_10013796 3300003373 Bacteria 2078
4 Ga0065712_10000240 3300005290 Bacteria 24235
5 Ga0065715_10000461 3300005293 Bacteria 26573
6 Ga0070676_10982103 3300005328 Bacteria 633
7 Ga0070690_100014126 3300005330 Bacteria 4733
8 Ga0070690_100018394 3300005330 Bacteria 4221
9 Ga0070690_100234131 3300005330 Bacteria 1293
10 Ga0070690_100965286 3300005330 Bacteria 670
11 Ga0070670_100029058 3300005331 Bacteria 4757
12 Ga0070670_100280323 3300005331 Bacteria 1455
13 Ga0070670_100423030 3300005331 Bacteria 1178
14 Ga0068869_100077706 3300005334 Bacteria 2470
15 Ga0068869_100197412 3300005334 Bacteria 1585
16 Ga0068869_100241558 3300005334 Bacteria 1439
17 Ga0070680_101433158 3300005336 Bacteria 598
18 Ga0068868_100100247 3300005338 Bacteria 2343
19 Ga0070689_100032111 3300005340 Bacteria 3992
20 Ga0070689_100296007 3300005340 Bacteria 1346
21 Ga0070689_101450868 3300005340 Bacteria 621
22 Ga0070687_100130181 3300005343 Bacteria 1452
23 Ga0070687_100819991 3300005343 Bacteria 661
24 Ga0070661_101045508 3300005344 Bacteria 679
25 Ga0070692_10589085 3300005345 Bacteria 734
26 Ga0070668_100053386 3300005347 Bacteria 3116
27 Ga0070668_100975650 3300005347 Bacteria 761
28 Ga0070669_100127779 3300005353 Bacteria 1947
29 Ga0070669_100162027 3300005353 Bacteria 1739
30 Ga0070675_100007860 3300005354 Bacteria 8265
31 Ga0070675_100071161 3300005354 Bacteria 2885
32 Ga0070675_100332182 3300005354 Bacteria 1345
33 Ga0070674_100479847 3300005356 Bacteria 1032
34 Ga0070674_100852101 3300005356 Bacteria 791
35 Ga0070673_100022470 3300005364 Bacteria 4592
36 Ga0070688_100020144 3300005365 Bacteria 3874
37 Ga0070688_100028781 3300005365 Bacteria 3321
38 Ga0070688_100177502 3300005365 Bacteria 1475
39 Ga0070659_101406943 3300005366 Bacteria 620
40 Ga0070667_100521029 3300005367 Bacteria 1091
41 Ga0070703_10141785 3300005406 Bacteria 894
42 Ga0070701_10111445 3300005438 Bacteria 1529
43 Ga0070701_10576930 3300005438 Bacteria 742
44 Ga0070701_10881648 3300005438 Bacteria 616
45 Ga0070705_100029368 3300005440 Bacteria 3023
46 Ga0070705_100607013 3300005440 Bacteria 847
47 Ga0070705_100964755 3300005440 Bacteria 690
48 Ga0070700_100173059 3300005441 Bacteria 1496
49 Ga0070700_100482863 3300005441 Bacteria 949
50 Ga0070700_101915441 3300005441 Bacteria 513
51 Ga0070694_100017964 3300005444 Bacteria 4479
52 Ga0070694_100030807 3300005444 Bacteria 3513
53 Ga0070694_100095081 3300005444 Bacteria 2097
54 Ga0070694_100639835 3300005444 Bacteria 860
55 Ga0070694_101004558 3300005444 Bacteria 693
56 Ga0070694_101502992 3300005444 Bacteria 570
57 Ga0070708_100094432 3300005445 Bacteria 2729
58 Ga0070708_100185277 3300005445 Bacteria 1946
59 Ga0070663_101681789 3300005455 Bacteria 567
60 Ga0070678_100051312 3300005456 Bacteria 2989
61 Ga0070662_100586327 3300005457 Bacteria 937
62 Ga0070662_100884836 3300005457 Bacteria 761
63 Ga0070662_101814253 3300005457 Bacteria 527
64 Ga0070681_10356972 3300005458 Bacteria 1372
65 Ga0068867_100005754 3300005459 Bacteria 8794
66 Ga0070685_10003607 3300005466 Bacteria 7854
67 Ga0070685_10029066 3300005466 Bacteria 3068
68 Ga0070706_100051965 3300005467 Bacteria 3783
69 Ga0070706_100069278 3300005467 Bacteria 3263
70 Ga0070706_100318170 3300005467 Bacteria 1451
71 Ga0070707_100005150 3300005468 Bacteria 12246
72 Ga0070707_100006346 3300005468 Bacteria 10993
73 Ga0070707_100074460 3300005468 Bacteria 3274
74 Ga0070707_100473639 3300005468 Bacteria 1214
75 Ga0070698_100006525 3300005471 Bacteria 12653
76 Ga0070698_100063875 3300005471 Bacteria 3712
77 Ga0070698_101042871 3300005471 Bacteria 765
78 Ga0070699_100005214 3300005518 Bacteria 11422
79 Ga0070699_100175744 3300005518 Bacteria 1899
80 Ga0070699_100527647 3300005518 Bacteria 1074
81 Ga0070697_100061009 3300005536 Bacteria 3075
82 Ga0070697_100168853 3300005536 Bacteria 1851
83 Ga0070697_100462031 3300005536 Bacteria 1106
84 Ga0068853_101700008 3300005539 Bacteria 612
85 Ga0070672_100017929 3300005543 Bacteria 5107
86 Ga0070672_100603603 3300005543 Bacteria 956
87 Ga0070686_100027890 3300005544 Bacteria 3420
88 Ga0070686_100034991 3300005544 Bacteria 3099
89 Ga0070686_100194815 3300005544 Bacteria 1449
90 Ga0070695_100001271 3300005545 Bacteria 13890
91 Ga0070695_100025526 3300005545 Bacteria 3650
92 Ga0070695_100107533 3300005545 Bacteria 1888
93 Ga0070695_100406905 3300005545 Bacteria 1033
94 Ga0070695_100474504 3300005545 Bacteria 963
95 Ga0070695_100877416 3300005545 Bacteria 723
