F450253

General Info

Members Datasets Scaffolds Average Seq Length
469 244 938 219

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10350834|Ga0207687_103508342
Length 266
Sequence LVCQRKARIETGGVWENKKEWRRGKEPDVPHKVYASELIPEMFVGHYSVAFALKNDRNRIPLWVLFVAVQFLDYIWATLVLLGIEKLRVIKGFTAGSMLDSYYHPYSRSLIAAILWSTVAGIGYKLLCRRLGYQYRKSAALIVGLAVFSHWILDLIAHPRDLAIYDDTWKVGFGLWNYRDPEFALEIAMLAGGITLYLARNAISIVRKMAVIGFGIALVIVQIGDTYVPRTPLSDKATAMGVWIFYTFFVVVAYLLERTRREKLES

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
243 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 9.59
Rhizosphere 89.98
Stem 0
Stem Tuber 0
Unclassified 18.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10350834 3300025927 Unclassified 1202
2 JGI25405J52794_10003884 3300003911 Bacteria 2650
3 JGI25405J52794_10011026 3300003911 Bacteria 1727
4 JGI25405J52794_10034006 3300003911 Unclassified 1065
5 Ga0065704_10389613 3300005289 Bacteria 761
6 Ga0065712_10006331 3300005290 Bacteria 4156
7 Ga0065712_10360847 3300005290 Bacteria 760
8 Ga0065715_10007227 3300005293 Unclassified 3589
9 Ga0065715_10011286 3300005293 Unclassified 3575
10 Ga0065715_10019192 3300005293 Unclassified 3785
11 Ga0065715_10093325 3300005293 Bacteria 4724
12 Ga0065715_10118865 3300005293 Bacteria 2294
13 Ga0065715_10174454 3300005293 Unclassified 1522
14 Ga0065707_10233132 3300005295 Unclassified 1181
15 Ga0070658_10453876 3300005327 Bacteria 1104
16 Ga0070676_10059837 3300005328 Bacteria 2260
17 Ga0070676_10618727 3300005328 Unclassified 783
18 Ga0070683_100009833 3300005329 Bacteria 8195
19 Ga0070683_100043791 3300005329 Bacteria 4125
20 Ga0070690_100252623 3300005330 Bacteria 1248
21 Ga0068869_100096533 3300005334 Unclassified 2231
22 Ga0070666_10256643 3300005335 Bacteria 1238
23 Ga0070680_100183015 3300005336 Bacteria 1765
24 Ga0070680_100528576 3300005336 Unclassified 1010
25 Ga0070682_100018885 3300005337 Bacteria 4038
26 Ga0068868_100155391 3300005338 Bacteria 1886
27 Ga0070660_100175523 3300005339 Bacteria 1733
28 Ga0070689_100048341 3300005340 Bacteria 3281
29 Ga0070689_100208322 3300005340 Unclassified 1599
30 Ga0070687_100356980 3300005343 Unclassified 945
31 Ga0070668_100273862 3300005347 Unclassified 1408
32 Ga0070675_100032400 3300005354 Bacteria 4230
33 Ga0070675_100095884 3300005354 Bacteria 2491
34 Ga0070675_100105024 3300005354 Unclassified 2383
35 Ga0070671_100006841 3300005355 Bacteria 9126
36 Ga0070671_100053216 3300005355 Bacteria 3365
37 Ga0070671_100154645 3300005355 Unclassified 1937
38 Ga0070674_100779571 3300005356 Unclassified 824
39 Ga0070673_100139886 3300005364 Bacteria 2040
40 Ga0070688_100019016 3300005365 Bacteria 3976
41 Ga0070688_100030742 3300005365 Unclassified 3225
42 Ga0070688_100032736 3300005365 Unclassified 3138
43 Ga0070688_100082089 3300005365 Bacteria 2088
44 Ga0070659_100020367 3300005366 Bacteria 5036
45 Ga0070659_100255596 3300005366 Bacteria 1453
46 Ga0070667_100064180 3300005367 Bacteria 3115
47 Ga0070667_100096427 3300005367 Bacteria 2550
48 Ga0070714_100177624 3300005435 Bacteria 1935
49 Ga0070714_100680977 3300005435 Unclassified 991
50 Ga0070713_100076680 3300005436 Bacteria 2840
51 Ga0070713_100101107 3300005436 Unclassified 2497
52 Ga0070713_100265367 3300005436 Bacteria 1570
53 Ga0070710_10024919 3300005437 Bacteria 3161
54 Ga0070710_10096737 3300005437 Bacteria 1750
55 Ga0070710_10157023 3300005437 Bacteria 1407
56 Ga0070710_10269787 3300005437 Bacteria 1100
57 Ga0070711_100041045 3300005439 Bacteria 3123
58 Ga0070711_100196457 3300005439 Bacteria 1554
59 Ga0070711_100257920 3300005439 Bacteria 1370
60 Ga0070705_100404626 3300005440 Bacteria 1012
61 Ga0070708_100036175 3300005445 Bacteria 4306
62 Ga0070708_100088296 3300005445 Bacteria 2819
63 Ga0070708_100163286 3300005445 Unclassified 2076
64 Ga0070708_100414286 3300005445 Bacteria 1271
65 Ga0070678_100101007 3300005456 Bacteria 2235
66 Ga0070678_100253350 3300005456 Bacteria 1477
