F450664

General Info

Members Datasets Scaffolds Average Seq Length
471 161 943 222

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0015926|Ga0495642_0015926_1390_2139
Length 249
Sequence MLNCHQNRRMAAKPWAAEGGIQMPLNPDASIEITAFRWVPTGAQGLVKDLRVRWALEEAGLEYKVRLIGPERPAGYANDQPFSQVPCLRDDTVRIFESGAILQYIGEQAEALLPSDPQARFRAIQWTYAAVSSVEPFVQFRALLNVVFADQPWAEPAKPTFEHFARLRLQQLADDLGDKRWLEGDQFTIGDVMMITVLRIADRSGQLADFPSLAAYVQRGQERPAFKQALGDQLAVFAANEPQPEGAAA

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.4
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0015926 3300046528 Bacteria 2927
2 JGI24740J21852_10017636 3300001979 Bacteria 2548
3 JGI24740J21852_10057453 3300001979 Bacteria 1086
4 JGI24737J22298_10094892 3300001990 Bacteria 884
5 JGI24735J21928_10018825 3300002067 Bacteria 2127
6 rootH1_10011305 3300003316 Bacteria 3850
7 rootH1_10011305 3300003323 Bacteria 2174
8 Ga0065715_10108728 3300005293 Bacteria 2704
9 Ga0065715_10146947 3300005293 Bacteria 1777
10 Ga0070658_10002368 3300005327 Bacteria 15812
11 Ga0070658_10007895 3300005327 Bacteria 8570
12 Ga0070658_10069968 3300005327 Bacteria 2872
13 Ga0070658_10072381 3300005327 Bacteria 2825
14 Ga0070658_10112129 3300005327 Bacteria 2260
15 Ga0070658_10159596 3300005327 Bacteria 1891
16 Ga0070658_10191742 3300005327 Bacteria 1722
17 Ga0070658_10305697 3300005327 Bacteria 1356
18 Ga0070676_10029039 3300005328 Bacteria 3143
19 Ga0070683_100009073 3300005329 Bacteria 8487
20 Ga0070683_100041784 3300005329 Bacteria 4220
21 Ga0070683_100235898 3300005329 Bacteria 1739
22 Ga0070683_100487905 3300005329 Bacteria 1177
23 Ga0070683_100829041 3300005329 Bacteria 887
24 Ga0070690_100003098 3300005330 Bacteria 9045
25 Ga0070670_100023229 3300005331 Bacteria 5337
26 Ga0070670_100064626 3300005331 Bacteria 3139
27 Ga0070670_100156939 3300005331 Bacteria 1971
28 Ga0070677_10011157 3300005333 Bacteria 3090
29 Ga0068869_100055977 3300005334 Bacteria 2875
30 Ga0070666_10069622 3300005335 Bacteria 2392
31 Ga0070666_10076128 3300005335 Bacteria 2289
32 Ga0070680_100000883 3300005336 Bacteria 21248
33 Ga0070680_100019069 3300005336 Bacteria 5430
34 Ga0070680_100050052 3300005336 Bacteria 3407
35 Ga0070680_100066887 3300005336 Bacteria 2947
36 Ga0070680_100929153 3300005336 Unclassified 751
37 Ga0070682_100036112 3300005337 Bacteria 3020
38 Ga0070682_100115898 3300005337 Bacteria 1792
39 Ga0070682_100188089 3300005337 Bacteria 1448
40 Ga0068868_100115027 3300005338 Bacteria 2189
41 Ga0070660_100010679 3300005339 Bacteria 6497
42 Ga0070660_100049916 3300005339 Bacteria 3218
43 Ga0070660_100063598 3300005339 Bacteria 2869
44 Ga0070660_100064495 3300005339 Bacteria 2850
45 Ga0070660_100080883 3300005339 Bacteria 2550
46 Ga0070660_100115588 3300005339 Bacteria 2139
47 Ga0070660_100263880 3300005339 Bacteria 1407
48 Ga0070660_100267606 3300005339 Bacteria 1396
49 Ga0070660_100268748 3300005339 Bacteria 1393
50 Ga0070660_100485491 3300005339 Bacteria 1027
51 Ga0070687_100028732 3300005343 Bacteria 2700
52 Ga0070661_100011558 3300005344 Bacteria 6151
53 Ga0070661_100022673 3300005344 Bacteria 4496
54 Ga0070661_100029606 3300005344 Bacteria 3952
55 Ga0070661_100031865 3300005344 Bacteria 3814
56 Ga0070661_100033595 3300005344 Bacteria 3716
57 Ga0070661_100046769 3300005344 Bacteria 3166
58 Ga0070661_100113894 3300005344 Bacteria 2021
59 Ga0070661_100143395 3300005344 Bacteria 1801
60 Ga0070661_100360277 3300005344 Bacteria 1143
61 Ga0070692_10012745 3300005345 Bacteria 3902
62 Ga0070692_10028978 3300005345 Bacteria 2757
63 Ga0070692_10031761 3300005345 Bacteria 2649
64 Ga0070675_100031113 3300005354 Bacteria 4313
65 Ga0070675_100035688 3300005354 Bacteria 4042
66 Ga0070675_100041860 3300005354 Bacteria 3742
67 Ga0070675_100051429 3300005354 Bacteria 3386
68 Ga0070671_100132166 3300005355 Bacteria 2102
69 Ga0070671_100354532 3300005355 Unclassified 1252
70 Ga0070673_100014339 3300005364 Bacteria 5515
71 Ga0070673_100076854 3300005364 Bacteria 2697
72 Ga0070659_100004304 3300005366 Bacteria 10163
73 Ga0070659_100006144 3300005366 Bacteria 8670
74 Ga0070659_100010984 3300005366 Bacteria 6687
75 Ga0070659_100021859 3300005366 Bacteria 4879
76 Ga0070659_100059163 3300005366 Bacteria 3025
77 Ga0070659_100059658 3300005366 Bacteria 3012
78 Ga0070659_100164702 3300005366 Bacteria 1814
79 Ga0070659_100174651 3300005366 Bacteria 1761
80 Ga0070659_100190294 3300005366 Bacteria 1686
81 Ga0070659_100241843 3300005366 Bacteria 1494
82 Ga0070659_100325551 3300005366 Bacteria 1285