96 Ga0070695_101743294 3300005545 Bacteria 522
97 Ga0070696_100065386 3300005546 Bacteria 2549
98 Ga0070696_100066787 3300005546 Bacteria 2523
99 Ga0070696_100631241 3300005546 Bacteria 867
100 Ga0070696_101789522 3300005546 Bacteria 531
101 Ga0070665_100261816 3300005548 Bacteria 1731
102 Ga0070704_100024511 3300005549 Bacteria 3959
103 Ga0070704_100204474 3300005549 Bacteria 1596
104 Ga0070704_100438881 3300005549 Bacteria 1122
105 Ga0070704_100480894 3300005549 Bacteria 1074
106 Ga0070704_100552062 3300005549 Bacteria 1007
107 Ga0070704_100678566 3300005549 Bacteria 912
108 Ga0070664_100707379 3300005564 Bacteria 939
109 Ga0070664_100860258 3300005564 Bacteria 849
110 Ga0068857_100466629 3300005577 Bacteria 1182
111 Ga0068854_100594665 3300005578 Bacteria 944
112 Ga0068854_100642732 3300005578 Bacteria 910
113 Ga0068856_100003343 3300005614 Bacteria 16290
114 Ga0068859_100014601 3300005617 Bacteria 7888
115 Ga0068859_100029022 3300005617 Bacteria 5550
116 Ga0068859_101597764 3300005617 Bacteria 720
117 Ga0068864_100145840 3300005618 Bacteria 2140
118 Ga0068864_100172666 3300005618 Bacteria 1972
119 Ga0068864_100605117 3300005618 Bacteria 1064
120 Ga0068864_101694852 3300005618 Bacteria 637
121 Ga0068866_10107893 3300005718 Bacteria 1548
122 Ga0068866_10695988 3300005718 Bacteria 697
123 Ga0068861_100188601 3300005719 Bacteria 1722
124 Ga0068861_100252548 3300005719 Bacteria 1505
125 Ga0068861_102542054 3300005719 Bacteria 516
126 Ga0068870_10040333 3300005840 Bacteria 2420
127 Ga0068870_10400501 3300005840 Bacteria 893
128 Ga0068870_10562060 3300005840 Bacteria 770
129 Ga0068863_100288678 3300005841 Bacteria 1590
130 Ga0068863_100547918 3300005841 Bacteria 1142
131 Ga0068858_100018211 3300005842 Bacteria 6577
132 Ga0068858_100542038 3300005842 Bacteria 1126
133 Ga0068858_101879306 3300005842 Bacteria 592
134 Ga0068860_100010739 3300005843 Bacteria 9040
135 Ga0068860_100729581 3300005843 Bacteria 1002
136 Ga0068860_101222487 3300005843 Bacteria 772
137 Ga0068860_102513273 3300005843 Bacteria 535
138 Ga0068862_100476641 3300005844 Bacteria 1181
139 Ga0068862_100653115 3300005844 Bacteria 1015
140 Ga0081455_10013894 3300005937 Bacteria 7915
141 Ga0081538_10009903 3300005981 Bacteria 7879
142 Ga0075365_10021599 3300006038 Bacteria 4018
143 Ga0075368_10017022 3300006042 Bacteria 2715
144 Ga0075363_100467849 3300006048 Bacteria 746
145 Ga0075364_10053682 3300006051 Bacteria 2634
146 Ga0075364_10991989 3300006051 Bacteria 571
147 Ga0075362_10175651 3300006177 Bacteria 1036
148 Ga0075367_10072927 3300006178 Bacteria 2068
149 Ga0075367_10358972 3300006178 Bacteria 920
150 Ga0075366_10000055 3300006195 Bacteria 41182
151 Ga0097621_100278017 3300006237 Bacteria 1473
152 Ga0097621_101586921 3300006237 Bacteria 622
153 Ga0075370_10033851 3300006353 Bacteria 2863
154 Ga0068871_100093502 3300006358 Bacteria 2509
155 Ga0075428_100004773 3300006844 Bacteria 15010
156 Ga0075428_100327103 3300006844 Bacteria 1647
157 Ga0075428_102485971 3300006844 Bacteria 531
158 Ga0075430_100028418 3300006846 Bacteria 4752
159 Ga0075430_101030618 3300006846 Bacteria 678
160 Ga0075430_101547779 3300006846 Bacteria 545
161 Ga0075431_100041827 3300006847 Bacteria 4726
162 Ga0075431_100367100 3300006847 Bacteria 1445
163 Ga0075431_100649844 3300006847 Bacteria 1035
164 Ga0075431_100746284 3300006847 Bacteria 954
165 Ga0075431_100944776 3300006847 Bacteria 831
166 Ga0075431_101351851 3300006847 Bacteria 673
167 Ga0075433_10013704 3300006852 Bacteria 6602
168 Ga0075433_10243185 3300006852 Bacteria 1597
169 Ga0075434_100022664 3300006871 Bacteria 6114
170 Ga0075434_100081985 3300006871 Bacteria 3222
171 Ga0075434_101729721 3300006871 Bacteria 633
172 Ga0075429_100012748 3300006880 Bacteria 7292
173 Ga0075429_100164444 3300006880 Bacteria 1944
174 Ga0075429_100560731 3300006880 Bacteria 1001
175 Ga0075429_101789489 3300006880 Bacteria 533
176 Ga0068865_100007943 3300006881 Bacteria 6550
177 Ga0068865_101179869 3300006881 Bacteria 677
178 Ga0075436_100195262 3300006914 Bacteria 1433
179 Ga0075436_100269612 3300006914 Bacteria 1215
180 Ga0097620_100014600 3300006931 Bacteria 7888
181 Ga0097620_100029022 3300006931 Bacteria 5550
182 Ga0097620_100396711 3300006931 Bacteria 1475
183 Ga0097620_101597709 3300006931 Bacteria 720
184 Ga0075435_100184194 3300007076 Bacteria 1766
185 Ga0075435_100428902 3300007076 Bacteria 1139
186 Ga0075435_101378532 3300007076 Bacteria 618