67 Ga0070662_100023146 3300005457 Bacteria 4264
68 Ga0070681_10021483 3300005458 Bacteria 6470
69 Ga0070681_10053562 3300005458 Bacteria 4021
70 Ga0070681_10149780 3300005458 Bacteria 2260
71 Ga0070681_10362928 3300005458 Bacteria 1359
72 Ga0070706_100063450 3300005467 Bacteria 3415
73 Ga0070706_100123451 3300005467 Bacteria 2414
74 Ga0070706_100620724 3300005467 Bacteria 1004
75 Ga0070707_100025696 3300005468 Bacteria 5590
76 Ga0070707_100402727 3300005468 Unclassified 1328
77 Ga0070707_100405807 3300005468 Bacteria 1323
78 Ga0070698_100193160 3300005471 Bacteria 1973
79 Ga0070699_100253819 3300005518 Bacteria 1572
80 Ga0070699_100271258 3300005518 Bacteria 1519
81 Ga0070684_100010153 3300005535 Bacteria 7445
82 Ga0070684_100209934 3300005535 Unclassified 1774
83 Ga0070684_100290451 3300005535 Bacteria 1499
84 Ga0070697_100250494 3300005536 Bacteria 1514
85 Ga0070697_100253489 3300005536 Unclassified 1505
86 Ga0070697_100318156 3300005536 Unclassified 1340
87 Ga0070672_100097598 3300005543 Bacteria 2379
88 Ga0070695_100279200 3300005545 Unclassified 1227
89 Ga0070696_100215831 3300005546 Bacteria 1438
90 Ga0070693_100027137 3300005547 Bacteria 3099
91 Ga0070665_100038468 3300005548 Bacteria 4809
92 Ga0070665_100069163 3300005548 Unclassified 3539
93 Ga0070665_100177689 3300005548 Bacteria 2130
94 Ga0070704_100059532 3300005549 Bacteria 2725
95 Ga0068855_100101883 3300005563 Unclassified 3305
96 Ga0070664_100245596 3300005564 Bacteria 1608
97 Ga0070664_100255524 3300005564 Bacteria 1576
98 Ga0068854_100056759 3300005578 Bacteria 2823
99 Ga0068856_100103004 3300005614 Bacteria 2848
100 Ga0068856_100314830 3300005614 Bacteria 1582
101 Ga0068856_100323325 3300005614 Bacteria 1560
102 Ga0068852_100019178 3300005616 Bacteria 5406
103 Ga0068852_101116382 3300005616 Bacteria 809
104 Ga0068859_100054013 3300005617 Unclassified 4040
105 Ga0068864_100306669 3300005618 Unclassified 1487
106 Ga0068863_100036451 3300005841 Bacteria 4684
107 Ga0068858_100077681 3300005842 Bacteria 3084
108 Ga0068858_100174064 3300005842 Bacteria 2031
109 Ga0068858_100876186 3300005842 Unclassified 877
110 Ga0068860_100255860 3300005843 Bacteria 1706
111 Ga0068860_101171654 3300005843 Bacteria 788
112 Ga0068862_100072887 3300005844 Bacteria 2967
113 Ga0068862_100225169 3300005844 Unclassified 1699
114 Ga0081455_10000222 3300005937 Bacteria 73055
115 Ga0081455_10003202 3300005937 Bacteria 18959
116 Ga0081455_10012138 3300005937 Bacteria 8608
117 Ga0081455_10021949 3300005937 Bacteria 5979
118 Ga0081455_10065789 3300005937 Bacteria 3030
119 Ga0081455_10070023 3300005937 Bacteria 2913
120 Ga0081455_10125919 3300005937 Unclassified 2011
121 Ga0081540_1109111 3300005983 Unclassified 1174
122 Ga0081539_10018638 3300005985 Bacteria 4803
123 Ga0070717_10020137 3300006028 Bacteria 5243
124 Ga0070717_10086796 3300006028 Bacteria 2634
125 Ga0070717_10130543 3300006028 Bacteria 2160
126 Ga0070717_10278668 3300006028 Bacteria 1483
127 Ga0070717_10710849 3300006028 Bacteria 913
128 Ga0070717_10773447 3300006028 Unclassified 873
129 Ga0070715_10184929 3300006163 Bacteria 1047
130 Ga0070716_100018585 3300006173 Unclassified 3623
131 Ga0070716_100150952 3300006173 Bacteria 1494
132 Ga0070712_100015830 3300006175 Bacteria 4862
133 Ga0070712_100046232 3300006175 Bacteria 3009
134 Ga0070712_100101609 3300006175 Bacteria 2127
135 Ga0070712_100222558 3300006175 Unclassified 1495
136 Ga0070712_100223960 3300006175 Bacteria 1490
137 Ga0070712_100295676 3300006175 Bacteria 1309
138 Ga0070712_100326652 3300006175 Unclassified 1249
139 Ga0070712_100600380 3300006175 Unclassified 932
140 Ga0068871_100067617 3300006358 Bacteria 2932
141 Ga0075428_100162815 3300006844 Unclassified 2421
142 Ga0075431_100310533 3300006847 Bacteria 1592
143 Ga0075433_10750419 3300006852 Unclassified 854
144 Ga0075434_100773660 3300006871 Unclassified 977
145 Ga0097620_100054013 3300006931 Unclassified 4040
146 Ga0075435_100154769 3300007076 Unclassified 1929
