F450593

General Info

Members Datasets Scaffolds Average Seq Length
471 274 942 551

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10068560|Ga0157371_100685602
Length 579
Sequence MIAFAQLYARLDATTSSNAKLAALQDYLRDAEPADAAWAVYFLAGGRPRQLVPSRQLRELAMQRAGLSEWLFEESYSAVGDLAETIALLLPEATSTSGDGLAVWVEDKLLPLRGLPPDELAMRLDALWAQLDRQSLMVSIKLITGAFRVGVSKLLVTRALAAVAEVDAKRVAQRLVGYTDLSNRPTAAAYERLIAAESEDEHAQRGGQPYPFFLAHPLQRPLEEFDASLGSPADWLIEWKWDGIRAQLVKRDGQLWVWSRGEELISERFPELQELAPLLPDGTVIDGELVVWRHAPQATAQQGELMAHAADEPAERLNDQVEEQLEQFGIQPFALLQQRIGRKTLSRKLLEEVPVAVLAYDLLEWQGEDWRSHPQHQRRAQMEQVVASCASPRLMPSPLLHGATWQALAQQREASRSLGVEGMMLKGREAAYGVGRSKDVGVWWKWKIDPLSVDAVLIYAQRGHGRRASLYSDYTFAVWDGAPGDPERRLVPFAKAYSGLTDEEMRKVDAIVRKTTVEKFGPVRSVTPSLVFELGFEGIARSPRHKSGIAVRFPRMLRWRHDKGVEEADTLELLQELLP