83 Ga0070667_100209672 3300005367 Bacteria 1731
84 Ga0070667_100537112 3300005367 Bacteria 1074
85 Ga0070714_100333229 3300005435 Bacteria 1422
86 Ga0070663_100023505 3300005455 Bacteria 4132
87 Ga0070663_100028766 3300005455 Bacteria 3788
88 Ga0070663_100293726 3300005455 Bacteria 1299
89 Ga0070663_100400368 3300005455 Bacteria 1122
90 Ga0070678_100022589 3300005456 Bacteria 4173
91 Ga0070678_100173448 3300005456 Bacteria 1758
92 Ga0070662_100035953 3300005457 Bacteria 3501
93 Ga0070662_100044495 3300005457 Bacteria 3180
94 Ga0070662_100059973 3300005457 Bacteria 2773
95 Ga0070662_100110153 3300005457 Bacteria 2096
96 Ga0070662_100195069 3300005457 Bacteria 1604
97 Ga0070662_100196154 3300005457 Bacteria 1599
98 Ga0070662_100467481 3300005457 Bacteria 1049
99 Ga0070662_100812514 3300005457 Unclassified 795
100 Ga0070681_10003859 3300005458 Bacteria 14106
101 Ga0070681_10219298 3300005458 Bacteria 1817
102 Ga0070681_10387833 3300005458 Bacteria 1308
103 Ga0070681_10540420 3300005458 Bacteria 1079
104 Ga0068867_100030971 3300005459 Bacteria 3860
105 Ga0070685_10105789 3300005466 Bacteria 1725
106 Ga0070679_100053786 3300005530 Bacteria 4008
107 Ga0070679_100069940 3300005530 Bacteria 3501
108 Ga0070679_100074475 3300005530 Bacteria 3386
109 Ga0070679_100170743 3300005530 Bacteria 2148
110 Ga0070679_100318764 3300005530 Bacteria 1504
111 Ga0070679_100325214 3300005530 Bacteria 1487
112 Ga0070679_100363950 3300005530 Bacteria 1393
113 Ga0070679_100527658 3300005530 Bacteria 1124
114 Ga0070684_100003085 3300005535 Bacteria 12436
115 Ga0070684_100011482 3300005535 Bacteria 7054
116 Ga0070684_100030635 3300005535 Bacteria 4572
117 Ga0068853_100053671 3300005539 Bacteria 3470
118 Ga0068853_100093027 3300005539 Bacteria 2653
119 Ga0068853_100109447 3300005539 Bacteria 2452
120 Ga0068853_100159791 3300005539 Bacteria 2033
121 Ga0068853_100449590 3300005539 Bacteria 1212
122 Ga0070672_100017944 3300005543 Bacteria 5104
123 Ga0070672_100055389 3300005543 Bacteria 3106
124 Ga0070672_100115738 3300005543 Bacteria 2190
125 Ga0070672_100581225 3300005543 Unclassified 974
126 Ga0070686_100005832 3300005544 Bacteria 6825
127 Ga0070693_100168720 3300005547 Bacteria 1400
128 Ga0070693_100243208 3300005547 Bacteria 1189
129 Ga0070665_100087255 3300005548 Bacteria 3125
130 Ga0070665_100142990 3300005548 Bacteria 2395
131 Ga0068855_100025103 3300005563 Bacteria 7135
132 Ga0068855_100060700 3300005563 Bacteria 4421
133 Ga0068855_100095436 3300005563 Bacteria 3427
134 Ga0068855_100102154 3300005563 Bacteria 3300
135 Ga0068855_100103048 3300005563 Bacteria 3284
136 Ga0068855_100110459 3300005563 Bacteria 3156
137 Ga0068855_100117499 3300005563 Bacteria 3047
138 Ga0068855_100442412 3300005563 Bacteria 1419
139 Ga0070664_100018856 3300005564 Bacteria 5672
140 Ga0070664_100059002 3300005564 Bacteria 3265
141 Ga0070664_100073407 3300005564 Bacteria 2935
142 Ga0070664_100138779 3300005564 Bacteria 2139
143 Ga0070664_100492549 3300005564 Bacteria 1129
144 Ga0068857_100035284 3300005577 Bacteria 4429
145 Ga0068857_100037178 3300005577 Bacteria 4313
146 Ga0068857_100063747 3300005577 Bacteria 3276
147 Ga0068857_100096493 3300005577 Bacteria 2649
148 Ga0068854_100010491 3300005578 Bacteria 6009
149 Ga0068854_100012472 3300005578 Bacteria 5567
150 Ga0068854_100034134 3300005578 Bacteria 3551
151 Ga0068854_100086632 3300005578 Bacteria 2322
152 Ga0068854_100105358 3300005578 Bacteria 2120
153 Ga0068856_100033122 3300005614 Bacteria 5060
154 Ga0068856_100068135 3300005614 Bacteria 3517
155 Ga0068856_100092051 3300005614 Bacteria 3016
156 Ga0068856_100265746 3300005614 Bacteria 1731
157 Ga0068856_100474103 3300005614 Bacteria 1272
158 Ga0068856_100639912 3300005614 Bacteria 1084
159 Ga0068856_100731296 3300005614 Bacteria 1010
160 Ga0068852_100000335 3300005616 Bacteria 31883
161 Ga0068852_100009282 3300005616 Bacteria 7293
162 Ga0068852_100019017 3300005616 Bacteria 5426
163 Ga0068852_100109815 3300005616 Bacteria 2505
164 Ga0068852_100152796 3300005616 Bacteria 2148
165 Ga0068852_100161834 3300005616 Bacteria 2090
166 Ga0068852_100490150 3300005616 Bacteria 1222
167 Ga0068859_100031175 3300005617 Bacteria 5352
168 Ga0068864_100033988 3300005618 Bacteria 4335
169 Ga0068864_100088353 3300005618 Bacteria 2730
170 Ga0068866_10004709 3300005718 Bacteria 5598
171 Ga0068851_10022088 3300005834 Bacteria 3096
172 Ga0068851_10023411 3300005834 Bacteria 3019
173 Ga0068851_10072284 3300005834 Bacteria 1787