147 Ga0099794_10231754 3300007265 Bacteria 950
148 Ga0111539_10820148 3300009094 Unclassified 1082
149 Ga0105245_10038487 3300009098 Bacteria 4255
150 Ga0105245_10238945 3300009098 Bacteria 1760
151 Ga0105245_10409230 3300009098 Unclassified 1357
152 Ga0105245_10684649 3300009098 Bacteria 1058
153 Ga0105247_10019357 3300009101 Bacteria 4085
154 Ga0105247_10074227 3300009101 Bacteria 2132
155 Ga0114129_10043580 3300009147 Bacteria 6313
156 Ga0114129_10241718 3300009147 Bacteria 2427
157 Ga0114129_11539716 3300009147 Bacteria 816
158 Ga0105243_10382808 3300009148 Bacteria 1302
159 Ga0105243_10456119 3300009148 Bacteria 1201
160 Ga0105242_10077566 3300009176 Bacteria 2772
161 Ga0105242_10336759 3300009176 Bacteria 1389
162 Ga0105242_10339531 3300009176 Bacteria 1384
163 Ga0105242_11038145 3300009176 Unclassified 830
164 Ga0105238_10037034 3300009551 Bacteria 4961
165 Ga0105238_10037640 3300009551 Bacteria 4917
166 Ga0105249_10128970 3300009553 Bacteria 2412
167 Ga0105249_10847435 3300009553 Unclassified 980
168 Ga0099796_10052564 3300010159 Bacteria 1419
169 Ga0099796_10069445 3300010159 Unclassified 1268
170 Ga0105239_10068227 3300010375 Bacteria 3908
171 Ga0105239_10098211 3300010375 Bacteria 3237
172 Ga0105239_10213428 3300010375 Bacteria 2164
173 Ga0105239_10478583 3300010375 Bacteria 1414
174 Ga0105246_10020775 3300011119 Bacteria 4216
175 Ga0157373_10139278 3300013100 Unclassified 1706
176 Ga0157373_10179347 3300013100 Bacteria 1491
177 Ga0157369_10090275 3300013105 Unclassified 3271
178 Ga0157369_10198848 3300013105 Bacteria 2104
179 Ga0157369_10309032 3300013105 Unclassified 1644
180 Ga0157369_10441237 3300013105 Bacteria 1348
181 Ga0157374_10067766 3300013296 Unclassified 3356
182 Ga0157374_10105042 3300013296 Bacteria 2712
183 Ga0157374_10115969 3300013296 Bacteria 2580
184 Ga0157374_10117759 3300013296 Bacteria 2561
185 Ga0157374_10144097 3300013296 Bacteria 2314
186 Ga0157374_10509069 3300013296 Bacteria 1209
187 Ga0157378_10025823 3300013297 Bacteria 5175
188 Ga0157378_10109370 3300013297 Bacteria 2532
189 Ga0157378_10183745 3300013297 Bacteria 1968
190 Ga0163162_10042427 3300013306 Bacteria 4554
191 Ga0163162_10230855 3300013306 Bacteria 1981
192 Ga0163162_10565849 3300013306 Bacteria 1264
193 Ga0163162_11065060 3300013306 Bacteria 915
194 Ga0157372_10164909 3300013307 Bacteria 2562
195 Ga0157372_10323300 3300013307 Bacteria 1796
196 Ga0157372_11112093 3300013307 Bacteria 914
197 Ga0157375_10006955 3300013308 Bacteria 9875
198 Ga0157375_10022271 3300013308 Bacteria 5830
199 Ga0157375_10062453 3300013308 Bacteria 3702
200 Ga0157375_10175460 3300013308 Unclassified 2292
201 Ga0163163_10512299 3300014325 Bacteria 1262
202 Ga0157377_10021639 3300014745 Bacteria 3385
203 Ga0157379_10013180 3300014968 Bacteria 7238
204 Ga0157379_10069198 3300014968 Bacteria 3156
205 Ga0157376_10109107 3300014969 Bacteria 2432
206 Ga0182006_1016592 3300015261 Bacteria 3140
207 Ga0182005_1005625 3300015265 Unclassified 3902
208 Ga0163161_10106230 3300017792 Bacteria 2095
209 Ga0163161_10339482 3300017792 Bacteria 1191
210 Ga0163161_10371971 3300017792 Bacteria 1140
211 Ga0207697_10005198 3300025315 Bacteria 6073
212 Ga0207697_10008187 3300025315 Unclassified 4598
213 Ga0207697_10012046 3300025315 Bacteria 3640
214 Ga0207697_10021321 3300025315 Bacteria 2653
215 Ga0207692_10083425 3300025898 Bacteria 1715
216 Ga0207692_10127586 3300025898 Bacteria 1432
217 Ga0207710_10019295 3300025900 Unclassified 2908
218 Ga0207688_10042540 3300025901 Bacteria 2529
219 Ga0207680_10343621 3300025903 Bacteria 1047
220 Ga0207685_10237292 3300025905 Unclassified 875
221 Ga0207645_10007098 3300025907 Bacteria 7959
222 Ga0207645_10039404 3300025907 Bacteria 3028
223 Ga0207645_10130565 3300025907 Bacteria 1635
224 Ga0207684_10009651 3300025910 Bacteria 8510
225 Ga0207707_10040156 3300025912 Bacteria 4088
226 Ga0207707_10092893 3300025912 Bacteria 2636