187 Ga0105240_11574653 3300009093 Bacteria 688
188 Ga0105240_12747671 3300009093 Bacteria 507
189 Ga0111539_10005357 3300009094 Bacteria 16592
190 Ga0111539_10024197 3300009094 Bacteria 7457
191 Ga0111539_10319787 3300009094 Bacteria 1806
192 Ga0111539_11020512 3300009094 Bacteria 962
193 Ga0105245_10183411 3300009098 Bacteria 2001
194 Ga0105245_10916714 3300009098 Bacteria 918
195 Ga0105247_11301505 3300009101 Bacteria 584
196 Ga0114129_10034293 3300009147 Bacteria 7168
197 Ga0114129_10060091 3300009147 Bacteria 5314
198 Ga0114129_10066599 3300009147 Bacteria 5024
199 Ga0114129_10213297 3300009147 Bacteria 2609
200 Ga0114129_10397977 3300009147 Bacteria 1815
201 Ga0114129_11020339 3300009147 Bacteria 1041
202 Ga0114129_11241067 3300009147 Bacteria 926
203 Ga0114129_11561777 3300009147 Bacteria 809
204 Ga0105243_10048042 3300009148 Bacteria 3363
205 Ga0105243_10283908 3300009148 Bacteria 1492
206 Ga0105241_10880415 3300009174 Bacteria 830
207 Ga0105242_10048455 3300009176 Bacteria 3453
208 Ga0105242_10084593 3300009176 Bacteria 2658
209 Ga0105248_10066998 3300009177 Bacteria 4031
210 Ga0105248_10092064 3300009177 Bacteria 3414
211 Ga0105248_10430182 3300009177 Bacteria 1487
212 Ga0105237_10172459 3300009545 Bacteria 2163
213 Ga0105249_10758255 3300009553 Bacteria 1033
214 Ga0105239_10467547 3300010375 Bacteria 1432
215 Ga0105239_11723099 3300010375 Unclassified 725
216 Ga0105239_12004809 3300010375 Bacteria 672
217 Ga0105246_10650940 3300011119 Bacteria 917
218 Ga0157374_10539200 3300013296 Bacteria 1174
219 Ga0163162_10074270 3300013306 Bacteria 3458
220 Ga0163162_13331526 3300013306 Bacteria 514
221 Ga0157375_10028714 3300013308 Bacteria 5220
222 Ga0157375_10597610 3300013308 Bacteria 1263
223 Ga0163163_10299530 3300014325 Bacteria 1660
224 Ga0163163_10549148 3300014325 Bacteria 1218
225 Ga0157380_10027390 3300014326 Bacteria 4335
226 Ga0157380_10416975 3300014326 Bacteria 1279
227 Ga0157380_12540658 3300014326 Bacteria 578
228 Ga0157377_10053362 3300014745 Bacteria 2285
229 Ga0157379_11266973 3300014968 Bacteria 711
230 Ga0157376_10310036 3300014969 Bacteria 1497
231 Ga0163161_10379843 3300017792 Bacteria 1129
232 Ga0163161_10466212 3300017792 Bacteria 1023
233 Ga0207697_10062387 3300025315 Bacteria 1552
234 Ga0207653_10038342 3300025885 Bacteria 1565
235 Ga0207653_10190644 3300025885 Bacteria 770
236 Ga0207642_10103152 3300025899 Bacteria 1436
237 Ga0207680_11226875 3300025903 Bacteria 534
238 Ga0207643_10979348 3300025908 Bacteria 547
239 Ga0207684_10011034 3300025910 Bacteria 7915
240 Ga0207684_10063272 3300025910 Bacteria 3141
241 Ga0207684_10358315 3300025910 Bacteria 1255
242 Ga0207684_10790593 3300025910 Bacteria 802
243 Ga0207654_11431426 3300025911 Bacteria 504
244 Ga0207707_10666364 3300025912 Bacteria 876
245 Ga0207662_10008287 3300025918 Bacteria 5689
246 Ga0207662_10829800 3300025918 Bacteria 653
247 Ga0207646_10001206 3300025922 Bacteria 32514
248 Ga0207646_10025144 3300025922 Bacteria 5450
249 Ga0207646_10119811 3300025922 Bacteria 2364
250 Ga0207646_10212621 3300025922 Bacteria 1747
251 Ga0207646_10360423 3300025922 Bacteria 1314
252 Ga0207681_10150171 3300025923 Bacteria 1745
253 Ga0207681_10223352 3300025923 Bacteria 1458
254 Ga0207681_11265621 3300025923 Bacteria 620
255 Ga0207650_10016323 3300025925 Bacteria 5189
256 Ga0207650_10048316 3300025925 Bacteria 3138
257 Ga0207650_10622579 3300025925 Bacteria 909
258 Ga0207659_10026603 3300025926 Bacteria 3905
259 Ga0207659_10070840 3300025926 Bacteria 2543
260 Ga0207687_10074839 3300025927 Bacteria 2428
261 Ga0207644_10108500 3300025931 Bacteria 2096
262 Ga0207706_10027640 3300025933 Bacteria 5072
263 Ga0207706_10390117 3300025933 Bacteria 1208
264 Ga0207706_11450225 3300025933 Bacteria 562
265 Ga0207686_10069311 3300025934 Bacteria 2262
266 Ga0207686_10074842 3300025934 Bacteria 2190
267 Ga0207709_10119652 3300025935 Bacteria 1776
268 Ga0207670_10922622 3300025936 Bacteria 732
269 Ga0207670_11174794 3300025936 Bacteria 649
270 Ga0207669_10048481 3300025937 Bacteria 2524
271 Ga0207669_10428342 3300025937 Bacteria 1043
272 Ga0207704_10013996 3300025938 Bacteria 4037
273 Ga0207691_10019196 3300025940 Bacteria 6472
274 Ga0207711_10049056 3300025941 Bacteria 3614
275 Ga0207711_10159816 3300025941 Bacteria 2038
276 Ga0207689_10020355 3300025942 Bacteria 5587
277 Ga0207689_10259997 3300025942 Bacteria 1436
278 Ga0207689_10310174 3300025942 Bacteria 1308