174 Ga0068851_10177933 3300005834 Bacteria 1177
175 Ga0068870_10132449 3300005840 Bacteria 1450
176 Ga0068863_100013325 3300005841 Bacteria 7930
177 Ga0068858_100076758 3300005842 Bacteria 3103
178 Ga0097621_100045537 3300006237 Bacteria 3544
179 Ga0097621_100115329 3300006237 Bacteria 2273
180 Ga0097621_100767088 3300006237 Bacteria 892
181 Ga0068871_100019088 3300006358 Bacteria 5228
182 Ga0097620_100031175 3300006931 Bacteria 5352
183 Ga0105240_10060792 3300009093 Bacteria 4709
184 Ga0105240_10064276 3300009093 Bacteria 4560
185 Ga0105245_10025575 3300009098 Bacteria 5192
186 Ga0105241_10014117 3300009174 Bacteria 5853
187 Ga0105241_10072122 3300009174 Bacteria 2683
188 Ga0105241_10503427 3300009174 Bacteria 1080
189 Ga0105242_10038878 3300009176 Bacteria 3829
190 Ga0105248_10039369 3300009177 Bacteria 5293
191 Ga0105248_10081320 3300009177 Bacteria 3641
192 Ga0105248_10909642 3300009177 Bacteria 994
193 Ga0105237_10020284 3300009545 Bacteria 6856
194 Ga0105237_10170570 3300009545 Bacteria 2176
195 Ga0105238_10026666 3300009551 Bacteria 5891
196 Ga0105238_10032221 3300009551 Bacteria 5334
197 Ga0105238_10103710 3300009551 Bacteria 2825
198 Ga0105239_10047857 3300010375 Bacteria 4687
199 Ga0105239_10068776 3300010375 Bacteria 3892
200 Ga0105239_10209127 3300010375 Bacteria 2187
201 Ga0157373_10016222 3300013100 Bacteria 5436
202 Ga0157373_10043080 3300013100 Bacteria 3225
203 Ga0157373_10045388 3300013100 Bacteria 3136
204 Ga0157373_10157107 3300013100 Bacteria 1600
205 Ga0157373_10218922 3300013100 Bacteria 1343
206 Ga0157373_10449304 3300013100 Bacteria 927
207 Ga0157373_10628217 3300013100 Bacteria 783
208 Ga0157371_10034950 3300013102 Bacteria 3604
209 Ga0157371_10036304 3300013102 Bacteria 3529
210 Ga0157371_10045646 3300013102 Bacteria 3117
211 Ga0157371_10048221 3300013102 Bacteria 3028
212 Ga0157371_10054663 3300013102 Bacteria 2835
213 Ga0157371_10072206 3300013102 Bacteria 2444
214 Ga0157371_10164495 3300013102 Bacteria 1585
215 Ga0157371_10391940 3300013102 Bacteria 1015
216 Ga0157370_10002914 3300013104 Bacteria 20381
217 Ga0157370_10009125 3300013104 Bacteria 10637
218 Ga0157370_10149061 3300013104 Bacteria 2177
219 Ga0157370_10369486 3300013104 Bacteria 1322
220 Ga0157369_10022605 3300013105 Bacteria 7013
221 Ga0157369_10061152 3300013105 Bacteria 4061
222 Ga0157369_10078998 3300013105 Bacteria 3524
223 Ga0157369_10166754 3300013105 Bacteria 2322
224 Ga0157369_10209688 3300013105 Bacteria 2042
225 Ga0157369_10320763 3300013105 Bacteria 1610
226 Ga0157369_10386489 3300013105 Bacteria 1452
227 Ga0157369_10411255 3300013105 Bacteria 1403
228 Ga0157369_10759151 3300013105 Bacteria 997
229 Ga0157374_10010355 3300013296 Bacteria 8021
230 Ga0157374_10274338 3300013296 Bacteria 1663
231 Ga0157378_10755720 3300013297 Bacteria 995
232 Ga0163162_10012953 3300013306 Bacteria 8140
233 Ga0163162_10080998 3300013306 Bacteria 3316
234 Ga0157372_10002766 3300013307 Bacteria 18963
235 Ga0157372_10009142 3300013307 Bacteria 10525
236 Ga0157372_10052378 3300013307 Bacteria 4545
237 Ga0157372_10340982 3300013307 Bacteria 1745
238 Ga0157372_10771859 3300013307 Bacteria 1117
239 Ga0157375_10050138 3300013308 Bacteria 4094
240 Ga0157375_10073931 3300013308 Bacteria 3428
241 Ga0182008_10072232 3300014497 Bacteria 1698
242 Ga0157377_10080499 3300014745 Bacteria 1903
243 Ga0157377_10082376 3300014745 Bacteria 1884
244 Ga0157379_10077397 3300014968 Bacteria 2978
245 Ga0157376_10034982 3300014969 Bacteria 4060
246 Ga0157376_10140240 3300014969 Bacteria 2168
247 Ga0206354_11495107 3300020081 Bacteria 1747
248 Ga0206353_10868385 3300020082 Bacteria 2149
249 Ga0213875_10003050 3300021388 Bacteria 9693
250 Ga0207697_10056569 3300025315 Bacteria 1627
251 Ga0207656_10083369 3300025321 Bacteria 1440
252 Ga0207656_10224888 3300025321 Bacteria 913
253 Ga0207682_10002020 3300025893 Bacteria 9185
254 Ga0207688_10096142 3300025901 Bacteria 1706
255 Ga0207680_10070822 3300025903 Bacteria 2159
256 Ga0207647_10000557 3300025904 Bacteria 29573
257 Ga0207647_10003088 3300025904 Bacteria 12521
258 Ga0207647_10108550 3300025904 Bacteria 1642
259 Ga0207647_10119819 3300025904 Bacteria 1552
260 Ga0207643_10030978 3300025908 Bacteria 2980
261 Ga0207705_10009263 3300025909 Bacteria 7161
262 Ga0207705_10010820 3300025909 Bacteria 6625
263 Ga0207705_10013807 3300025909 Bacteria 5825
264 Ga0207705_10099182 3300025909 Bacteria 2141
265 Ga0207705_10305268 3300025909 Bacteria 1221
266 Ga0207707_10112855 3300025912 Bacteria 2376