227 Ga0207693_10016293 3300025915 Bacteria 5943
228 Ga0207693_10036764 3300025915 Bacteria 3861
229 Ga0207693_10048488 3300025915 Bacteria 3335
230 Ga0207693_10060364 3300025915 Bacteria 2970
231 Ga0207693_10086321 3300025915 Bacteria 2459
232 Ga0207693_10206618 3300025915 Bacteria 1544
233 Ga0207693_10366483 3300025915 Bacteria 1127
234 Ga0207663_10003173 3300025916 Bacteria 7997
235 Ga0207663_10234317 3300025916 Bacteria 1343
236 Ga0207662_10226943 3300025918 Bacteria 1218
237 Ga0207657_10140573 3300025919 Bacteria 1973
238 Ga0207657_10189982 3300025919 Bacteria 1657
239 Ga0207649_10169038 3300025920 Bacteria 1521
240 Ga0207652_10021510 3300025921 Bacteria 5323
241 Ga0207646_10017603 3300025922 Bacteria 6678
242 Ga0207646_10393621 3300025922 Unclassified 1252
243 Ga0207646_10527750 3300025922 Bacteria 1063
244 Ga0207681_10032639 3300025923 Bacteria 3410
245 Ga0207694_10145403 3300025924 Unclassified 1908
246 Ga0207694_10243055 3300025924 Bacteria 1471
247 Ga0207659_10049949 3300025926 Bacteria 2969
248 Ga0207659_10164324 3300025926 Bacteria 1746
249 Ga0207659_10224362 3300025926 Unclassified 1512
250 Ga0207659_10304386 3300025926 Bacteria 1310
251 Ga0207659_10366948 3300025926 Bacteria 1198
252 Ga0207659_10533444 3300025926 Unclassified 996
253 Ga0207700_10040265 3300025928 Bacteria 3409
254 Ga0207700_10149430 3300025928 Bacteria 1929
255 Ga0207700_10443397 3300025928 Bacteria 1143
256 Ga0207700_10615061 3300025928 Bacteria 967
257 Ga0207700_10755334 3300025928 Unclassified 869
258 Ga0207664_10024806 3300025929 Bacteria 4509
259 Ga0207664_10057939 3300025929 Bacteria 3080
260 Ga0207644_10107211 3300025931 Bacteria 2107
261 Ga0207690_10012215 3300025932 Bacteria 5140
262 Ga0207706_10008984 3300025933 Bacteria 9199
263 Ga0207706_10089833 3300025933 Bacteria 2701
264 Ga0207706_10113288 3300025933 Bacteria 2386
265 Ga0207709_10132863 3300025935 Bacteria 1699
266 Ga0207669_10009743 3300025937 Bacteria 4591
267 Ga0207669_10561118 3300025937 Bacteria 923
268 Ga0207704_10262585 3300025938 Bacteria 1303
269 Ga0207665_10059281 3300025939 Bacteria 2590
270 Ga0207665_10089942 3300025939 Bacteria 2127
271 Ga0207665_10107135 3300025939 Bacteria 1959
272 Ga0207691_10007558 3300025940 Bacteria 10462
273 Ga0207689_10110764 3300025942 Unclassified 2256
274 Ga0207661_10014237 3300025944 Bacteria 5824
275 Ga0207661_10333399 3300025944 Bacteria 1366
276 Ga0207679_10141170 3300025945 Bacteria 1947
277 Ga0207679_10165464 3300025945 Bacteria 1815
278 Ga0207679_10204651 3300025945 Bacteria 1651
279 Ga0207667_10066679 3300025949 Unclassified 3751
280 Ga0207651_10064182 3300025960 Unclassified 2569
281 Ga0207651_10511708 3300025960 Unclassified 1039
282 Ga0207712_10218801 3300025961 Bacteria 1521
283 Ga0207668_10340340 3300025972 Unclassified 1251
284 Ga0207668_10607357 3300025972 Unclassified 953
285 Ga0207658_10130649 3300025986 Bacteria 2017
286 Ga0207658_10200433 3300025986 Bacteria 1666
287 Ga0207677_10217970 3300026023 Bacteria 1528
288 Ga0207703_10260201 3300026035 Bacteria 1568
289 Ga0207639_10318109 3300026041 Unclassified 1381
290 Ga0207708_10055318 3300026075 Bacteria 3025
291 Ga0207702_10008845 3300026078 Bacteria 8487
292 Ga0207641_10096747 3300026088 Bacteria 2593
293 Ga0207683_10067450 3300026121 Unclassified 3156
294 Ga0268266_10138983 3300028379 Bacteria 2179
295 Ga0268266_10308369 3300028379 Unclassified 1478
296 Ga0268266_11126399 3300028379 Bacteria 759
297 Ga0268265_10155422 3300028380 Bacteria 1935
298 Ga0268264_10748353 3300028381 Bacteria 973
299 Ga0373926_0009147 3300035083 Bacteria 3305
300 Ga0373934_0014265 3300035086 Bacteria 3010
301 Ga0373944_0003211 3300035089 Bacteria 4198
302 Ga0373923_0004757 3300035111 Bacteria 4539
303 Ga0373923_0040167 3300035111 Bacteria 1924
304 Ga0373936_0030072 3300035113 Unclassified 2142
305 Ga0373945_0002769 3300035116 Bacteria 5506
306 Ga0373954_0044984 3300035118 Bacteria 2061
307 Ga0373956_0040348 3300035119 Bacteria 2070