279 Ga0207689_10709209 3300025942 Bacteria 849
280 Ga0207679_10539665 3300025945 Bacteria 1045
281 Ga0207679_11021490 3300025945 Bacteria 758
282 Ga0207651_10034980 3300025960 Bacteria 3260
283 Ga0207651_10214011 3300025960 Bacteria 1553
284 Ga0207651_11114208 3300025960 Bacteria 708
285 Ga0207668_10090248 3300025972 Bacteria 2249
286 Ga0207668_10600703 3300025972 Bacteria 958
287 Ga0207668_11314764 3300025972 Bacteria 651
288 Ga0207640_10645435 3300025981 Bacteria 901
289 Ga0207703_10199695 3300026035 Bacteria 1776
290 Ga0207703_10222411 3300026035 Bacteria 1689
291 Ga0207703_11921027 3300026035 Bacteria 568
292 Ga0207639_10366299 3300026041 Bacteria 1291
293 Ga0207678_10017233 3300026067 Bacteria 6342
294 Ga0207708_10002091 3300026075 Bacteria 14691
295 Ga0207708_10360971 3300026075 Bacteria 1194
296 Ga0207702_10014837 3300026078 Bacteria 6462
297 Ga0207641_10047696 3300026088 Bacteria 3613
298 Ga0207641_10070674 3300026088 Bacteria 3000
299 Ga0207641_10079042 3300026088 Bacteria 2851
300 Ga0207648_10001969 3300026089 Bacteria 22425
301 Ga0207648_10184989 3300026089 Bacteria 1845
302 Ga0207676_10089537 3300026095 Bacteria 2522
303 Ga0207676_10148475 3300026095 Bacteria 2016
304 Ga0207676_10331883 3300026095 Bacteria 1400
305 Ga0207676_10809893 3300026095 Bacteria 914
306 Ga0207674_10305098 3300026116 Bacteria 1541
307 Ga0207674_10459752 3300026116 Bacteria 1230
308 Ga0207675_100145054 3300026118 Bacteria 2257
309 Ga0207675_100245586 3300026118 Bacteria 1731
310 Ga0207675_100415951 3300026118 Bacteria 1327
311 Ga0207675_100926679 3300026118 Bacteria 888
312 Ga0207675_101253587 3300026118 Bacteria 762
313 Ga0207675_101625485 3300026118 Bacteria 666
314 Ga0207675_101957420 3300026118 Bacteria 604
315 Ga0207683_10015260 3300026121 Bacteria 6538
316 Ga0209813_10066161 3300027866 Bacteria 1165
317 Ga0207428_10000060 3300027907 Bacteria 156452
318 Ga0207428_10210820 3300027907 Bacteria 1459
319 Ga0207428_10224630 3300027907 Bacteria 1406
320 Ga0268266_10098603 3300028379 Bacteria 2571
321 Ga0268265_10024092 3300028380 Bacteria 4301
322 Ga0268264_10114445 3300028381 Bacteria 2368
323 Ga0268264_10242940 3300028381 Bacteria 1669
324 Ga0316579_10378952 3300031691 Bacteria 684
325 Ga0316577_10806060 3300031733 Unclassified 533
326 Ga0307410_10224695 3300031852 Bacteria 1446
327 Ga0307410_11074182 3300031852 Bacteria 697
328 Ga0307409_100223167 3300031995 Bacteria 1703
329 Ga0307416_101327079 3300032002 Unclassified 825
330 Ga0307415_101126922 3300032126 Bacteria 736
331 Ga0373954_0608539 3300035118 Bacteria 542
332 Ga0373924_0572241 3300035410 Bacteria 509
333 Ga0373931_0605162 3300035691 Bacteria 717
334 Ga0373937_0619334 3300036401 Bacteria 1027
335 Ga0436364_0058494 3300037853 Bacteria 1367
336 Ga0451847_0522228 3300041503 Bacteria 536
337 Ga0439448_0281485 3300042005 Unclassified 589
338 Ga0439451_130770 3300042009 Bacteria 513
339 Ga0451577_0002995 3300042876 Bacteria 19246
340 Ga0451577_0372810 3300042876 Bacteria 1295
341 Ga0451577_1675911 3300042876 Bacteria 560
342 Ga0453684_0032536 3300044712 Bacteria 7296
343 Ga0453684_0155851 3300044712 Bacteria 2708
344 Ga0453684_0380813 3300044712 Bacteria 1584
345 Ga0453684_1258724 3300044712 Unclassified 774
346 Ga0451576_2002116 3300045051 Bacteria 597
347 Ga0451576_2704310 3300045051 Bacteria 505
348 Ga0495629_0013862 3300046459 Bacteria 5816
349 Ga0495641_0403704 3300046461 Bacteria 620
350 Ga0495580_0994044 3300046472 Bacteria 535
351 Ga0495639_0029957 3300046475 Bacteria 2417
352 Ga0495583_0280947 3300046506 Bacteria 664
353 Ga0495666_0081871 3300046526 Bacteria 1527
354 Ga0495640_0257753 3300046533 Bacteria 1090
355 Ga0495621_0293945 3300046539 Bacteria 672
356 Ga0495622_0119235 3300046557 Bacteria 1205
357 Ga0495634_0419445 3300046642 Bacteria 793
358 Ga0495634_0747493 3300046642 Bacteria 560
359 Ga0495658_0103005 3300046683 Bacteria 1706
360 Ga0495658_0316995 3300046683 Bacteria 988
361 Ga0495669_0379141 3300046684 Bacteria 684
362 Ga0495624_0427728 3300046690 Bacteria 794
363 Ga0495600_0652369 3300046809 Bacteria 636
364 Ga0495581_0100705 3300047315 Bacteria 1678
365 Ga0495672_0052111 3300047320 Bacteria 2405
366 Ga0495676_0021477 3300047321 Bacteria 5636
367 Ga0496100_0169965 3300048903 Bacteria 1569
368 Ga0496101_0567527 3300048904 Bacteria 897
369 Ga0496104_0009688 3300048907 Bacteria 8583
370 Ga0496105_0582301 3300048908 Bacteria 870