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
104 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
105 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
127 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
128 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
129 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
130 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
131 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
132 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
133 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
134 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
137 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
138 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
216 2511231012 Pseudomonas sp. GM33 Isolate Nodule
217 2511231024 Pseudomonas sp. GM84 Isolate Nodule
218 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
219 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
220 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
221 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
222 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
223 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
224 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
225 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
226 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
227 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
228 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
229 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
230 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
231 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
232 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
233 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
234 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
235 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
236 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
237 2765235841 Pseudomonas putida AA7 Isolate Unclassified
238 2773857670 Pseudomonas sp. 478 Isolate Unclassified
239 2784132072 Pseudomonas sp. 460 Isolate Unclassified
240 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
241 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
242 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
243 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
244 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
245 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
246 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
247 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
248 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
249 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
250 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
251 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
252 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
253 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
254 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
255 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
256 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
257 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
258 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
259 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
260 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
261 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
262 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
263 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
264 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
265 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
266 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
267 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
268 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
269 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
270 8052494512 Pseudomonas putida LD6 Isolate Unclassified
271 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
272 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
273 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
274 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.47
Metatranscriptomes 0
Isolates 12.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 1.91
Rhizoplane 4.46
Rhizosphere 75.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10068560 3300013102 Bacteria 2511
2 rootH1_10024310 3300003323 Bacteria 54858
3 Ga0055538_1000096 3300003751 Bacteria 73286
4 Ga0055526_1000694 3300003771 Bacteria 25675
5 Ga0055530_10000427 3300003791 Bacteria 37349
6 Ga0055540_1000377 3300003792 Bacteria 37349
7 Ga0065714_10000350 3300005288 Bacteria 5646
8 Ga0065714_10005321 3300005288 Bacteria 4339
9 Ga0065714_10070681 3300005288 Bacteria 3794
10 Ga0065714_10085326 3300005288 Bacteria 2152
11 Ga0065704_10007269 3300005289 Bacteria 4413
12 Ga0065712_10068014 3300005290 Bacteria 17200
13 Ga0065715_10106346 3300005293 Bacteria 2836
14 Ga0070658_10013435 3300005327 Bacteria 6570
15 Ga0070690_100000967 3300005330 Bacteria 14614
16 Ga0070670_100008834 3300005331 Bacteria 8601
17 Ga0070666_10000968 3300005335 Bacteria 17521
18 Ga0068868_100058907 3300005338 Bacteria 3037
19 Ga0070689_100062181 3300005340 Bacteria 2905
20 Ga0070674_100112779 3300005356 Bacteria 1999
21 Ga0070688_100007954 3300005365 Bacteria 5734
22 Ga0070659_100036887 3300005366 Bacteria 3811
23 Ga0070709_10037316 3300005434 Bacteria 2967
24 Ga0070714_100010721 3300005435 Bacteria 7252
25 Ga0070713_100010217 3300005436 Bacteria 6774
26 Ga0070705_100037647 3300005440 Bacteria 2731
27 Ga0070678_100012790 3300005456 Bacteria 5234
28 Ga0070662_100000044 3300005457 Bacteria 69006
29 Ga0070681_10108931 3300005458 Bacteria 2710
30 Ga0070685_10000937 3300005466 Bacteria 15702
31 Ga0070686_100018960 3300005544 Bacteria 4047
32 Ga0070693_100000679 3300005547 Bacteria 15079
33 Ga0070665_100003911 3300005548 Bacteria 15743
34 Ga0070704_100035823 3300005549 Bacteria 3376
35 Ga0070664_100008128 3300005564 Bacteria 8481
36 Ga0068856_100009487 3300005614 Bacteria 9450
37 Ga0068852_100008926 3300005616 Bacteria 7419