308 Ga0373957_0000582 3300035120 Bacteria 9224
309 Ga0373943_0345809 3300035170 Bacteria 851
310 Ga0373946_0044523 3300035171 Bacteria 1832
311 Ga0373955_0004923 3300035172 Bacteria 5959
312 Ga0373955_0056598 3300035172 Bacteria 2151
313 Ga0373931_0010532 3300035691 Bacteria 4446
314 Ga0373931_0416805 3300035691 Bacteria 853
315 Ga0373935_0010094 3300035692 Bacteria 5656
316 Ga0373935_0044666 3300035692 Bacteria 2793
317 Ga0373935_0167006 3300035692 Bacteria 1503
318 Ga0373927_0027948 3300035695 Bacteria 3681
319 Ga0373927_0095556 3300035695 Bacteria 1931
320 Ga0373933_0052188 3300035724 Bacteria 2446
321 Ga0373933_0070496 3300035724 Bacteria 2126
322 Ga0373947_0016270 3300035725 Bacteria 4275
323 Ga0373947_0079700 3300035725 Bacteria 2024
324 Ga0373937_0000490 3300036401 Bacteria 36024
325 Ga0373937_0005156 3300036401 Bacteria 11139
326 Ga0373937_0010387 3300036401 Bacteria 8130
327 Ga0373937_0263300 3300036401 Bacteria 1626
328 Ga0373937_0263684 3300036401 Unclassified 1625
329 Ga0373925_0013621 3300037068 Bacteria 5888
330 Ga0373925_0025014 3300037068 Bacteria 4360
331 Ga0373925_0034143 3300037068 Bacteria 3750
332 Ga0373925_0420791 3300037068 Bacteria 1091
333 Ga0395899_0049354 3300037312 Bacteria 3129
334 Ga0395900_0062405 3300037418 Bacteria 3831
335 Ga0395900_0113602 3300037418 Bacteria 2779
336 Ga0395900_0314464 3300037418 Unclassified 1548
337 Ga0395898_0012151 3300037466 Bacteria 8909
338 Ga0395898_0234027 3300037466 Bacteria 1752
339 Ga0395898_0717067 3300037466 Bacteria 942
340 Ga0395905_0006379 3300037471 Bacteria 11888
341 Ga0395901_0025796 3300038443 Bacteria 6034
342 Ga0395901_0036494 3300038443 Bacteria 5082
343 Ga0395901_0207151 3300038443 Unclassified 2054
344 Ga0451798_0053566 3300041458 Unclassified 838
345 Ga0495592_0001184 3300046454 Bacteria 18095
346 Ga0495603_0049998 3300046455 Bacteria 2487
347 Ga0495603_0062269 3300046455 Bacteria 2203
348 Ga0495629_0316858 3300046459 Unclassified 1066
349 Ga0495629_0416200 3300046459 Unclassified 912
350 Ga0495651_0000895 3300046462 Bacteria 23161
351 Ga0495653_0012511 3300046463 Bacteria 6929
352 Ga0495580_0101539 3300046472 Bacteria 2000
353 Ga0495639_0060117 3300046475 Unclassified 1740
354 Ga0495662_0012727 3300046476 Bacteria 4102
355 Ga0495664_0007609 3300046477 Bacteria 6021
356 Ga0495664_0036790 3300046477 Bacteria 2886
357 Ga0495594_0017031 3300046499 Bacteria 3836
358 Ga0495594_0023996 3300046499 Bacteria 3272
359 Ga0495594_0055671 3300046499 Bacteria 2181
360 Ga0495608_0000129 3300046511 Bacteria 53862
361 Ga0495618_0001726 3300046514 Bacteria 14506
362 Ga0495618_0144000 3300046514 Bacteria 1524
363 Ga0495628_0001570 3300046516 Bacteria 20927
364 Ga0495630_0304255 3300046517 Bacteria 1218
365 Ga0495666_0016940 3300046526 Bacteria 3628
366 Ga0495652_0004520 3300046529 Bacteria 13265
367 Ga0495652_0026867 3300046529 Bacteria 5078
368 Ga0495652_0081297 3300046529 Bacteria 2673
369 Ga0495665_0023523 3300046531 Bacteria 3309
370 Ga0495665_0201928 3300046531 Bacteria 1030
371 Ga0495640_0015297 3300046533 Bacteria 5776
372 Ga0495586_0180398 3300046535 Bacteria 1194
373 Ga0495587_0000354 3300046536 Bacteria 32868
374 Ga0495645_0000800 3300046543 Bacteria 21568
375 Ga0495667_0002315 3300046559 Bacteria 12757
376 Ga0495656_0149447 3300046615 Unclassified 1127
377 Ga0495634_0027037 3300046642 Bacteria 3996
378 Ga0495634_0232164 3300046642 Bacteria 1135
379 Ga0495635_0001388 3300046663 Bacteria 16150
380 Ga0495635_0008767 3300046663 Bacteria 7061
381 Ga0495657_0001374 3300046675 Bacteria 21110
382 Ga0495599_0000294 3300046678 Bacteria 30376
383 Ga0495623_0000055 3300046679 Bacteria 69548
384 Ga0495646_0000749 3300046680 Bacteria 18095
385 Ga0495646_0136883 3300046680 Unclassified 1373
386 Ga0495647_0019550 3300046681 Bacteria 2423
387 Ga0495647_0069323 3300046681 Bacteria 1408
388 Ga0495658_0030195 3300046683 Bacteria 2941
389 Ga0495658_0069406 3300046683 Bacteria 2043