267 Ga0207707_10305331 3300025912 Bacteria 1375
268 Ga0207707_10387574 3300025912 Bacteria 1201
269 Ga0207707_10467263 3300025912 Bacteria 1078
270 Ga0207707_10598298 3300025912 Bacteria 934
271 Ga0207695_10028155 3300025913 Bacteria 6239
272 Ga0207660_10001245 3300025917 Bacteria 17060
273 Ga0207660_10149346 3300025917 Bacteria 1794
274 Ga0207660_10198478 3300025917 Bacteria 1566
275 Ga0207660_10263843 3300025917 Bacteria 1363
276 Ga0207662_10021389 3300025918 Bacteria 3697
277 Ga0207657_10008835 3300025919 Bacteria 10192
278 Ga0207657_10010483 3300025919 Bacteria 9247
279 Ga0207657_10011678 3300025919 Bacteria 8705
280 Ga0207657_10022524 3300025919 Bacteria 5890
281 Ga0207657_10025335 3300025919 Bacteria 5471
282 Ga0207657_10030929 3300025919 Bacteria 4853
283 Ga0207657_10032204 3300025919 Bacteria 4740
284 Ga0207657_10116496 3300025919 Bacteria 2201
285 Ga0207657_10191148 3300025919 Bacteria 1651
286 Ga0207649_10003288 3300025920 Bacteria 8848
287 Ga0207649_10022801 3300025920 Bacteria 3617
288 Ga0207649_10028554 3300025920 Bacteria 3285
289 Ga0207649_10063306 3300025920 Bacteria 2335
290 Ga0207649_10082073 3300025920 Bacteria 2089
291 Ga0207649_10086213 3300025920 Bacteria 2046
292 Ga0207649_10286726 3300025920 Bacteria 1199
293 Ga0207652_10055979 3300025921 Bacteria 3394
294 Ga0207652_10079444 3300025921 Bacteria 2866
295 Ga0207652_10122922 3300025921 Bacteria 2310
296 Ga0207652_10126436 3300025921 Bacteria 2277
297 Ga0207652_10135719 3300025921 Bacteria 2197
298 Ga0207694_10360752 3300025924 Bacteria 1204
299 Ga0207650_10089849 3300025925 Bacteria 2345
300 Ga0207650_10203167 3300025925 Bacteria 1588
301 Ga0207659_10013351 3300025926 Bacteria 5256
302 Ga0207659_10044207 3300025926 Bacteria 3133
303 Ga0207687_10028573 3300025927 Bacteria 3746
304 Ga0207687_10041551 3300025927 Bacteria 3158
305 Ga0207644_10001166 3300025931 Bacteria 16850
306 Ga0207644_10007708 3300025931 Bacteria 7024
307 Ga0207644_10113026 3300025931 Bacteria 2056
308 Ga0207690_10023069 3300025932 Bacteria 3880
309 Ga0207690_10028246 3300025932 Bacteria 3554
310 Ga0207690_10047937 3300025932 Bacteria 2837
311 Ga0207690_10066170 3300025932 Bacteria 2474
312 Ga0207690_10170956 3300025932 Bacteria 1628
313 Ga0207690_10484563 3300025932 Bacteria 998
314 Ga0207706_10007351 3300025933 Bacteria 10184
315 Ga0207706_10016374 3300025933 Bacteria 6694
316 Ga0207706_10047997 3300025933 Bacteria 3776
317 Ga0207706_10070651 3300025933 Bacteria 3071
318 Ga0207706_10071588 3300025933 Bacteria 3050
319 Ga0207706_10214053 3300025933 Bacteria 1688
320 Ga0207709_10073382 3300025935 Bacteria 2180
321 Ga0207669_10033585 3300025937 Bacteria 2897
322 Ga0207669_10038140 3300025937 Bacteria 2764
323 Ga0207669_10526188 3300025937 Bacteria 950
324 Ga0207704_10300653 3300025938 Bacteria 1229
325 Ga0207691_10011548 3300025940 Bacteria 8479
326 Ga0207691_10076929 3300025940 Bacteria 3007
327 Ga0207691_10089396 3300025940 Bacteria 2762
328 Ga0207711_10166316 3300025941 Bacteria 1999
329 Ga0207711_10225986 3300025941 Bacteria 1713
330 Ga0207689_10139159 3300025942 Bacteria 1999
331 Ga0207661_10059824 3300025944 Bacteria 3071
332 Ga0207661_10147298 3300025944 Bacteria 2032
333 Ga0207661_10216517 3300025944 Bacteria 1691
334 Ga0207661_10429834 3300025944 Bacteria 1200
335 Ga0207679_10053367 3300025945 Bacteria 2970
336 Ga0207679_10260849 3300025945 Bacteria 1478
337 Ga0207679_10383685 3300025945 Bacteria 1232
338 Ga0207679_10482817 3300025945 Bacteria 1103
339 Ga0207679_10803526 3300025945 Bacteria 858
340 Ga0207667_10063865 3300025949 Bacteria 3846
341 Ga0207667_10165111 3300025949 Bacteria 2276
342 Ga0207667_10293354 3300025949 Bacteria 1661
343 Ga0207667_10976586 3300025949 Bacteria 835
344 Ga0207651_10036019 3300025960 Bacteria 3225
345 Ga0207651_10072116 3300025960 Bacteria 2450
346 Ga0207640_10006261 3300025981 Bacteria 6525
347 Ga0207640_10014463 3300025981 Bacteria 4545
348 Ga0207640_10102646 3300025981 Bacteria 2009
349 Ga0207640_10191834 3300025981 Bacteria 1541
350 Ga0207658_10212648 3300025986 Bacteria 1622
351 Ga0207658_10249472 3300025986 Bacteria 1507
352 Ga0207703_10062599 3300026035 Bacteria 3048
353 Ga0207703_10299623 3300026035 Bacteria 1466
354 Ga0207639_10000289 3300026041 Bacteria 35884
355 Ga0207639_10037853 3300026041 Bacteria 3586
356 Ga0207639_10236374 3300026041 Bacteria 1587
357 Ga0207639_10417986 3300026041 Bacteria 1212
358 Ga0207639_10665232 3300026041 Bacteria 964
359 Ga0207639_10781384 3300026041 Bacteria 889