38 Ga0068859_100000711 3300005617 Bacteria 33515
39 Ga0068866_10001482 3300005718 Bacteria 9998
40 Ga0068863_100000570 3300005841 Bacteria 37497
41 Ga0068860_100031042 3300005843 Bacteria 5137
42 Ga0068860_100073101 3300005843 Bacteria 3260
43 Ga0070712_100008509 3300006175 Bacteria 6455
44 Ga0097621_100019921 3300006237 Bacteria 5161
45 Ga0068871_100017061 3300006358 Bacteria 5486
46 Ga0097620_100000711 3300006931 Bacteria 33515
47 Ga0099823_1000376 3300006944 Bacteria 28378
48 Ga0099823_1035869 3300006944 Bacteria 3843
49 Ga0079104_1000484 3300006946 Bacteria 44056
50 Ga0099826_10000372 3300006948 Bacteria 20776
51 Ga0105251_10000123 3300009011 Bacteria 77428
52 Ga0105251_10000202 3300009011 Bacteria 59944
53 Ga0105251_10002278 3300009011 Bacteria 15224
54 Ga0105251_10005995 3300009011 Bacteria 7839
55 Ga0105251_10007847 3300009011 Bacteria 6495
56 Ga0105244_10000147 3300009036 Bacteria 73676
57 Ga0105244_10001713 3300009036 Bacteria 17317
58 Ga0105244_10001740 3300009036 Bacteria 17118
59 Ga0105244_10002909 3300009036 Bacteria 12647
60 Ga0105244_10004722 3300009036 Bacteria 9272
61 Ga0105244_10015088 3300009036 Bacteria 4441
62 Ga0105244_10023002 3300009036 Bacteria 3425
63 Ga0105250_10001623 3300009092 Bacteria 12016
64 Ga0105250_10011715 3300009092 Bacteria 3634
65 Ga0105250_10012786 3300009092 Bacteria 3457
66 Ga0105245_10002757 3300009098 Bacteria 15792
67 Ga0105245_10010893 3300009098 Bacteria 7908
68 Ga0105247_10011455 3300009101 Bacteria 5346
69 Ga0105243_10008101 3300009148 Bacteria 8065
70 Ga0105243_10012066 3300009148 Bacteria 6531
71 Ga0105243_10034528 3300009148 Bacteria 3916
72 Ga0105242_10005066 3300009176 Bacteria 10175
73 Ga0105248_10003992 3300009177 Bacteria 16311
74 Ga0105237_10032831 3300009545 Bacteria 5255
75 Ga0105238_10026581 3300009551 Bacteria 5901
76 Ga0105239_10000135 3300010375 Bacteria 103223
77 Ga0105246_10000136 3300011119 Bacteria 34129
78 Ga0157373_10012223 3300013100 Bacteria 6313
79 Ga0157370_10000155 3300013104 Bacteria 84680
80 Ga0157370_10049245 3300013104 Bacteria 4033
81 Ga0157374_10001209 3300013296 Bacteria 22078
82 Ga0157374_10004803 3300013296 Bacteria 11342
83 Ga0163162_10003534 3300013306 Bacteria 14955
84 Ga0157372_10000274 3300013307 Bacteria 57253
85 Ga0157372_10199603 3300013307 Bacteria 2317
86 Ga0157375_10004843 3300013308 Bacteria 11694
87 Ga0182008_10002230 3300014497 Bacteria 12268
88 Ga0182008_10009409 3300014497 Bacteria 5274
89 Ga0157377_10067548 3300014745 Bacteria 2058
90 Ga0157376_10012585 3300014969 Bacteria 6284
91 Ga0182007_10002648 3300015262 Bacteria 8792
92 Ga0163161_10081036 3300017792 Bacteria 2389
93 Ga0209455_1004669 3300025272 Bacteria 4411
94 Ga0209676_1000231 3300025292 Bacteria 120750
95 Ga0209676_1006561 3300025292 Bacteria 5707
96 Ga0209676_1007954 3300025292 Bacteria 4844
97 Ga0209050_1000187 3300025298 Bacteria 139437
98 Ga0209050_1001895 3300025298 Bacteria 20032
99 Ga0209051_1000131 3300025303 Bacteria 139437
100 Ga0209051_1003680 3300025303 Bacteria 9907
101 Ga0209051_1012371 3300025303 Bacteria 4133
102 Ga0209257_1005683 3300025304 Bacteria 8592
103 Ga0207696_1000022 3300025711 Bacteria 427529
104 Ga0207696_1000044 3300025711 Bacteria 300953
105 Ga0207696_1006974 3300025711 Bacteria 4477
106 Ga0207655_1000399 3300025728 Bacteria 60374
107 Ga0207655_1001857 3300025728 Bacteria 18236
108 Ga0207655_1002011 3300025728 Bacteria 17238
109 Ga0207655_1005147 3300025728 Bacteria 9000
110 Ga0207655_1006933 3300025728 Bacteria 7432
111 Ga0207655_1024702 3300025728 Bacteria 2937
112 Ga0207713_1000085 3300025735 Bacteria 160800
113 Ga0207713_1000177 3300025735 Bacteria 91799
114 Ga0207713_1001940 3300025735 Bacteria 15644
115 Ga0207713_1005923 3300025735 Bacteria 7550
116 Ga0207713_1008096 3300025735 Bacteria 6096
117 Ga0207713_1027122 3300025735 Bacteria 2608
118 Ga0207713_1032902 3300025735 Bacteria 2271
119 Ga0207682_10000905 3300025893 Bacteria 13733
120 Ga0207680_10005766 3300025903 Bacteria 5941
121 Ga0207699_10042213 3300025906 Bacteria 2640
122 Ga0207707_10026655 3300025912 Bacteria 5052
123 Ga0207671_10022245 3300025914 Bacteria 4795
124 Ga0207693_10002180 3300025915 Bacteria 17069
125 Ga0207649_10009317 3300025920 Bacteria 5372
126 Ga0207652_10028980 3300025921 Bacteria 4623
127 Ga0207694_10000424 3300025924 Bacteria 39415
128 Ga0207687_10002817 3300025927 Bacteria 11793
129 Ga0207700_10020275 3300025928 Bacteria 4511
130 Ga0207664_10013349 3300025929 Bacteria 5892
131 Ga0207706_10002463 3300025933 Bacteria 18064
132 Ga0207686_10000325 3300025934 Bacteria 34366
133 Ga0207709_10011639 3300025935 Bacteria 4850
134 Ga0207670_10047997 3300025936 Bacteria 2846
135 Ga0207665_10020295 3300025939 Bacteria 4366
136 Ga0207711_10000514 3300025941 Bacteria 39755
137 Ga0207689_10027287 3300025942 Bacteria 4781
138 Ga0207689_10032865 3300025942 Bacteria 4313
139 Ga0207679_10078937 3300025945 Bacteria 2508
140 Ga0207640_10015509 3300025981 Bacteria 4412
141 Ga0207677_10000276 3300026023 Bacteria 38489
142 Ga0207703_10000574 3300026035 Bacteria 37591
143 Ga0207703_10071198 3300026035 Bacteria 2871
144 Ga0207641_10017882 3300026088 Bacteria 5807
145 Ga0207648_10075900 3300026089 Bacteria 2930
146 Ga0207683_10001923 3300026121 Bacteria 18388
147 Ga0209281_1000202 3300027111 Bacteria 135240
148 Ga0209389_1000131 3300027296 Bacteria 66499
149 Ga0209389_1053141 3300027296 Bacteria 2732
150 Ga0209371_1000518 3300027312 Bacteria 36725
151 Ga0209999_1003730 3300027543 Bacteria 2731
152 Ga0209974_10019177 3300027876 Bacteria 2268
153 Ga0207428_10009097 3300027907 Bacteria 8930
154 Ga0268266_10067433 3300028379 Bacteria 3097
155 Ga0307517_10003898 3300028786 Bacteria 23126
156 Ga0307515_10000019 3300028794 Bacteria 422262
157 Ga0268256_1000365 3300030500 Bacteria 42892
158 Ga0307511_10070501 3300030521 Bacteria 2559
159 Ga0316181_1147001 3300030744 Bacteria 7323
160 Ga0307405_10004299 3300031731 Bacteria 6705
161 Ga0307406_10021614 3300031901 Bacteria 3808
162 Ga0307412_10001346 3300031911 Bacteria 13689
163 Ga0307409_100029560 3300031995 Bacteria 3923
164 Ga0373934_0004456 3300035086 Bacteria 5174
165 Ga0373923_0006006 3300035111 Bacteria 4164