371 Ga0496106_1584081 3300048909 Bacteria 502
372 Ga0496107_0093561 3300048910 Bacteria 2198
373 Ga0496108_0065953 3300048911 Bacteria 3052
374 Ga0496109_0187634 3300048912 Bacteria 1943
375 Ga0496110_0042104 3300048913 Bacteria 3986
376 Ga0496112_0001501 3300048915 Bacteria 17968
377 Ga0496113_0024353 3300048916 Bacteria 4301
378 Ga0501031_0589335 3300049568 Bacteria 715
379 Ga0501032_0607761 3300049569 Bacteria 695
380 Ga0501033_0632549 3300049570 Bacteria 732
381 Ga0501036_0329960 3300049572 Bacteria 1275
382 Ga0501036_1423759 3300049572 Bacteria 562
383 Ga0501038_0851173 3300049574 Bacteria 675
384 Ga0501039_0195048 3300049575 Bacteria 1592
385 Ga0501041_0201435 3300049577 Bacteria 1248
386 Ga0501041_0304596 3300049577 Bacteria 1004
387 Ga0501042_0042410 3300049578 Bacteria 3239
388 Ga0501042_0462944 3300049578 Bacteria 920
389 Ga0501042_0644021 3300049578 Bacteria 770
390 Ga0501043_1315218 3300049579 Bacteria 504
391 Ga0501048_0231389 3300049582 Bacteria 1311
392 Ga0501071_0011289 3300049587 Bacteria 6012
393 Ga0501071_0531134 3300049587 Bacteria 903
394 Ga0501072_0254197 3300049588 Bacteria 1399
395 Ga0501074_0044376 3300049590 Bacteria 3219
396 Ga0501075_0034619 3300049591 Bacteria 3761
397 Ga0501075_0089357 3300049591 Bacteria 2336
398 Ga0501075_0378982 3300049591 Bacteria 1078
399 Ga0501075_0473019 3300049591 Bacteria 956
400 Ga0501076_0002562 3300049592 Bacteria 12504
401 Ga0501076_0112061 3300049592 Bacteria 2206
402 Ga0501076_0470866 3300049592 Bacteria 1035
403 Ga0501076_1562946 3300049592 Bacteria 541
404 Ga0501077_0419367 3300049593 Bacteria 856
405 Ga0501079_0145249 3300049741 Bacteria 1849
406 Ga0501079_0324075 3300049741 Bacteria 1206
407 Ga0501079_0713227 3300049741 Bacteria 789
408 Ga0501079_0940405 3300049741 Bacteria 681
409 Ga0501080_0295990 3300049742 Bacteria 1469
410 Ga0501080_0476158 3300049742 Bacteria 1117
411 Ga0501080_0969348 3300049742 Unclassified 739
412 Ga0501081_0081204 3300049743 Bacteria 2271
413 Ga0501081_0430059 3300049743 Bacteria 979
414 Ga0501081_1123140 3300049743 Bacteria 595
415 Ga0501044_1575416 3300049823 Bacteria 522
416 Ga0501045_0059739 3300049824 Bacteria 2794
417 Ga0501045_0446332 3300049824 Bacteria 962
418 Ga0501045_0607714 3300049824 Bacteria 809
419 nmdc:mga03683_542531_c1 3300050489 Bacteria 566
420 nmdc:mga00v17_74339_c1 3300050491 Bacteria 2112
421 nmdc:mga0yw44_31884_c1 3300050492 Bacteria 3068
422 nmdc:mga0k408_700_c1 3300050493 Bacteria 18347
423 nmdc:mga06z11_2593_c1 3300050494 Bacteria 6923
424 nmdc:mga04h51_62851_c1 3300050495 Bacteria 1277
425 nmdc:mga07m45_25866_c1 3300050496 Bacteria 3223
426 nmdc:mga07m45_47091_c1 3300050496 Bacteria 2423
427 nmdc:mga05p37_105390_c1 3300050507 Bacteria 3469
428 nmdc:mga05p37_18014_c1 3300050507 Bacteria 8529
429 nmdc:mga05p37_404081_c1 3300050507 Bacteria 1594
430 nmdc:mga05p37_530577_c1 3300050507 Bacteria 1344
431 nmdc:mga05p37_79857_c1 3300050507 Bacteria 4028
432 nmdc:mga05p37_91896_c1 3300050507 Bacteria 3739
433 nmdc:mga09592_1125903_c1 3300050508 Bacteria 651
434 nmdc:mga09592_233157_c1 3300050508 Bacteria 1595
435 nmdc:mga09592_51838_c1 3300050508 Bacteria 3462
436 nmdc:mga09592_64374_c1 3300050508 Bacteria 3104
437 nmdc:mga09592_843643_c1 3300050508 Bacteria 773
438 nmdc:mga0qj67_9754_c1 3300050509 Bacteria 7151
439 nmdc:mga06r32_1136601_c1 3300050510 Bacteria 729
440 nmdc:mga06r32_241152_c1 3300050510 Bacteria 1795
441 nmdc:mga06r32_449709_c1 3300050510 Bacteria 1268
442 nmdc:mga06r32_49276_c1 3300050510 Bacteria 4028
443 nmdc:mga06r32_830890_c1 3300050510 Bacteria 883
444 nmdc:mga08y16_12242_c1 3300050511 Bacteria 9014
445 nmdc:mga08y16_54307_c1 3300050511 Bacteria 4186
446 nmdc:mga0n895_242289_c1 3300050512 Bacteria 1830
447 nmdc:mga0n895_247778_c1 3300050512 Bacteria 1808
448 nmdc:mga0n895_25644_c1 3300050512 Bacteria 5573
449 nmdc:mga0n895_530721_c1 3300050512 Bacteria 1184
450 nmdc:mga0rr50_115002_c1 3300050513 Bacteria 2134
451 nmdc:mga0rr50_1446449_c1 3300050513 Bacteria 581
452 nmdc:mga08x19_149408_c1 3300050514 Bacteria 1581
453 nmdc:mga08x19_21949_c1 3300050514 Bacteria 3947
454 nmdc:mga0a205_178406_c1 3300050515 Bacteria 1236
455 nmdc:mga0a205_228432_c1 3300050515 Bacteria 1745
456 nmdc:mga0a205_32269_c1 3300050515 Bacteria 5022
457 nmdc:mga0a205_936446_c1 3300050515 Bacteria 713
458 Ga0495601_0176566 3300053077 Bacteria 1396
459 Ga0495595_0454173 3300053084 Bacteria 651
460 Ga0495619_0003559 3300053085 Bacteria 10049