360 Ga0207678_10028075 3300026067 Bacteria 4914
361 Ga0207678_10047665 3300026067 Bacteria 3705
362 Ga0207678_10194808 3300026067 Bacteria 1732
363 Ga0207702_10013161 3300026078 Bacteria 6879
364 Ga0207702_10044154 3300026078 Bacteria 3745
365 Ga0207702_10206910 3300026078 Bacteria 1822
366 Ga0207641_10152398 3300026088 Bacteria 2094
367 Ga0207648_10043136 3300026089 Bacteria 3960
368 Ga0207676_10122793 3300026095 Bacteria 2193
369 Ga0207676_10470565 3300026095 Bacteria 1188
370 Ga0207674_10007432 3300026116 Bacteria 12769
371 Ga0207674_10048018 3300026116 Bacteria 4372
372 Ga0207674_10132972 3300026116 Bacteria 2450
373 Ga0207675_100475502 3300026118 Bacteria 1241
374 Ga0207683_10012478 3300026121 Bacteria 7250
375 Ga0207683_10027998 3300026121 Bacteria 4871
376 Ga0207683_10033138 3300026121 Bacteria 4487
377 Ga0207698_10003933 3300026142 Bacteria 8998
378 Ga0207698_10018421 3300026142 Bacteria 4757
379 Ga0207698_10054778 3300026142 Bacteria 3070
380 Ga0207698_10175832 3300026142 Bacteria 1890
381 Ga0207698_10250151 3300026142 Bacteria 1621
382 Ga0207698_10276725 3300026142 Bacteria 1550
383 Ga0268266_10084154 3300028379 Bacteria 2777
384 Ga0268264_10939456 3300028381 Bacteria 869
385 Ga0373962_0083158 3300035242 Bacteria 975
386 Ga0373931_0105732 3300035691 Bacteria 1590
387 Ga0395899_0009983 3300037312 Bacteria 7282
388 Ga0395899_0011210 3300037312 Bacteria 6869
389 Ga0395899_0014720 3300037312 Bacteria 5970
390 Ga0395899_0018077 3300037312 Bacteria 5365
391 Ga0395899_0300384 3300037312 Bacteria 1086
392 Ga0395900_0014503 3300037418 Bacteria 8041
393 Ga0395900_0018120 3300037418 Bacteria 7186
394 Ga0395900_0018717 3300037418 Bacteria 7062
395 Ga0395900_0019494 3300037418 Bacteria 6915
396 Ga0395900_0033585 3300037418 Bacteria 5280
397 Ga0395900_0091724 3300037418 Bacteria 3121
398 Ga0395900_0234595 3300037418 Bacteria 1843
399 Ga0395900_0481424 3300037418 Bacteria 1193
400 Ga0395900_0482538 3300037418 Bacteria 1192
401 Ga0395900_0547403 3300037418 Bacteria 1102
402 Ga0395900_0560213 3300037418 Bacteria 1086
403 Ga0395900_0570348 3300037418 Bacteria 1074
404 Ga0395900_0660464 3300037418 Bacteria 981
405 Ga0395898_0020718 3300037466 Bacteria 6675
406 Ga0395898_0166143 3300037466 Bacteria 2110
407 Ga0395898_0241059 3300037466 Bacteria 1724
408 Ga0395898_0245218 3300037466 Bacteria 1708
409 Ga0395905_0079302 3300037471 Bacteria 3077
410 Ga0395905_0084379 3300037471 Bacteria 2976
411 Ga0395905_0086827 3300037471 Bacteria 2932
412 Ga0395905_0110573 3300037471 Bacteria 2580
413 Ga0395905_0407061 3300037471 Bacteria 1255
414 Ga0395905_0491446 3300037471 Bacteria 1127
415 Ga0395905_0964266 3300037471 Unclassified 756
416 Ga0436364_0653289 3300037853 Bacteria 12578
417 Ga0395901_0000041 3300038443 Bacteria 202314
418 Ga0395901_0001382 3300038443 Bacteria 25390
419 Ga0395901_0045220 3300038443 Bacteria 4568
420 Ga0395901_0164806 3300038443 Bacteria 2327
421 Ga0395901_0348497 3300038443 Unclassified 1528
422 Ga0395901_0348819 3300038443 Bacteria 1528
423 Ga0395901_0397290 3300038443 Bacteria 1416
424 Ga0395901_0510629 3300038443 Bacteria 1222
425 Ga0395901_0606256 3300038443 Bacteria 1103
426 Ga0395901_0652650 3300038443 Unclassified 1055
427 Ga0466972_0097231 3300044658 Bacteria 1394
428 Ga0466972_0148462 3300044658 Unclassified 1102
429 Ga0466963_0011495 3300044694 Bacteria 5391
430 Ga0466963_0027833 3300044694 Bacteria 3624
431 Ga0466963_0034780 3300044694 Bacteria 3280
432 Ga0466963_0204654 3300044694 Bacteria 1380
433 Ga0466963_0290023 3300044694 Bacteria 1150
434 Ga0466964_0023144 3300044706 Bacteria 2414
435 Ga0466970_0052642 3300044765 Bacteria 2173
436 Ga0466957_0003303 3300044842 Bacteria 8830
437 Ga0466957_0023178 3300044842 Bacteria 3668
438 Ga0466957_0411224 3300044842 Bacteria 927
439 Ga0466960_0050394 3300044901 Bacteria 2007
440 Ga0466959_0165156 3300045049 Unclassified 1555
441 Ga0466959_0179243 3300045049 Bacteria 1483
442 Ga0466958_0088611 3300045836 Bacteria 1912
443 Ga0466958_0099032 3300045836 Bacteria 1811
444 Ga0466958_0110525 3300045836 Bacteria 1715
445 Ga0466967_0015912 3300045976 Bacteria 5912
446 Ga0466967_0017619 3300045976 Bacteria 5679
447 Ga0466967_0181707 3300045976 Bacteria 1984
448 Ga0466967_0270798 3300045976 Bacteria 1627
449 Ga0466967_0335283 3300045976 Bacteria 1461
450 Ga0466967_0431448 3300045976 Bacteria 1286
451 Ga0466967_0492584 3300045976 Bacteria 1202
452 Ga0495598_0000899 3300046537 Bacteria 5730
453 Ga0495633_0009236 3300046558 Bacteria 5465