166 Ga0373933_0029857 3300035724 Bacteria 3154
167 Ga0395905_0000209 3300037471 Bacteria 90777
168 Ga0395905_0182632 3300037471 Bacteria 1969
169 Ga0439438_000622 3300041405 Bacteria 15975
170 Ga0439438_001115 3300041405 Bacteria 11950
171 Ga0439438_001130 3300041405 Bacteria 11875
172 Ga0439438_005626 3300041405 Bacteria 4572
173 Ga0439438_007628 3300041405 Bacteria 3676
174 Ga0439447_001610 3300041407 Bacteria 8274
175 Ga0439466_0003983 3300041411 Bacteria 5696
176 Ga0439445_0004174 3300042004 Bacteria 3264
177 Ga0439432_000475 3300042006 Bacteria 15068
178 Ga0439432_001712 3300042006 Bacteria 8207
179 Ga0439432_008596 3300042006 Bacteria 3583
180 Ga0439452_001056 3300042010 Bacteria 12156
181 Ga0439452_005063 3300042010 Bacteria 4302
182 Ga0439456_008183 3300042013 Bacteria 2158
183 Ga0450900_000124 3300042136 Bacteria 4483
184 Ga0450902_000487 3300042137 Bacteria 4939
185 Ga0450903_003659 3300042138 Bacteria 2653
186 Ga0450904_000003 3300042139 Bacteria 81068
187 Ga0450905_000399 3300042142 Bacteria 5263
188 Ga0450907_000081 3300042146 Bacteria 37093
189 Ga0450909_000290 3300042185 Bacteria 6163
190 Ga0450901_000100 3300042533 Bacteria 9240
191 Ga0439440_0000658 3300042993 Bacteria 5888
192 Ga0466961_0022979 3300044693 Bacteria 4011
193 Ga0495617_020634 3300046452 Bacteria 2226
194 Ga0495627_000495 3300046453 Bacteria 33051
195 Ga0495627_001208 3300046453 Bacteria 16186
196 Ga0495603_0015447 3300046455 Bacteria 4620
197 Ga0495590_0012592 3300046457 Bacteria 3136
198 Ga0495590_0021699 3300046457 Bacteria 2274
199 Ga0495591_000035 3300046458 Bacteria 169656
200 Ga0495591_000476 3300046458 Bacteria 31823
201 Ga0495591_000804 3300046458 Bacteria 22249
202 Ga0495591_003506 3300046458 Bacteria 8062
203 Ga0495591_006036 3300046458 Bacteria 5457
204 Ga0495638_0002645 3300046460 Bacteria 14417
205 Ga0495638_0003669 3300046460 Bacteria 11959
206 Ga0495638_0013723 3300046460 Bacteria 5504
207 Ga0495638_0031404 3300046460 Bacteria 3414
208 Ga0495638_0066485 3300046460 Bacteria 2215
209 Ga0495651_0014730 3300046462 Bacteria 6047
210 Ga0495650_0000630 3300046471 Bacteria 47358
211 Ga0495650_0001566 3300046471 Bacteria 21553
212 Ga0495650_0013384 3300046471 Bacteria 4340
213 Ga0495605_0000137 3300046474 Bacteria 94482
214 Ga0495605_0000911 3300046474 Bacteria 20328
215 Ga0495605_0023961 3300046474 Bacteria 3200
216 Ga0495605_0030738 3300046474 Bacteria 2750
217 Ga0495639_0019599 3300046475 Bacteria 2953
218 Ga0495584_0001750 3300046491 Bacteria 12669
219 Ga0495584_0007456 3300046491 Bacteria 5703
220 Ga0495584_0012141 3300046491 Bacteria 4402
221 Ga0495585_0040998 3300046492 Bacteria 2597
222 Ga0495585_0054200 3300046492 Bacteria 2217
223 Ga0495607_0000376 3300046501 Bacteria 46064
224 Ga0495607_0000642 3300046501 Bacteria 33955
225 Ga0495607_0002114 3300046501 Bacteria 16578
226 Ga0495607_0017234 3300046501 Bacteria 4643
227 Ga0495607_0018546 3300046501 Bacteria 4434
228 Ga0495607_0040744 3300046501 Bacteria 2763
229 Ga0495607_0044183 3300046501 Bacteria 2628
230 Ga0495583_0000894 3300046506 Bacteria 35676
231 Ga0495583_0003193 3300046506 Bacteria 12857
232 Ga0495583_0004738 3300046506 Bacteria 9563
233 Ga0495583_0006295 3300046506 Bacteria 7799
234 Ga0495583_0008260 3300046506 Bacteria 6383
235 Ga0495606_0000320 3300046507 Bacteria 82551
236 Ga0495606_0000453 3300046507 Bacteria 67136
237 Ga0495606_0006728 3300046507 Bacteria 10524
238 Ga0495606_0028801 3300046507 Bacteria 3910
239 Ga0495606_0051419 3300046507 Bacteria 2687
240 Ga0495610_0008452 3300046512 Bacteria 6668
241 Ga0495610_0011049 3300046512 Bacteria 5549
242 Ga0495616_0007063 3300046513 Bacteria 6746
243 Ga0495620_0000013 3300046515 Bacteria 160349
244 Ga0495620_0006319 3300046515 Bacteria 6520
245 Ga0495620_0008294 3300046515 Bacteria 5585
246 Ga0495620_0011653 3300046515 Bacteria 4577
247 Ga0495631_0016389 3300046518 Bacteria 3533
248 Ga0495632_0001087 3300046519 Bacteria 23308
249 Ga0495632_0001201 3300046519 Bacteria 21985
250 Ga0495632_0001757 3300046519 Bacteria 17531
251 Ga0495632_0010515 3300046519 Bacteria 5472
252 Ga0495632_0041826 3300046519 Bacteria 2300
253 Ga0495637_0000303 3300046520 Bacteria 38131
254 Ga0495637_0000319 3300046520 Bacteria 37329
255 Ga0495637_0004844 3300046520 Bacteria 6928
256 Ga0495637_0020023 3300046520 Bacteria 3082
257 Ga0495637_0033853 3300046520 Bacteria 2241
258 Ga0495643_0000740 3300046522 Bacteria 37104
259 Ga0495643_0001199 3300046522 Bacteria 25188
260 Ga0495643_0003271 3300046522 Bacteria 11989
261 Ga0495643_0035459 3300046522 Bacteria 2747
262 Ga0495643_0057624 3300046522 Bacteria 2069
263 Ga0495644_0000889 3300046523 Bacteria 12373
264 Ga0495648_0000885 3300046524 Bacteria 31452
265 Ga0495648_0009678 3300046524 Bacteria 7431
266 Ga0495648_0013480 3300046524 Bacteria 6038
267 Ga0495648_0014884 3300046524 Bacteria 5667
268 Ga0495648_0039718 3300046524 Bacteria 2991
269 Ga0495666_0031555 3300046526 Bacteria 2595
270 Ga0495642_0000897 3300046528 Bacteria 13984
271 Ga0495654_0001131 3300046530 Bacteria 19187
272 Ga0495654_0005109 3300046530 Bacteria 7668
273 Ga0495654_0008033 3300046530 Bacteria 5856
274 Ga0495654_0012698 3300046530 Bacteria 4521
275 Ga0495654_0022161 3300046530 Bacteria 3302
276 Ga0495654_0034186 3300046530 Bacteria 2567
277 Ga0495609_0000265 3300046538 Bacteria 49286
278 Ga0495609_0000273 3300046538 Bacteria 48181
279 Ga0495609_0024520 3300046538 Bacteria 2766
280 Ga0495609_0040536 3300046538 Bacteria 2095
281 Ga0495597_0000200 3300046542 Bacteria 54946
282 Ga0495597_0010510 3300046542 Bacteria 4520
283 Ga0495597_0019340 3300046542 Bacteria 3187
284 Ga0495622_0009720 3300046557 Bacteria 4446
285 Ga0495622_0017006 3300046557 Bacteria 3385
286 Ga0495622_0038599 3300046557 Bacteria 2223
287 Ga0495633_0012458 3300046558 Bacteria 4522
288 Ga0495656_0005660 3300046615 Bacteria 4325
289 Ga0495611_0002612 3300046648 Bacteria 8155
290 Ga0495611_0028316 3300046648 Bacteria 2452
291 Ga0495625_0000076 3300046660 Bacteria 163580
292 Ga0495625_0034147 3300046660 Bacteria 3755
293 Ga0495661_0000432 3300046665 Bacteria 44289
294 Ga0495661_0000517 3300046665 Bacteria 40087