461 Ga0495619_0474612 3300053085 Bacteria 861
462 Ga0500589_201583 3300053147 Bacteria 764
463 Ga0500657_234691 3300053728 Bacteria 565
464 Ga0500645_009955 3300053730 Bacteria 3170
465 Ga0501084_0623216 3300054114 Bacteria 911
466 Ga0590071_137685 3300059421 Bacteria 629
467 Ga0501082_0045914 3300060353 Bacteria 3767
468 Ga0501082_0117102 3300060353 Bacteria 2308
469 Ga0501082_0206339 3300060353 Bacteria 1710
470 Ga0501082_0420796 3300060353 Bacteria 1167
471 Ga0501082_0709312 3300060353 Bacteria 880
472 Ga0530510_0523929 3300061734 Bacteria 899
473 Ga0075370_10078289
474 JGI25406J46586_10006995
475 JGI25407J50210_10013796
476 Ga0065712_10000240
477 Ga0065715_10000461
478 Ga0070676_10982103
479 Ga0070690_100014126
480 Ga0070690_100018394
481 Ga0070690_100234131
482 Ga0070690_100965286
483 Ga0070670_100029058
484 Ga0070670_100280323
485 Ga0070670_100423030
486 Ga0068869_100077706
487 Ga0068869_100197412
488 Ga0068869_100241558
489 Ga0070680_101433158
490 Ga0068868_100100247
491 Ga0070689_100032111
492 Ga0070689_100296007
493 Ga0070689_101450868
494 Ga0070687_100130181
495 Ga0070687_100819991
496 Ga0070661_101045508
497 Ga0070692_10589085
498 Ga0070668_100053386
499 Ga0070668_100975650
500 Ga0070669_100127779
501 Ga0070669_100162027
502 Ga0070675_100007860
503 Ga0070675_100071161
504 Ga0070675_100332182
505 Ga0070674_100479847
506 Ga0070674_100852101
507 Ga0070673_100022470
508 Ga0070688_100020144
509 Ga0070688_100028781
510 Ga0070688_100177502
511 Ga0070659_101406943
512 Ga0070667_100521029
513 Ga0070703_10141785
514 Ga0070701_10111445
515 Ga0070701_10576930
516 Ga0070701_10881648
517 Ga0070705_100029368
518 Ga0070705_100607013
519 Ga0070705_100964755
520 Ga0070700_100173059
521 Ga0070700_100482863
522 Ga0070700_101915441
523 Ga0070694_100017964
524 Ga0070694_100030807
525 Ga0070694_100095081
526 Ga0070694_100639835
527 Ga0070694_101004558
528 Ga0070694_101502992
529 Ga0070708_100094432
530 Ga0070708_100185277
531 Ga0070663_101681789
532 Ga0070678_100051312
533 Ga0070662_100586327
534 Ga0070662_100884836
535 Ga0070662_101814253
536 Ga0070681_10356972
537 Ga0068867_100005754
538 Ga0070685_10003607
539 Ga0070685_10029066
540 Ga0070706_100051965
541 Ga0070706_100069278
542 Ga0070706_100318170
543 Ga0070707_100005150
544 Ga0070707_100006346
545 Ga0070707_100074460
546 Ga0070707_100473639
547 Ga0070698_100006525
548 Ga0070698_100063875
549 Ga0070698_101042871
550 Ga0070699_100005214
551 Ga0070699_100175744
552 Ga0070699_100527647
553 Ga0070697_100061009
554 Ga0070697_100168853
555 Ga0070697_100462031
556 Ga0068853_101700008
557 Ga0070672_100017929
558 Ga0070672_100603603
559 Ga0070686_100027890
560 Ga0070686_100034991
561 Ga0070686_100194815
562 Ga0070695_100001271
563 Ga0070695_100025526
564 Ga0070695_100107533
565 Ga0070695_100406905
566 Ga0070695_100474504
567 Ga0070695_100877416
568 Ga0070695_101743294
569 Ga0070696_100065386
570 Ga0070696_100066787
571 Ga0070696_100631241
572 Ga0070696_101789522
573 Ga0070665_100261816
574 Ga0070704_100024511
575 Ga0070704_100204474
576 Ga0070704_100438881
577 Ga0070704_100480894
578 Ga0070704_100552062
579 Ga0070704_100678566
580 Ga0070664_100707379
581 Ga0070664_100860258
582 Ga0068857_100466629
583 Ga0068854_100594665
584 Ga0068854_100642732
585 Ga0068856_100003343
586 Ga0068859_100014601
587 Ga0068859_100029022
588 Ga0068859_101597764
589 Ga0068864_100145840
590 Ga0068864_100172666
591 Ga0068864_100605117
592 Ga0068864_101694852
593 Ga0068866_10107893
594 Ga0068866_10695988
595 Ga0068861_100188601
596 Ga0068861_100252548
597 Ga0068861_102542054
598 Ga0068870_10040333
599 Ga0068870_10400501
600 Ga0068870_10562060
601 Ga0068863_100288678
602 Ga0068863_100547918
603 Ga0068858_100018211
604 Ga0068858_100542038
605 Ga0068858_101879306
606 Ga0068860_100010739
607 Ga0068860_100729581
608 Ga0068860_101222487
609 Ga0068860_102513273
610 Ga0068862_100476641
611 Ga0068862_100653115
612 Ga0081455_10013894
613 Ga0081538_10009903
614 Ga0075365_10021599
615 Ga0075368_10017022
616 Ga0075363_100467849
617 Ga0075364_10053682
618 Ga0075364_10991989
619 Ga0075362_10175651
620 Ga0075367_10072927
621 Ga0075367_10358972
622 Ga0075366_10000055
623 Ga0097621_100278017
624 Ga0097621_101586921
625 Ga0075370_10033851
626 Ga0068871_100093502
627 Ga0075428_100004773
628 Ga0075428_100327103
629 Ga0075428_102485971
630 Ga0075430_100028418
631 Ga0075430_101030618
632 Ga0075430_101547779
633 Ga0075431_100041827