454 Ga0495670_0004472 3300046691 Bacteria 6861
455 Ga0496100_0062159 3300048903 Bacteria 2463
456 Ga0496100_0188791 3300048903 Bacteria 1495
457 Ga0496101_0037807 3300048904 Bacteria 3426
458 Ga0496102_0560655 3300048905 Bacteria 1065
459 Ga0496103_0016288 3300048906 Bacteria 4437
460 Ga0496103_0046269 3300048906 Bacteria 2686
461 Ga0496105_0068994 3300048908 Bacteria 2921
462 Ga0496106_0078669 3300048909 Bacteria 2531
463 Ga0496106_0203317 3300048909 Bacteria 1577
464 Ga0496107_0030930 3300048910 Bacteria 3817
465 Ga0496109_0084726 3300048912 Bacteria 2924
466 Ga0496110_0017892 3300048913 Bacteria 5933
467 Ga0496111_0087188 3300048914 Bacteria 2284
468 Ga0496112_0108958 3300048915 Bacteria 2740
469 Ga0496113_0088694 3300048916 Bacteria 2379
470 Ga0496114_0148622 3300048917 Bacteria 2032
471 Ga0466962_0015869 3300061719 Bacteria 3635
472 Ga0466962_0200308 3300061719 Unclassified 975
473 Ga0495642_0015926
474 JGI24740J21852_10017636
475 JGI24740J21852_10057453
476 JGI24737J22298_10094892
477 JGI24735J21928_10018825
478 rootH1_10011305
479 Ga0065715_10108728
480 Ga0065715_10146947
481 Ga0070658_10002368
482 Ga0070658_10007895
483 Ga0070658_10069968
484 Ga0070658_10072381
485 Ga0070658_10112129
486 Ga0070658_10159596
487 Ga0070658_10191742
488 Ga0070658_10305697
489 Ga0070676_10029039
490 Ga0070683_100009073
491 Ga0070683_100041784
492 Ga0070683_100235898
493 Ga0070683_100487905
494 Ga0070683_100829041
495 Ga0070690_100003098
496 Ga0070670_100023229
497 Ga0070670_100064626
498 Ga0070670_100156939
499 Ga0070677_10011157
500 Ga0068869_100055977
501 Ga0070666_10069622
502 Ga0070666_10076128
503 Ga0070680_100000883
504 Ga0070680_100019069
505 Ga0070680_100050052
506 Ga0070680_100066887
507 Ga0070680_100929153
508 Ga0070682_100036112
509 Ga0070682_100115898
510 Ga0070682_100188089
511 Ga0068868_100115027
512 Ga0070660_100010679
513 Ga0070660_100049916
514 Ga0070660_100063598
515 Ga0070660_100064495
516 Ga0070660_100080883
517 Ga0070660_100115588
518 Ga0070660_100263880
519 Ga0070660_100267606
520 Ga0070660_100268748
521 Ga0070660_100485491
522 Ga0070687_100028732
523 Ga0070661_100011558
524 Ga0070661_100022673
525 Ga0070661_100029606
526 Ga0070661_100031865
527 Ga0070661_100033595
528 Ga0070661_100046769
529 Ga0070661_100113894
530 Ga0070661_100143395
531 Ga0070661_100360277
532 Ga0070692_10012745
533 Ga0070692_10028978
534 Ga0070692_10031761
535 Ga0070675_100031113
536 Ga0070675_100035688
537 Ga0070675_100041860
538 Ga0070675_100051429
539 Ga0070671_100132166
540 Ga0070671_100354532
541 Ga0070673_100014339
542 Ga0070673_100076854
543 Ga0070659_100004304
544 Ga0070659_100006144
545 Ga0070659_100010984
546 Ga0070659_100021859
547 Ga0070659_100059163
548 Ga0070659_100059658
549 Ga0070659_100164702
550 Ga0070659_100174651
551 Ga0070659_100190294
552 Ga0070659_100241843
553 Ga0070659_100325551
554 Ga0070667_100209672
555 Ga0070667_100537112
556 Ga0070714_100333229
557 Ga0070663_100023505
558 Ga0070663_100028766
559 Ga0070663_100293726
560 Ga0070663_100400368
561 Ga0070678_100022589
562 Ga0070678_100173448
563 Ga0070662_100035953
564 Ga0070662_100044495
565 Ga0070662_100059973
566 Ga0070662_100110153
567 Ga0070662_100195069
568 Ga0070662_100196154
569 Ga0070662_100467481
570 Ga0070662_100812514
571 Ga0070681_10003859
572 Ga0070681_10219298
573 Ga0070681_10387833
574 Ga0070681_10540420
575 Ga0068867_100030971
576 Ga0070685_10105789
577 Ga0070679_100053786
578 Ga0070679_100069940
579 Ga0070679_100074475
580 Ga0070679_100170743
581 Ga0070679_100318764
582 Ga0070679_100325214
583 Ga0070679_100363950
584 Ga0070679_100527658
585 Ga0070684_100003085
586 Ga0070684_100011482
587 Ga0070684_100030635
588 Ga0068853_100053671
589 Ga0068853_100093027
590 Ga0068853_100109447
591 Ga0068853_100159791
592 Ga0068853_100449590
593 Ga0070672_100017944
594 Ga0070672_100055389
595 Ga0070672_100115738
596 Ga0070672_100581225
597 Ga0070686_100005832
598 Ga0070693_100168720
599 Ga0070693_100243208
600 Ga0070665_100087255
601 Ga0070665_100142990
602 Ga0068855_100025103
603 Ga0068855_100060700
604 Ga0068855_100095436
605 Ga0068855_100102154
606 Ga0068855_100103048
607 Ga0068855_100110459
608 Ga0068855_100117499
609 Ga0068855_100442412
610 Ga0070664_100018856
611 Ga0070664_100059002
612 Ga0070664_100073407
613 Ga0070664_100138779
614 Ga0070664_100492549
615 Ga0068857_100035284
616 Ga0068857_100037178
617 Ga0068857_100063747
618 Ga0068857_100096493
619 Ga0068854_100010491
620 Ga0068854_100012472