295 Ga0495661_0001420 3300046665 Bacteria 20076
296 Ga0495661_0037989 3300046665 Bacteria 3003
297 Ga0495661_0041168 3300046665 Bacteria 2860
298 Ga0495661_0059690 3300046665 Bacteria 2269
299 Ga0495647_0001851 3300046681 Bacteria 6561
300 Ga0495669_0004608 3300046684 Bacteria 5710
301 Ga0495670_0030210 3300046691 Bacteria 2691
302 Ga0495671_0000958 3300046692 Bacteria 20273
303 Ga0495671_0014311 3300046692 Bacteria 4272
304 Ga0495671_0021870 3300046692 Bacteria 3354
305 Ga0495671_0032204 3300046692 Bacteria 2677
306 Ga0495671_0035470 3300046692 Bacteria 2532
307 Ga0495671_0038483 3300046692 Bacteria 2417
308 Ga0495671_0042029 3300046692 Bacteria 2299
309 Ga0495671_0043140 3300046692 Bacteria 2264
310 Ga0495649_0002398 3300046694 Bacteria 13239
311 Ga0495649_0004367 3300046694 Bacteria 9252
312 Ga0495649_0008307 3300046694 Bacteria 6249
313 Ga0495649_0036846 3300046694 Bacteria 2686
314 Ga0495589_0003963 3300046794 Bacteria 7945
315 Ga0495589_0015079 3300046794 Bacteria 3978
316 Ga0495589_0040322 3300046794 Bacteria 2332
317 Ga0495660_0001052 3300046810 Bacteria 19967
318 Ga0495660_0007310 3300046810 Bacteria 6491
319 Ga0495660_0015836 3300046810 Bacteria 4352
320 Ga0495660_0018908 3300046810 Bacteria 3954
321 Ga0495660_0024021 3300046810 Bacteria 3474
322 Ga0495660_0024085 3300046810 Bacteria 3468
323 Ga0495660_0024148 3300046810 Bacteria 3464
324 Ga0495604_0015190 3300047317 Bacteria 6147
325 Ga0495674_0058610 3300047319 Bacteria 3366
326 Ga0495672_0001578 3300047320 Bacteria 22259
327 Ga0495672_0002286 3300047320 Bacteria 17780
328 Ga0495672_0017924 3300047320 Bacteria 4721
329 Ga0495672_0030821 3300047320 Bacteria 3355
330 Ga0495676_0000016 3300047321 Bacteria 196310
331 Ga0495683_0000910 3300047323 Bacteria 20890
332 Ga0495683_0012443 3300047323 Bacteria 4464
333 Ga0495683_0020565 3300047323 Bacteria 3403
334 Ga0495677_0001430 3300047445 Bacteria 9577
335 Ga0495679_001655 3300047446 Bacteria 12412
336 Ga0495679_023700 3300047446 Bacteria 2078
337 Ga0495673_0000484 3300047469 Bacteria 42445
338 Ga0495673_0000586 3300047469 Bacteria 36563
339 Ga0495673_0002774 3300047469 Bacteria 11987
340 Ga0495673_0008728 3300047469 Bacteria 5665
341 Ga0495673_0010895 3300047469 Bacteria 4919
342 Ga0495673_0016193 3300047469 Bacteria 3819
343 Ga0495673_0018975 3300047469 Bacteria 3454
344 Ga0495681_0006402 3300047470 Bacteria 7747
345 Ga0495681_0006912 3300047470 Bacteria 7361
346 Ga0495681_0012606 3300047470 Bacteria 4957
347 Ga0495681_0037384 3300047470 Bacteria 2391
348 Ga0495681_0058411 3300047470 Bacteria 1787
349 Ga0495684_0005090 3300047471 Bacteria 10250
350 Ga0495602_0150558 3300048088 Bacteria 1830
351 Ga0495626_0000336 3300048091 Bacteria 49874
352 Ga0495626_0001676 3300048091 Bacteria 17098
353 Ga0495626_0007782 3300048091 Bacteria 5937
354 Ga0495626_0014759 3300048091 Bacteria 4015
355 Ga0496102_0044387 3300048905 Bacteria 4034
356 Ga0496104_0000923 3300048907 Bacteria 25200
357 Ga0496109_0021304 3300048912 Bacteria 5731
358 Ga0496110_0035905 3300048913 Bacteria 4304
359 Ga0496110_0098407 3300048913 Bacteria 2621
360 Ga0496110_0106658 3300048913 Bacteria 2514
361 Ga0496112_0031698 3300048915 Bacteria 5127
362 Ga0496114_0006021 3300048917 Bacteria 9543
363 Ga0496114_0011345 3300048917 Bacteria 7119
364 Ga0496116_0000332 3300048919 Bacteria 76047
365 Ga0496116_0009529 3300048919 Bacteria 8269
366 Ga0496117_0000935 3300048920 Bacteria 44757
367 Ga0496117_0001232 3300048920 Bacteria 38326
368 Ga0496117_0001376 3300048920 Bacteria 35421
369 Ga0496117_0001851 3300048920 Bacteria 28533
370 Ga0496118_0002130 3300048921 Bacteria 27647
371 Ga0496118_0004881 3300048921 Bacteria 15603
372 Ga0496118_0028622 3300048921 Bacteria 4688
373 Ga0496118_0032774 3300048921 Bacteria 4272
374 Ga0496118_0078277 3300048921 Bacteria 2340
375 Ga0496119_0000112 3300048922 Bacteria 114767
376 Ga0496119_0058012 3300048922 Bacteria 2335
377 Ga0496120_0001230 3300048923 Bacteria 32387
378 Ga0496120_0038259 3300048923 Bacteria 2839
379 Ga0496121_0010782 3300048924 Bacteria 10245
380 Ga0496121_0011619 3300048924 Bacteria 9738
381 Ga0496121_0095052 3300048924 Bacteria 2317
382 Ga0496122_0000447 3300048925 Bacteria 86474
383 Ga0496122_0004606 3300048925 Bacteria 16975
384 Ga0496123_0000348 3300048926 Bacteria 86724
385 Ga0496123_0001754 3300048926 Bacteria 28633
386 Ga0496124_0001241 3300048927 Bacteria 39178
387 Ga0496124_0002369 3300048927 Bacteria 24838
388 Ga0496124_0006498 3300048927 Bacteria 12720
389 Ga0496124_0006656 3300048927 Bacteria 12536
390 Ga0496124_0011845 3300048927 Bacteria 8683
391 Ga0496124_0013568 3300048927 Bacteria 7945
392 Ga0496124_0023274 3300048927 Bacteria 5658
393 Ga0496124_0029664 3300048927 Bacteria 4868
394 Ga0496124_0045800 3300048927 Bacteria 3749
395 Ga0496125_0001176 3300048928 Bacteria 39651
396 Ga0496125_0001804 3300048928 Bacteria 29576
397 Ga0496125_0007932 3300048928 Bacteria 11211
398 Ga0496125_0031815 3300048928 Bacteria 4695
399 Ga0496125_0039051 3300048928 Bacteria 4095
400 Ga0496125_0089607 3300048928 Bacteria 2313
401 Ga0496126_0048785 3300048929 Bacteria 3867
402 Ga0496126_0235193 3300048929 Bacteria 1533
403 Ga0495678_000504 3300049459 Bacteria 38278
404 Ga0495678_008685 3300049459 Bacteria 5100
405 Ga0495678_010694 3300049459 Bacteria 4438
406 Ga0495678_012279 3300049459 Bacteria 4066
407 Ga0495678_020299 3300049459 Bacteria 2946
408 Ga0501034_0000020 3300049571 Bacteria 280294
409 Ga0501034_0000199 3300049571 Bacteria 113624
410 Ga0501226_000005 3300049853 Bacteria 271019
411 Ga0495595_0008911 3300053084 Bacteria 4135
412 Ga0500659_0001360 3300053135 Bacteria 15531
413 2511300049 2511231012 Bacteria 6738011
414 2511376395 2511231024 Bacteria 5835885
415 2555248029 2554235231 Bacteria 5215788
416 2599330172 2599185155 Bacteria 5827168
417 2599507787 2599185189 Bacteria 5862825
418 2599616871 2599185212 Bacteria 6765997
419 2599996412 2599185311 Bacteria 6354990
420 2600024148 2599185316 Bacteria 6320029
421 2600031174 2599185317 Bacteria 6435722
422 2600035331 2599185318 Bacteria 6961590
423 2600058284 2599185322 Bacteria 6763055