634 Ga0075431_100367100
635 Ga0075431_100649844
636 Ga0075431_100746284
637 Ga0075431_100944776
638 Ga0075431_101351851
639 Ga0075433_10013704
640 Ga0075433_10243185
641 Ga0075434_100022664
642 Ga0075434_100081985
643 Ga0075434_101729721
644 Ga0075429_100012748
645 Ga0075429_100164444
646 Ga0075429_100560731
647 Ga0075429_101789489
648 Ga0068865_100007943
649 Ga0068865_101179869
650 Ga0075436_100195262
651 Ga0075436_100269612
652 Ga0097620_100014600
653 Ga0097620_100029022
654 Ga0097620_100396711
655 Ga0097620_101597709
656 Ga0075435_100184194
657 Ga0075435_100428902
658 Ga0075435_101378532
659 Ga0105240_11574653
660 Ga0105240_12747671
661 Ga0111539_10005357
662 Ga0111539_10024197
663 Ga0111539_10319787
664 Ga0111539_11020512
665 Ga0105245_10183411
666 Ga0105245_10916714
667 Ga0105247_11301505
668 Ga0114129_10034293
669 Ga0114129_10060091
670 Ga0114129_10066599
671 Ga0114129_10213297
672 Ga0114129_10397977
673 Ga0114129_11020339
674 Ga0114129_11241067
675 Ga0114129_11561777
676 Ga0105243_10048042
677 Ga0105243_10283908
678 Ga0105241_10880415
679 Ga0105242_10048455
680 Ga0105242_10084593
681 Ga0105248_10066998
682 Ga0105248_10092064
683 Ga0105248_10430182
684 Ga0105237_10172459
685 Ga0105249_10758255
686 Ga0105239_10467547
687 Ga0105239_11723099
688 Ga0105239_12004809
689 Ga0105246_10650940
690 Ga0157374_10539200
691 Ga0163162_10074270
692 Ga0163162_13331526
693 Ga0157375_10028714
694 Ga0157375_10597610
695 Ga0163163_10299530
696 Ga0163163_10549148
697 Ga0157380_10027390
698 Ga0157380_10416975
699 Ga0157380_12540658
700 Ga0157377_10053362
701 Ga0157379_11266973
702 Ga0157376_10310036
703 Ga0163161_10379843
704 Ga0163161_10466212
705 Ga0207697_10062387
706 Ga0207653_10038342
707 Ga0207653_10190644
708 Ga0207642_10103152
709 Ga0207680_11226875
710 Ga0207643_10979348
711 Ga0207684_10011034
712 Ga0207684_10063272
713 Ga0207684_10358315
714 Ga0207684_10790593
715 Ga0207654_11431426
716 Ga0207707_10666364
717 Ga0207662_10008287
718 Ga0207662_10829800
719 Ga0207646_10001206
720 Ga0207646_10025144
721 Ga0207646_10119811
722 Ga0207646_10212621
723 Ga0207646_10360423
724 Ga0207681_10150171
725 Ga0207681_10223352
726 Ga0207681_11265621
727 Ga0207650_10016323
728 Ga0207650_10048316
729 Ga0207650_10622579
730 Ga0207659_10026603
731 Ga0207659_10070840
732 Ga0207687_10074839
733 Ga0207644_10108500
734 Ga0207706_10027640
735 Ga0207706_10390117
736 Ga0207706_11450225
737 Ga0207686_10069311
738 Ga0207686_10074842
739 Ga0207709_10119652
740 Ga0207670_10922622
741 Ga0207670_11174794
742 Ga0207669_10048481
743 Ga0207669_10428342
744 Ga0207704_10013996
745 Ga0207691_10019196
746 Ga0207711_10049056
747 Ga0207711_10159816
748 Ga0207689_10020355
749 Ga0207689_10259997
750 Ga0207689_10310174
751 Ga0207689_10709209
752 Ga0207679_10539665
753 Ga0207679_11021490
754 Ga0207651_10034980
755 Ga0207651_10214011
756 Ga0207651_11114208
757 Ga0207668_10090248
758 Ga0207668_10600703
759 Ga0207668_11314764
760 Ga0207640_10645435
761 Ga0207703_10199695
762 Ga0207703_10222411
763 Ga0207703_11921027
764 Ga0207639_10366299
765 Ga0207678_10017233
766 Ga0207708_10002091
767 Ga0207708_10360971
768 Ga0207702_10014837
769 Ga0207641_10047696
770 Ga0207641_10070674
771 Ga0207641_10079042
772 Ga0207648_10001969
773 Ga0207648_10184989
774 Ga0207676_10089537
775 Ga0207676_10148475
776 Ga0207676_10331883
777 Ga0207676_10809893
778 Ga0207674_10305098
779 Ga0207674_10459752
780 Ga0207675_100145054
781 Ga0207675_100245586
782 Ga0207675_100415951
783 Ga0207675_100926679
784 Ga0207675_101253587
785 Ga0207675_101625485
786 Ga0207675_101957420
787 Ga0207683_10015260
788 Ga0209813_10066161
789 Ga0207428_10000060
790 Ga0207428_10210820
791 Ga0207428_10224630
792 Ga0268266_10098603
793 Ga0268265_10024092
794 Ga0268264_10114445
795 Ga0268264_10242940
796 Ga0316579_10378952
797 Ga0316577_10806060
798 Ga0307410_10224695
799 Ga0307410_11074182
800 Ga0307409_100223167
801 Ga0307416_101327079
802 Ga0307415_101126922
803 Ga0373954_0608539
804 Ga0373924_0572241
805 Ga0373931_0605162
806 Ga0373937_0619334
807 Ga0436364_0058494
808 Ga0451847_0522228
809 Ga0439448_0281485
810 Ga0439451_130770
811 Ga0451577_0002995
812 Ga0451577_0372810
813 Ga0451577_1675911
814 Ga0453684_0032536
815 Ga0453684_0155851
816 Ga0453684_0380813
817 Ga0453684_1258724
818 Ga0451576_2002116
819 Ga0451576_2704310
820 Ga0495629_0013862
821 Ga0495641_0403704
822 Ga0495580_0994044
823 Ga0495639_0029957
824 Ga0495583_0280947