621 Ga0068854_100034134
622 Ga0068854_100086632
623 Ga0068854_100105358
624 Ga0068856_100033122
625 Ga0068856_100068135
626 Ga0068856_100092051
627 Ga0068856_100265746
628 Ga0068856_100474103
629 Ga0068856_100639912
630 Ga0068856_100731296
631 Ga0068852_100000335
632 Ga0068852_100009282
633 Ga0068852_100019017
634 Ga0068852_100109815
635 Ga0068852_100152796
636 Ga0068852_100161834
637 Ga0068852_100490150
638 Ga0068859_100031175
639 Ga0068864_100033988
640 Ga0068864_100088353
641 Ga0068866_10004709
642 Ga0068851_10022088
643 Ga0068851_10023411
644 Ga0068851_10072284
645 Ga0068851_10177933
646 Ga0068870_10132449
647 Ga0068863_100013325
648 Ga0068858_100076758
649 Ga0097621_100045537
650 Ga0097621_100115329
651 Ga0097621_100767088
652 Ga0068871_100019088
653 Ga0097620_100031175
654 Ga0105240_10060792
655 Ga0105240_10064276
656 Ga0105245_10025575
657 Ga0105241_10014117
658 Ga0105241_10072122
659 Ga0105241_10503427
660 Ga0105242_10038878
661 Ga0105248_10039369
662 Ga0105248_10081320
663 Ga0105248_10909642
664 Ga0105237_10020284
665 Ga0105237_10170570
666 Ga0105238_10026666
667 Ga0105238_10032221
668 Ga0105238_10103710
669 Ga0105239_10047857
670 Ga0105239_10068776
671 Ga0105239_10209127
672 Ga0157373_10016222
673 Ga0157373_10043080
674 Ga0157373_10045388
675 Ga0157373_10157107
676 Ga0157373_10218922
677 Ga0157373_10449304
678 Ga0157373_10628217
679 Ga0157371_10034950
680 Ga0157371_10036304
681 Ga0157371_10045646
682 Ga0157371_10048221
683 Ga0157371_10054663
684 Ga0157371_10072206
685 Ga0157371_10164495
686 Ga0157371_10391940
687 Ga0157370_10002914
688 Ga0157370_10009125
689 Ga0157370_10149061
690 Ga0157370_10369486
691 Ga0157369_10022605
692 Ga0157369_10061152
693 Ga0157369_10078998
694 Ga0157369_10166754
695 Ga0157369_10209688
696 Ga0157369_10320763
697 Ga0157369_10386489
698 Ga0157369_10411255
699 Ga0157369_10759151
700 Ga0157374_10010355
701 Ga0157374_10274338
702 Ga0157378_10755720
703 Ga0163162_10012953
704 Ga0163162_10080998
705 Ga0157372_10002766
706 Ga0157372_10009142
707 Ga0157372_10052378
708 Ga0157372_10340982
709 Ga0157372_10771859
710 Ga0157375_10050138
711 Ga0157375_10073931
712 Ga0182008_10072232
713 Ga0157377_10080499
714 Ga0157377_10082376
715 Ga0157379_10077397
716 Ga0157376_10034982
717 Ga0157376_10140240
718 Ga0206354_11495107
719 Ga0206353_10868385
720 Ga0213875_10003050
721 Ga0207697_10056569
722 Ga0207656_10083369
723 Ga0207656_10224888
724 Ga0207682_10002020
725 Ga0207688_10096142
726 Ga0207680_10070822
727 Ga0207647_10000557
728 Ga0207647_10003088
729 Ga0207647_10108550
730 Ga0207647_10119819
731 Ga0207643_10030978
732 Ga0207705_10009263
733 Ga0207705_10010820
734 Ga0207705_10013807
735 Ga0207705_10099182
736 Ga0207705_10305268
737 Ga0207707_10112855
738 Ga0207707_10305331
739 Ga0207707_10387574
740 Ga0207707_10467263
741 Ga0207707_10598298
742 Ga0207695_10028155
743 Ga0207660_10001245
744 Ga0207660_10149346
745 Ga0207660_10198478
746 Ga0207660_10263843
747 Ga0207662_10021389
748 Ga0207657_10008835
749 Ga0207657_10010483
750 Ga0207657_10011678
751 Ga0207657_10022524
752 Ga0207657_10025335
753 Ga0207657_10030929
754 Ga0207657_10032204
755 Ga0207657_10116496
756 Ga0207657_10191148
757 Ga0207649_10003288
758 Ga0207649_10022801
759 Ga0207649_10028554
760 Ga0207649_10063306
761 Ga0207649_10082073
762 Ga0207649_10086213
763 Ga0207649_10286726
764 Ga0207652_10055979
765 Ga0207652_10079444
766 Ga0207652_10122922
767 Ga0207652_10126436
768 Ga0207652_10135719
769 Ga0207694_10360752
770 Ga0207650_10089849
771 Ga0207650_10203167
772 Ga0207659_10013351
773 Ga0207659_10044207
774 Ga0207687_10028573
775 Ga0207687_10041551
776 Ga0207644_10001166
777 Ga0207644_10007708
778 Ga0207644_10113026
779 Ga0207690_10023069
780 Ga0207690_10028246
781 Ga0207690_10047937
782 Ga0207690_10066170
783 Ga0207690_10170956
784 Ga0207690_10484563
785 Ga0207706_10007351
786 Ga0207706_10016374
787 Ga0207706_10047997
788 Ga0207706_10070651
789 Ga0207706_10071588
790 Ga0207706_10214053
791 Ga0207709_10073382
792 Ga0207669_10033585
793 Ga0207669_10038140
794 Ga0207669_10526188
795 Ga0207704_10300653
796 Ga0207691_10011548
797 Ga0207691_10076929
798 Ga0207691_10089396
799 Ga0207711_10166316
800 Ga0207711_10225986
801 Ga0207689_10139159
802 Ga0207661_10059824
803 Ga0207661_10147298
804 Ga0207661_10216517
805 Ga0207661_10429834
806 Ga0207679_10053367
807 Ga0207679_10260849
808 Ga0207679_10383685
809 Ga0207679_10482817
810 Ga0207679_10803526
811 Ga0207667_10063865
812 Ga0207667_10165111
813 Ga0207667_10293354