424 2600078488 2599185325 Bacteria 6324919
425 2600360137 2600254930 Bacteria 6431253
426 2601625659 2600255283 Bacteria 6061572
427 2601691159 2600255296 Bacteria 5784754
428 2652547333 2651869719 Bacteria 6047974
429 2723247455 2721755607 Bacteria 5841722
430 2738691477 2738541271 Bacteria 5657310
431 2739198575 2738543004 Bacteria 6381073
432 2739267252 2738543016 Bacteria 5657564
433 2748017275 2747842501 Bacteria 5293829
434 2765585628 2765235841 Bacteria 6137024
435 2774121544 2773857670 Bacteria 6407454
436 2784315569 2784132072 Bacteria 6596533
437 2807408388 2806310737 Bacteria 5751088
438 2807456702 2806310745 Bacteria 5742165
439 2808856458 2808606361 Bacteria 6136259
440 2808924544 2808606376 Bacteria 6248667
441 2808936394 2808606378 Bacteria 6177535
442 2808946623 2808606380 Bacteria 6248705
443 2808964815 2808606383 Bacteria 6138645
444 2808999707 2808606389 Bacteria 6138126
445 2812368293 2811994881 Bacteria 6298475
446 2826586128 2826581358 Bacteria 5963467
447 2842806392 2842805378 Bacteria 5385175
448 2842820667 2842815866 Bacteria 5947510
449 2842828951 2842826826 Bacteria 5974129
450 2842839862 2842837860 Bacteria 6066181
451 2842853301 2842849001 Bacteria 5924277
452 2842857067 2842854478 Bacteria 6143501
453 2857359381 2857357740 Bacteria 9937880
454 2919159338 2919155634 Bacteria 4860545
455 2919483017 2919481497 Bacteria 6907839
456 2923522347 2923519811 Bacteria 6298479
457 2923590773 2923586266 Bacteria 6565975
458 2929191274 2929189879 Bacteria 5930554
459 2988733099 2988728565 Bacteria 6124362
460 3007256906 3007252601 Bacteria 4559114
461 3007318838 3007315729 Bacteria 5076637
462 3007623092 3007619802 Bacteria 6411688
463 3007805062 3007803356 Bacteria 5931491
464 3007871603 3007866637 Bacteria 5899198
465 640488606 640427133 Bacteria 4567418
466 651176654 651053060 Bacteria 4689946
467 8052498826 8052494512 Bacteria 5765634
468 8054348303 8054347763 Bacteria 5901107
469 8054933305 8054929484 Bacteria 5599761
470 8055884140 8055878733 Bacteria 5907058
471 8056147721 8056143049 Bacteria 6307666
472 Ga0157371_10068560
473 rootH1_10024310
474 Ga0055538_1000096
475 Ga0055526_1000694
476 Ga0055530_10000427
477 Ga0055540_1000377
478 Ga0065714_10000350
479 Ga0065714_10005321
480 Ga0065714_10070681
481 Ga0065714_10085326
482 Ga0065704_10007269
483 Ga0065712_10068014
484 Ga0065715_10106346
485 Ga0070658_10013435
486 Ga0070690_100000967
487 Ga0070670_100008834
488 Ga0070666_10000968
489 Ga0068868_100058907
490 Ga0070689_100062181
491 Ga0070674_100112779
492 Ga0070688_100007954
493 Ga0070659_100036887
494 Ga0070709_10037316
495 Ga0070714_100010721
496 Ga0070713_100010217
497 Ga0070705_100037647
498 Ga0070678_100012790
499 Ga0070662_100000044
500 Ga0070681_10108931
501 Ga0070685_10000937
502 Ga0070686_100018960
503 Ga0070693_100000679
504 Ga0070665_100003911
505 Ga0070704_100035823
506 Ga0070664_100008128
507 Ga0068856_100009487
508 Ga0068852_100008926
509 Ga0068859_100000711
510 Ga0068866_10001482
511 Ga0068863_100000570
512 Ga0068860_100031042
513 Ga0068860_100073101
514 Ga0070712_100008509
515 Ga0097621_100019921
516 Ga0068871_100017061
517 Ga0097620_100000711
518 Ga0099823_1000376
519 Ga0099823_1035869
520 Ga0079104_1000484
521 Ga0099826_10000372
522 Ga0105251_10000123
523 Ga0105251_10000202
524 Ga0105251_10002278
525 Ga0105251_10005995
526 Ga0105251_10007847
527 Ga0105244_10000147
528 Ga0105244_10001713
529 Ga0105244_10001740
530 Ga0105244_10002909
531 Ga0105244_10004722
532 Ga0105244_10015088
533 Ga0105244_10023002
534 Ga0105250_10001623
535 Ga0105250_10011715
536 Ga0105250_10012786
537 Ga0105245_10002757
538 Ga0105245_10010893
539 Ga0105247_10011455
540 Ga0105243_10008101
541 Ga0105243_10012066
542 Ga0105243_10034528
543 Ga0105242_10005066
544 Ga0105248_10003992
545 Ga0105237_10032831
546 Ga0105238_10026581
547 Ga0105239_10000135
548 Ga0105246_10000136
549 Ga0157373_10012223
550 Ga0157370_10000155
551 Ga0157370_10049245
552 Ga0157374_10001209
553 Ga0157374_10004803
554 Ga0163162_10003534
555 Ga0157372_10000274
556 Ga0157372_10199603
557 Ga0157375_10004843
558 Ga0182008_10002230
559 Ga0182008_10009409
560 Ga0157377_10067548
561 Ga0157376_10012585
562 Ga0182007_10002648
563 Ga0163161_10081036
564 Ga0209455_1004669
565 Ga0209676_1000231
566 Ga0209676_1006561
567 Ga0209676_1007954
568 Ga0209050_1000187
569 Ga0209050_1001895
570 Ga0209051_1000131
571 Ga0209051_1003680
572 Ga0209051_1012371
573 Ga0209257_1005683
574 Ga0207696_1000022
575 Ga0207696_1000044
576 Ga0207696_1006974
577 Ga0207655_1000399
578 Ga0207655_1001857
579 Ga0207655_1002011
580 Ga0207655_1005147
581 Ga0207655_1006933
582 Ga0207655_1024702
583 Ga0207713_1000085
584 Ga0207713_1000177
585 Ga0207713_1001940
586 Ga0207713_1005923
587 Ga0207713_1008096
588 Ga0207713_1027122
589 Ga0207713_1032902
590 Ga0207682_10000905
591 Ga0207680_10005766
592 Ga0207699_10042213
593 Ga0207707_10026655
594 Ga0207671_10022245
595 Ga0207693_10002180
596 Ga0207649_10009317
597 Ga0207652_10028980
598 Ga0207694_10000424
599 Ga0207687_10002817
600 Ga0207700_10020275
601 Ga0207664_10013349
602 Ga0207706_10002463
603 Ga0207686_10000325
604 Ga0207709_10011639
605 Ga0207670_10047997
606 Ga0207665_10020295
607 Ga0207711_10000514
608 Ga0207689_10027287
609 Ga0207689_10032865
610 Ga0207679_10078937
611 Ga0207640_10015509
612 Ga0207677_10000276
613 Ga0207703_10000574
614 Ga0207703_10071198
615 Ga0207641_10017882
616 Ga0207648_10075900
617 Ga0207683_10001923
618 Ga0209281_1000202
619 Ga0209389_1000131
620 Ga0209389_1053141
621 Ga0209371_1000518
622 Ga0209999_1003730
623 Ga0209974_10019177
624 Ga0207428_10009097
625 Ga0268266_10067433
626 Ga0307517_10003898
627 Ga0307515_10000019
628 Ga0268256_1000365
629 Ga0307511_10070501
630 Ga0316181_1147001
631 Ga0307405_10004299
632 Ga0307406_10021614
633 Ga0307412_10001346
634 Ga0307409_100029560
635 Ga0373934_0004456
636 Ga0373923_0006006
637 Ga0373933_0029857
638 Ga0395905_0000209
639 Ga0395905_0182632
640 Ga0439438_000622
641 Ga0439438_001115
642 Ga0439438_001130
643 Ga0439438_005626
644 Ga0439438_007628
645 Ga0439447_001610
646 Ga0439466_0003983
647 Ga0439445_0004174
648 Ga0439432_000475