390 Ga0495669_0046166 3300046684 Bacteria 1944
391 Ga0495613_0067413 3300046689 Bacteria 2612
392 Ga0495613_0106635 3300046689 Bacteria 2021
393 Ga0495624_0135693 3300046690 Bacteria 1508
394 Ga0495600_0014646 3300046809 Bacteria 4943
395 Ga0495600_0015473 3300046809 Bacteria 4822
396 Ga0495581_0062332 3300047315 Bacteria 2154
397 Ga0495581_0131641 3300047315 Bacteria 1457
398 Ga0495604_0001560 3300047317 Bacteria 18862
399 Ga0495674_0005151 3300047319 Bacteria 12554
400 Ga0495674_0033478 3300047319 Bacteria 4653
401 Ga0495680_0019769 3300047322 Bacteria 5680
402 Ga0495675_0000190 3300047444 Bacteria 44968
403 Ga0495684_0059163 3300047471 Bacteria 2918
404 Ga0495593_0039520 3300047673 Bacteria 2543
405 Ga0495602_0000445 3300048088 Bacteria 38896
406 Ga0495614_0176369 3300048089 Bacteria 960
407 Ga0496100_0055665 3300048903 Bacteria 2585
408 Ga0496100_0244745 3300048903 Bacteria 1324
409 Ga0496101_0044728 3300048904 Bacteria 3169
410 Ga0496102_0034406 3300048905 Bacteria 4556
411 Ga0496102_0044759 3300048905 Bacteria 4018
412 Ga0496102_0072639 3300048905 Bacteria 3162
413 Ga0496102_0293414 3300048905 Unclassified 1533
414 Ga0496102_1308317 3300048905 Unclassified 644
415 Ga0496103_0027825 3300048906 Bacteria 3428
416 Ga0496103_0144614 3300048906 Bacteria 1521
417 Ga0496103_0156755 3300048906 Bacteria 1460
418 Ga0496104_0010004 3300048907 Bacteria 8467
419 Ga0496104_0054678 3300048907 Bacteria 3773
420 Ga0496104_0134543 3300048907 Bacteria 2375
421 Ga0496105_0004757 3300048908 Bacteria 10249
422 Ga0496105_0009544 3300048908 Bacteria 7594
423 Ga0496105_0081943 3300048908 Bacteria 2665
424 Ga0496106_0037972 3300048909 Bacteria 3603
425 Ga0496106_0070257 3300048909 Bacteria 2674
426 Ga0496106_0136440 3300048909 Bacteria 1927
427 Ga0496107_0022645 3300048910 Bacteria 4440
428 Ga0496107_0054422 3300048910 Bacteria 2888
429 Ga0496108_0125528 3300048911 Bacteria 2203
430 Ga0496108_0176185 3300048911 Bacteria 1851
431 Ga0496109_0270424 3300048912 Bacteria 1601
432 Ga0496110_0055055 3300048913 Bacteria 3500
433 Ga0496110_0065084 3300048913 Bacteria 3223
434 Ga0496110_0761121 3300048913 Bacteria 872
435 Ga0496111_0023791 3300048914 Bacteria 4303
436 Ga0496111_0124895 3300048914 Bacteria 1902
437 Ga0496111_0306101 3300048914 Unclassified 1178
438 Ga0496111_0420076 3300048914 Bacteria 988
439 Ga0496112_0002056 3300048915 Bacteria 15960
440 Ga0496112_0252350 3300048915 Unclassified 1715
441 Ga0496112_0317788 3300048915 Bacteria 1502
442 Ga0496112_0327324 3300048915 Bacteria 1476
443 Ga0496112_0545811 3300048915 Bacteria 1093
444 Ga0496112_0868137 3300048915 Bacteria 825
445 Ga0496113_0002197 3300048916 Bacteria 11250
446 Ga0496113_0101289 3300048916 Bacteria 2233
447 Ga0496113_0103007 3300048916 Bacteria 2214
448 Ga0496114_0030313 3300048917 Bacteria 4451
449 Ga0496115_0032563 3300048918 Bacteria 4112
450 Ga0496115_0343719 3300048918 Bacteria 1217
451 Ga0501068_0003577 3300049584 Bacteria 8393
452 Ga0501071_0052888 3300049587 Bacteria 2928
453 Ga0501073_0148314 3300049589 Bacteria 1625
454 Ga0501080_0134185 3300049742 Bacteria 2291
455 Ga0501080_0298357 3300049742 Unclassified 1462
456 nmdc:mga05p37_187903_c1 3300050507 Bacteria 2511
457 nmdc:mga0n895_697013_c1 3300050512 Bacteria 1012
458 nmdc:mga0n895_922464_c1 3300050512 Bacteria 858
459 nmdc:mga0rr50_495088_c1 3300050513 Bacteria 1039
460 Ga0495601_0000677 3300053077 Bacteria 18186
461 Ga0495601_0022598 3300053077 Bacteria 3862
462 Ga0495612_0002567 3300053078 Bacteria 7487
463 Ga0495612_0005714 3300053078 Bacteria 5135
464 Ga0495595_0000369 3300053084 Bacteria 17095
465 Ga0495619_0002831 3300053085 Bacteria 11298
466 Ga0495619_0003693 3300053085 Bacteria 9866
467 Ga0500618_019254 3300053125 Bacteria 1682
468 Ga0500637_0001526 3300053178 Bacteria 9882
469 Ga0501082_0041323 3300060353 Bacteria 3975
470 Ga0207687_10350834
471 JGI25405J52794_10003884
472 JGI25405J52794_10011026
473 JGI25405J52794_10034006
474 Ga0065704_10389613