814 Ga0207667_10976586
815 Ga0207651_10036019
816 Ga0207651_10072116
817 Ga0207640_10006261
818 Ga0207640_10014463
819 Ga0207640_10102646
820 Ga0207640_10191834
821 Ga0207658_10212648
822 Ga0207658_10249472
823 Ga0207703_10062599
824 Ga0207703_10299623
825 Ga0207639_10000289
826 Ga0207639_10037853
827 Ga0207639_10236374
828 Ga0207639_10417986
829 Ga0207639_10665232
830 Ga0207639_10781384
831 Ga0207678_10028075
832 Ga0207678_10047665
833 Ga0207678_10194808
834 Ga0207702_10013161
835 Ga0207702_10044154
836 Ga0207702_10206910
837 Ga0207641_10152398
838 Ga0207648_10043136
839 Ga0207676_10122793
840 Ga0207676_10470565
841 Ga0207674_10007432
842 Ga0207674_10048018
843 Ga0207674_10132972
844 Ga0207675_100475502
845 Ga0207683_10012478
846 Ga0207683_10027998
847 Ga0207683_10033138
848 Ga0207698_10003933
849 Ga0207698_10018421
850 Ga0207698_10054778
851 Ga0207698_10175832
852 Ga0207698_10250151
853 Ga0207698_10276725
854 Ga0268266_10084154
855 Ga0268264_10939456
856 Ga0373962_0083158
857 Ga0373931_0105732
858 Ga0395899_0009983
859 Ga0395899_0011210
860 Ga0395899_0014720
861 Ga0395899_0018077
862 Ga0395899_0300384
863 Ga0395900_0014503
864 Ga0395900_0018120
865 Ga0395900_0018717
866 Ga0395900_0019494
867 Ga0395900_0033585
868 Ga0395900_0091724
869 Ga0395900_0234595
870 Ga0395900_0481424
871 Ga0395900_0482538
872 Ga0395900_0547403
873 Ga0395900_0560213
874 Ga0395900_0570348
875 Ga0395900_0660464
876 Ga0395898_0020718
877 Ga0395898_0166143
878 Ga0395898_0241059
879 Ga0395898_0245218
880 Ga0395905_0079302
881 Ga0395905_0084379
882 Ga0395905_0086827
883 Ga0395905_0110573
884 Ga0395905_0407061
885 Ga0395905_0491446
886 Ga0395905_0964266
887 Ga0436364_0653289
888 Ga0395901_0000041
889 Ga0395901_0001382
890 Ga0395901_0045220
891 Ga0395901_0164806
892 Ga0395901_0348497
893 Ga0395901_0348819
894 Ga0395901_0397290
895 Ga0395901_0510629
896 Ga0395901_0606256
897 Ga0395901_0652650
898 Ga0466972_0097231
899 Ga0466972_0148462
900 Ga0466963_0011495
901 Ga0466963_0027833
902 Ga0466963_0034780
903 Ga0466963_0204654
904 Ga0466963_0290023
905 Ga0466964_0023144
906 Ga0466970_0052642
907 Ga0466957_0003303
908 Ga0466957_0023178
909 Ga0466957_0411224
910 Ga0466960_0050394
911 Ga0466959_0165156
912 Ga0466959_0179243
913 Ga0466958_0088611
914 Ga0466958_0099032
915 Ga0466958_0110525
916 Ga0466967_0015912
917 Ga0466967_0017619
918 Ga0466967_0181707
919 Ga0466967_0270798
920 Ga0466967_0335283
921 Ga0466967_0431448
922 Ga0466967_0492584
923 Ga0495598_0000899
924 Ga0495633_0009236
925 Ga0495670_0004472
926 Ga0496100_0062159
927 Ga0496100_0188791
928 Ga0496101_0037807
929 Ga0496102_0560655
930 Ga0496103_0016288
931 Ga0496103_0046269
932 Ga0496105_0068994
933 Ga0496106_0078669
934 Ga0496106_0203317
935 Ga0496107_0030930
936 Ga0496109_0084726
937 Ga0496110_0017892
938 Ga0496111_0087188
939 Ga0496112_0108958
940 Ga0496113_0088694
941 Ga0496114_0148622
942 Ga0466962_0015869
943 Ga0466962_0200308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

50

115

0.96

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

45

107

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

50

108

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

151

219

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

148

224

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9513 8 217
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9412 8 217
3lq7-assembly2.cif.gz_C-2 crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9359 7 213
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9338 6 216
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9326 8 217
ID Description Score Start End Superfamily
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9452 92 207 1.20.1050.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9387 92 207 1.20.1050.10
3lq7C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9328 92 207 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9222 92 207 1.20.1050.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9179 9 91 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A519KRG8-F1-model_v4 Glutathione S-transferase family protein 0.9591 9 207 GO:0016740
AF-A0A346N4Z6-F1-model_v4 Glutathione S-transferase family protein 0.9561 1 214 GO:0016740
AF-A0A418WA53-F1-model_v4 Glutathione S-transferase family protein 0.9556 9 215 GO:0016740
AF-A0A534TDK8-F1-model_v4 Glutathione S-transferase family protein 0.952 112 217 GO:0016740
AF-S4XUW6-F1-model_v4 Glutathione S-transferase 0.9516 25 217

Map