649 Ga0439432_001712
650 Ga0439432_008596
651 Ga0439452_001056
652 Ga0439452_005063
653 Ga0439456_008183
654 Ga0450900_000124
655 Ga0450902_000487
656 Ga0450903_003659
657 Ga0450904_000003
658 Ga0450905_000399
659 Ga0450907_000081
660 Ga0450909_000290
661 Ga0450901_000100
662 Ga0439440_0000658
663 Ga0466961_0022979
664 Ga0495617_020634
665 Ga0495627_000495
666 Ga0495627_001208
667 Ga0495603_0015447
668 Ga0495590_0012592
669 Ga0495590_0021699
670 Ga0495591_000035
671 Ga0495591_000476
672 Ga0495591_000804
673 Ga0495591_003506
674 Ga0495591_006036
675 Ga0495638_0002645
676 Ga0495638_0003669
677 Ga0495638_0013723
678 Ga0495638_0031404
679 Ga0495638_0066485
680 Ga0495651_0014730
681 Ga0495650_0000630
682 Ga0495650_0001566
683 Ga0495650_0013384
684 Ga0495605_0000137
685 Ga0495605_0000911
686 Ga0495605_0023961
687 Ga0495605_0030738
688 Ga0495639_0019599
689 Ga0495584_0001750
690 Ga0495584_0007456
691 Ga0495584_0012141
692 Ga0495585_0040998
693 Ga0495585_0054200
694 Ga0495607_0000376
695 Ga0495607_0000642
696 Ga0495607_0002114
697 Ga0495607_0017234
698 Ga0495607_0018546
699 Ga0495607_0040744
700 Ga0495607_0044183
701 Ga0495583_0000894
702 Ga0495583_0003193
703 Ga0495583_0004738
704 Ga0495583_0006295
705 Ga0495583_0008260
706 Ga0495606_0000320
707 Ga0495606_0000453
708 Ga0495606_0006728
709 Ga0495606_0028801
710 Ga0495606_0051419
711 Ga0495610_0008452
712 Ga0495610_0011049
713 Ga0495616_0007063
714 Ga0495620_0000013
715 Ga0495620_0006319
716 Ga0495620_0008294
717 Ga0495620_0011653
718 Ga0495631_0016389
719 Ga0495632_0001087
720 Ga0495632_0001201
721 Ga0495632_0001757
722 Ga0495632_0010515
723 Ga0495632_0041826
724 Ga0495637_0000303
725 Ga0495637_0000319
726 Ga0495637_0004844
727 Ga0495637_0020023
728 Ga0495637_0033853
729 Ga0495643_0000740
730 Ga0495643_0001199
731 Ga0495643_0003271
732 Ga0495643_0035459
733 Ga0495643_0057624
734 Ga0495644_0000889
735 Ga0495648_0000885
736 Ga0495648_0009678
737 Ga0495648_0013480
738 Ga0495648_0014884
739 Ga0495648_0039718
740 Ga0495666_0031555
741 Ga0495642_0000897
742 Ga0495654_0001131
743 Ga0495654_0005109
744 Ga0495654_0008033
745 Ga0495654_0012698
746 Ga0495654_0022161
747 Ga0495654_0034186
748 Ga0495609_0000265
749 Ga0495609_0000273
750 Ga0495609_0024520
751 Ga0495609_0040536
752 Ga0495597_0000200
753 Ga0495597_0010510
754 Ga0495597_0019340
755 Ga0495622_0009720
756 Ga0495622_0017006
757 Ga0495622_0038599
758 Ga0495633_0012458
759 Ga0495656_0005660
760 Ga0495611_0002612
761 Ga0495611_0028316
762 Ga0495625_0000076
763 Ga0495625_0034147
764 Ga0495661_0000432
765 Ga0495661_0000517
766 Ga0495661_0001420
767 Ga0495661_0037989
768 Ga0495661_0041168
769 Ga0495661_0059690
770 Ga0495647_0001851
771 Ga0495669_0004608
772 Ga0495670_0030210
773 Ga0495671_0000958
774 Ga0495671_0014311
775 Ga0495671_0021870
776 Ga0495671_0032204
777 Ga0495671_0035470
778 Ga0495671_0038483
779 Ga0495671_0042029
780 Ga0495671_0043140
781 Ga0495649_0002398
782 Ga0495649_0004367
783 Ga0495649_0008307
784 Ga0495649_0036846
785 Ga0495589_0003963
786 Ga0495589_0015079
787 Ga0495589_0040322
788 Ga0495660_0001052
789 Ga0495660_0007310
790 Ga0495660_0015836
791 Ga0495660_0018908
792 Ga0495660_0024021
793 Ga0495660_0024085
794 Ga0495660_0024148
795 Ga0495604_0015190
796 Ga0495674_0058610
797 Ga0495672_0001578
798 Ga0495672_0002286
799 Ga0495672_0017924
800 Ga0495672_0030821
801 Ga0495676_0000016
802 Ga0495683_0000910
803 Ga0495683_0012443
804 Ga0495683_0020565
805 Ga0495677_0001430
806 Ga0495679_001655
807 Ga0495679_023700
808 Ga0495673_0000484
809 Ga0495673_0000586
810 Ga0495673_0002774
811 Ga0495673_0008728
812 Ga0495673_0010895
813 Ga0495673_0016193
814 Ga0495673_0018975
815 Ga0495681_0006402
816 Ga0495681_0006912
817 Ga0495681_0012606
818 Ga0495681_0037384
819 Ga0495681_0058411
820 Ga0495684_0005090
821 Ga0495602_0150558
822 Ga0495626_0000336
823 Ga0495626_0001676
824 Ga0495626_0007782
825 Ga0495626_0014759
826 Ga0496102_0044387
827 Ga0496104_0000923
828 Ga0496109_0021304
829 Ga0496110_0035905
830 Ga0496110_0098407
831 Ga0496110_0106658
832 Ga0496112_0031698
833 Ga0496114_0006021
834 Ga0496114_0011345
835 Ga0496116_0000332
836 Ga0496116_0009529
837 Ga0496117_0000935
838 Ga0496117_0001232
839 Ga0496117_0001376
840 Ga0496117_0001851
841 Ga0496118_0002130
842 Ga0496118_0004881
843 Ga0496118_0028622
844 Ga0496118_0032774
845 Ga0496118_0078277
846 Ga0496119_0000112
847 Ga0496119_0058012
848 Ga0496120_0001230
849 Ga0496120_0038259
850 Ga0496121_0010782
851 Ga0496121_0011619
852 Ga0496121_0095052
853 Ga0496122_0000447
854 Ga0496122_0004606
855 Ga0496123_0000348
856 Ga0496123_0001754
857 Ga0496124_0001241
858 Ga0496124_0002369
859 Ga0496124_0006498
860 Ga0496124_0006656
861 Ga0496124_0011845
862 Ga0496124_0013568
863 Ga0496124_0023274
864 Ga0496124_0029664
865 Ga0496124_0045800
866 Ga0496125_0001176
867 Ga0496125_0001804
868 Ga0496125_0007932
869 Ga0496125_0031815
870 Ga0496125_0039051
871 Ga0496125_0089607
872 Ga0496126_0048785
873 Ga0496126_0235193
874 Ga0495678_000504
875 Ga0495678_008685
876 Ga0495678_010694
877 Ga0495678_012279
878 Ga0495678_020299
879 Ga0501034_0000020
880 Ga0501034_0000199
881 Ga0501226_000005
882 Ga0495595_0008911
883 Ga0500659_0001360
884 2511300049
885 2511376395
886 2555248029
887 2599330172
888 2599507787
889 2599616871
890 2599996412
891 2600024148
892 2600031174
893 2600035331
894 2600058284
895 2600078488
896 2600360137
897 2601625659
898 2601691159
899 2652547333
900 2723247455
901 2738691477
902 2739198575
903 2739267252
904 2748017275
905 2765585628
906 2774121544
907 2784315569
908 2807408388
909 2807456702
910 2808856458
911 2808924544
912 2808936394
913 2808946623
914 2808964815
915 2808999707
916 2812368293
917 2826586128
918 2842806392
919 2842820667
920 2842828951
921 2842839862
922 2842853301
923 2842857067
924 2857359381
925 2919159338
926 2919483017
927 2923522347
928 2923590773
929 2929191274
930 2988733099
931 3007256906
932 3007318838
933 3007623092
934 3007805062
935 3007871603
936 640488606
937 651176654
938 8052498826
939 8054348303
940 8054933305
941 8055884140
942 8056147721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04675