475 Ga0065712_10006331
476 Ga0065712_10360847
477 Ga0065715_10007227
478 Ga0065715_10011286
479 Ga0065715_10019192
480 Ga0065715_10093325
481 Ga0065715_10118865
482 Ga0065715_10174454
483 Ga0065707_10233132
484 Ga0070658_10453876
485 Ga0070676_10059837
486 Ga0070676_10618727
487 Ga0070683_100009833
488 Ga0070683_100043791
489 Ga0070690_100252623
490 Ga0068869_100096533
491 Ga0070666_10256643
492 Ga0070680_100183015
493 Ga0070680_100528576
494 Ga0070682_100018885
495 Ga0068868_100155391
496 Ga0070660_100175523
497 Ga0070689_100048341
498 Ga0070689_100208322
499 Ga0070687_100356980
500 Ga0070668_100273862
501 Ga0070675_100032400
502 Ga0070675_100095884
503 Ga0070675_100105024
504 Ga0070671_100006841
505 Ga0070671_100053216
506 Ga0070671_100154645
507 Ga0070674_100779571
508 Ga0070673_100139886
509 Ga0070688_100019016
510 Ga0070688_100030742
511 Ga0070688_100032736
512 Ga0070688_100082089
513 Ga0070659_100020367
514 Ga0070659_100255596
515 Ga0070667_100064180
516 Ga0070667_100096427
517 Ga0070714_100177624
518 Ga0070714_100680977
519 Ga0070713_100076680
520 Ga0070713_100101107
521 Ga0070713_100265367
522 Ga0070710_10024919
523 Ga0070710_10096737
524 Ga0070710_10157023
525 Ga0070710_10269787
526 Ga0070711_100041045
527 Ga0070711_100196457
528 Ga0070711_100257920
529 Ga0070705_100404626
530 Ga0070708_100036175
531 Ga0070708_100088296
532 Ga0070708_100163286
533 Ga0070708_100414286
534 Ga0070678_100101007
535 Ga0070678_100253350
536 Ga0070662_100023146
537 Ga0070681_10021483
538 Ga0070681_10053562
539 Ga0070681_10149780
540 Ga0070681_10362928
541 Ga0070706_100063450
542 Ga0070706_100123451
543 Ga0070706_100620724
544 Ga0070707_100025696
545 Ga0070707_100402727
546 Ga0070707_100405807
547 Ga0070698_100193160
548 Ga0070699_100253819
549 Ga0070699_100271258
550 Ga0070684_100010153
551 Ga0070684_100209934
552 Ga0070684_100290451
553 Ga0070697_100250494
554 Ga0070697_100253489
555 Ga0070697_100318156
556 Ga0070672_100097598
557 Ga0070695_100279200
558 Ga0070696_100215831
559 Ga0070693_100027137
560 Ga0070665_100038468
561 Ga0070665_100069163
562 Ga0070665_100177689
563 Ga0070704_100059532
564 Ga0068855_100101883
565 Ga0070664_100245596
566 Ga0070664_100255524
567 Ga0068854_100056759
568 Ga0068856_100103004
569 Ga0068856_100314830
570 Ga0068856_100323325
571 Ga0068852_100019178
572 Ga0068852_101116382
573 Ga0068859_100054013
574 Ga0068864_100306669
575 Ga0068863_100036451
576 Ga0068858_100077681
577 Ga0068858_100174064
578 Ga0068858_100876186
579 Ga0068860_100255860
580 Ga0068860_101171654
581 Ga0068862_100072887
582 Ga0068862_100225169
583 Ga0081455_10000222
584 Ga0081455_10003202
585 Ga0081455_10012138
586 Ga0081455_10021949
587 Ga0081455_10065789
588 Ga0081455_10070023
589 Ga0081455_10125919
590 Ga0081540_1109111
591 Ga0081539_10018638
592 Ga0070717_10020137
593 Ga0070717_10086796
594 Ga0070717_10130543
595 Ga0070717_10278668
596 Ga0070717_10710849
597 Ga0070717_10773447
598 Ga0070715_10184929
599 Ga0070716_100018585
600 Ga0070716_100150952
601 Ga0070712_100015830
602 Ga0070712_100046232
603 Ga0070712_100101609
604 Ga0070712_100222558
605 Ga0070712_100223960
606 Ga0070712_100295676
607 Ga0070712_100326652
608 Ga0070712_100600380
609 Ga0068871_100067617
610 Ga0075428_100162815
611 Ga0075431_100310533
612 Ga0075433_10750419
613 Ga0075434_100773660
614 Ga0097620_100054013
615 Ga0075435_100154769
616 Ga0099794_10231754
617 Ga0111539_10820148
618 Ga0105245_10038487
619 Ga0105245_10238945
620 Ga0105245_10409230
621 Ga0105245_10684649
622 Ga0105247_10019357
623 Ga0105247_10074227
624 Ga0114129_10043580
625 Ga0114129_10241718
626 Ga0114129_11539716
627 Ga0105243_10382808
628 Ga0105243_10456119
629 Ga0105242_10077566
630 Ga0105242_10336759
631 Ga0105242_10339531
632 Ga0105242_11038145
633 Ga0105238_10037034
634 Ga0105238_10037640
635 Ga0105249_10128970
636 Ga0105249_10847435
637 Ga0099796_10052564
638 Ga0099796_10069445
639 Ga0105239_10068227
640 Ga0105239_10098211