825 Ga0495666_0081871
826 Ga0495640_0257753
827 Ga0495621_0293945
828 Ga0495622_0119235
829 Ga0495634_0419445
830 Ga0495634_0747493
831 Ga0495658_0103005
832 Ga0495658_0316995
833 Ga0495669_0379141
834 Ga0495624_0427728
835 Ga0495600_0652369
836 Ga0495581_0100705
837 Ga0495672_0052111
838 Ga0495676_0021477
839 Ga0496100_0169965
840 Ga0496101_0567527
841 Ga0496104_0009688
842 Ga0496105_0582301
843 Ga0496106_1584081
844 Ga0496107_0093561
845 Ga0496108_0065953
846 Ga0496109_0187634
847 Ga0496110_0042104
848 Ga0496112_0001501
849 Ga0496113_0024353
850 Ga0501031_0589335
851 Ga0501032_0607761
852 Ga0501033_0632549
853 Ga0501036_0329960
854 Ga0501036_1423759
855 Ga0501038_0851173
856 Ga0501039_0195048
857 Ga0501041_0201435
858 Ga0501041_0304596
859 Ga0501042_0042410
860 Ga0501042_0462944
861 Ga0501042_0644021
862 Ga0501043_1315218
863 Ga0501048_0231389
864 Ga0501071_0011289
865 Ga0501071_0531134
866 Ga0501072_0254197
867 Ga0501074_0044376
868 Ga0501075_0034619
869 Ga0501075_0089357
870 Ga0501075_0378982
871 Ga0501075_0473019
872 Ga0501076_0002562
873 Ga0501076_0112061
874 Ga0501076_0470866
875 Ga0501076_1562946
876 Ga0501077_0419367
877 Ga0501079_0145249
878 Ga0501079_0324075
879 Ga0501079_0713227
880 Ga0501079_0940405
881 Ga0501080_0295990
882 Ga0501080_0476158
883 Ga0501080_0969348
884 Ga0501081_0081204
885 Ga0501081_0430059
886 Ga0501081_1123140
887 Ga0501044_1575416
888 Ga0501045_0059739
889 Ga0501045_0446332
890 Ga0501045_0607714
891 nmdc:mga03683_542531_c1
892 nmdc:mga00v17_74339_c1
893 nmdc:mga0yw44_31884_c1
894 nmdc:mga0k408_700_c1
895 nmdc:mga06z11_2593_c1
896 nmdc:mga04h51_62851_c1
897 nmdc:mga07m45_25866_c1
898 nmdc:mga07m45_47091_c1
899 nmdc:mga05p37_105390_c1
900 nmdc:mga05p37_18014_c1
901 nmdc:mga05p37_404081_c1
902 nmdc:mga05p37_530577_c1
903 nmdc:mga05p37_79857_c1
904 nmdc:mga05p37_91896_c1
905 nmdc:mga09592_1125903_c1
906 nmdc:mga09592_233157_c1
907 nmdc:mga09592_51838_c1
908 nmdc:mga09592_64374_c1
909 nmdc:mga09592_843643_c1
910 nmdc:mga0qj67_9754_c1
911 nmdc:mga06r32_1136601_c1
912 nmdc:mga06r32_241152_c1
913 nmdc:mga06r32_449709_c1
914 nmdc:mga06r32_49276_c1
915 nmdc:mga06r32_830890_c1
916 nmdc:mga08y16_12242_c1
917 nmdc:mga08y16_54307_c1
918 nmdc:mga0n895_242289_c1
919 nmdc:mga0n895_247778_c1
920 nmdc:mga0n895_25644_c1
921 nmdc:mga0n895_530721_c1
922 nmdc:mga0rr50_115002_c1
923 nmdc:mga0rr50_1446449_c1
924 nmdc:mga08x19_149408_c1
925 nmdc:mga08x19_21949_c1
926 nmdc:mga0a205_178406_c1
927 nmdc:mga0a205_228432_c1
928 nmdc:mga0a205_32269_c1
929 nmdc:mga0a205_936446_c1
930 Ga0495601_0176566
931 Ga0495595_0454173
932 Ga0495619_0003559
933 Ga0495619_0474612
934 Ga0500589_201583
935 Ga0500657_234691
936 Ga0500645_009955
937 Ga0501084_0623216
938 Ga0590071_137685
939 Ga0501082_0045914
940 Ga0501082_0117102
941 Ga0501082_0206339
942 Ga0501082_0420796
943 Ga0501082_0709312
944 Ga0530510_0523929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

25

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wg5-assembly1.cif.gz_E cyclic electron transport supercomplex ndh-psi from arabidopsis 0.921 3 85
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.9185 3 84
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.9178 9 86
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.9173 3 84
8e73-assembly1.cif.gz_4L vigna radiata supercomplex i+iii2 (full bridge) 0.9127 3 86
ID Description Score Start End Superfamily
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9366 6 86 1.10.287.3510
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9339 6 86 1.10.287.3510
af_Q2FZV1_630_695_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9328 13 76 1.10.287.3510
4heaS00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9187 6 86 1.10.287.3510
6nbqE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9056 1 86 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A1G0MJL9-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9713 3 85 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A1V5UB10-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9553 1 86 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-C8XH07-F1-model_v4 Multiple resistance and pH regulation protein F 0.9514 3 73 GO:0005886
GO:0015385
AF-R4Z183-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9503 3 86 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A3C0HIU2-F1-model_v4 Cation:proton antiporter 0.9498 3 79 GO:0005886
GO:0015385

Map