DNA_ligase_A_N

DNA ligase N terminus

1

161

0.92

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

213

447

0.89

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

467

563

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gdr-assembly1.cif.gz_A dna binding with a minimal scaffold: structure-function analysis of lig e dna ligases 0.7948 201 518
6gdr-assembly1.cif.gz_A dna binding with a minimal scaffold: structure-function analysis of lig e dna ligases 0.7894 201 518
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.7604 1 413
7sx5-assembly1.cif.gz_A crystal structure of ligase i with nick duplexes containing mismatch a:c 0.7402 4 537
6iml-assembly1.cif.gz_A the crystal structure of asfvlig:ct1 complex 0.7365 203 515
ID Description Score Start End Superfamily
af_Q57635_441_573_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9562 416 537 2.40.50.140
3rr5A03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9199 415 537 2.40.50.140
af_P9WNV5_381_507_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9188 414 534 2.40.50.140
af_A4I634_506_665_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.901 414 537 2.40.50.140
af_Q8IES4_745_907_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.899 414 537 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5Q4F2J7-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9866 434 537 GO:0003910
GO:0006281
GO:0006310
AF-A0A4V1ZYT2-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9844 421 536 GO:0003910
GO:0006281
GO:0006310
AF-A0A7W1SPB4-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9758 439 528 GO:0003910
GO:0006281
GO:0006310
AF-A0A3C1RBC0-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) 0.9726 424 536 GO:0003910
GO:0006281
GO:0006310
AF-A0A3C2A9F9-F1-model_v4 ATP-dependent DNA ligase (EC 6.5.1.1) 0.9699 263 388 GO:0003910
GO:0005524
GO:0006281
GO:0006310

Map