641 Ga0105239_10213428
642 Ga0105239_10478583
643 Ga0105246_10020775
644 Ga0157373_10139278
645 Ga0157373_10179347
646 Ga0157369_10090275
647 Ga0157369_10198848
648 Ga0157369_10309032
649 Ga0157369_10441237
650 Ga0157374_10067766
651 Ga0157374_10105042
652 Ga0157374_10115969
653 Ga0157374_10117759
654 Ga0157374_10144097
655 Ga0157374_10509069
656 Ga0157378_10025823
657 Ga0157378_10109370
658 Ga0157378_10183745
659 Ga0163162_10042427
660 Ga0163162_10230855
661 Ga0163162_10565849
662 Ga0163162_11065060
663 Ga0157372_10164909
664 Ga0157372_10323300
665 Ga0157372_11112093
666 Ga0157375_10006955
667 Ga0157375_10022271
668 Ga0157375_10062453
669 Ga0157375_10175460
670 Ga0163163_10512299
671 Ga0157377_10021639
672 Ga0157379_10013180
673 Ga0157379_10069198
674 Ga0157376_10109107
675 Ga0182006_1016592
676 Ga0182005_1005625
677 Ga0163161_10106230
678 Ga0163161_10339482
679 Ga0163161_10371971
680 Ga0207697_10005198
681 Ga0207697_10008187
682 Ga0207697_10012046
683 Ga0207697_10021321
684 Ga0207692_10083425
685 Ga0207692_10127586
686 Ga0207710_10019295
687 Ga0207688_10042540
688 Ga0207680_10343621
689 Ga0207685_10237292
690 Ga0207645_10007098
691 Ga0207645_10039404
692 Ga0207645_10130565
693 Ga0207684_10009651
694 Ga0207707_10040156
695 Ga0207707_10092893
696 Ga0207693_10016293
697 Ga0207693_10036764
698 Ga0207693_10048488
699 Ga0207693_10060364
700 Ga0207693_10086321
701 Ga0207693_10206618
702 Ga0207693_10366483
703 Ga0207663_10003173
704 Ga0207663_10234317
705 Ga0207662_10226943
706 Ga0207657_10140573
707 Ga0207657_10189982
708 Ga0207649_10169038
709 Ga0207652_10021510
710 Ga0207646_10017603
711 Ga0207646_10393621
712 Ga0207646_10527750
713 Ga0207681_10032639
714 Ga0207694_10145403
715 Ga0207694_10243055
716 Ga0207659_10049949
717 Ga0207659_10164324
718 Ga0207659_10224362
719 Ga0207659_10304386
720 Ga0207659_10366948
721 Ga0207659_10533444
722 Ga0207700_10040265
723 Ga0207700_10149430
724 Ga0207700_10443397
725 Ga0207700_10615061
726 Ga0207700_10755334
727 Ga0207664_10024806
728 Ga0207664_10057939
729 Ga0207644_10107211
730 Ga0207690_10012215
731 Ga0207706_10008984
732 Ga0207706_10089833
733 Ga0207706_10113288
734 Ga0207709_10132863
735 Ga0207669_10009743
736 Ga0207669_10561118
737 Ga0207704_10262585
738 Ga0207665_10059281
739 Ga0207665_10089942
740 Ga0207665_10107135
741 Ga0207691_10007558
742 Ga0207689_10110764
743 Ga0207661_10014237
744 Ga0207661_10333399
745 Ga0207679_10141170
746 Ga0207679_10165464
747 Ga0207679_10204651
748 Ga0207667_10066679
749 Ga0207651_10064182
750 Ga0207651_10511708
751 Ga0207712_10218801
752 Ga0207668_10340340
753 Ga0207668_10607357
754 Ga0207658_10130649
755 Ga0207658_10200433
756 Ga0207677_10217970
757 Ga0207703_10260201
758 Ga0207639_10318109
759 Ga0207708_10055318
760 Ga0207702_10008845
761 Ga0207641_10096747
762 Ga0207683_10067450
763 Ga0268266_10138983
764 Ga0268266_10308369
765 Ga0268266_11126399
766 Ga0268265_10155422
767 Ga0268264_10748353
768 Ga0373926_0009147
769 Ga0373934_0014265
770 Ga0373944_0003211
771 Ga0373923_0004757
772 Ga0373923_0040167
773 Ga0373936_0030072
774 Ga0373945_0002769
775 Ga0373954_0044984
776 Ga0373956_0040348
777 Ga0373957_0000582
778 Ga0373943_0345809
779 Ga0373946_0044523
780 Ga0373955_0004923
781 Ga0373955_0056598
782 Ga0373931_0010532
783 Ga0373931_0416805
784 Ga0373935_0010094
785 Ga0373935_0044666
786 Ga0373935_0167006
787 Ga0373927_0027948
788 Ga0373927_0095556
789 Ga0373933_0052188
790 Ga0373933_0070496
791 Ga0373947_0016270
792 Ga0373947_0079700
793 Ga0373937_0000490
794 Ga0373937_0005156
795 Ga0373937_0010387
796 Ga0373937_0263300
797 Ga0373937_0263684
798 Ga0373925_0013621
799 Ga0373925_0025014
800 Ga0373925_0034143
801 Ga0373925_0420791
802 Ga0395899_0049354
803 Ga0395900_0062405
804 Ga0395900_0113602
805 Ga0395900_0314464
806 Ga0395898_0012151
807 Ga0395898_0234027
808 Ga0395898_0717067
809 Ga0395905_0006379
810 Ga0395901_0025796
811 Ga0395901_0036494
812 Ga0395901_0207151
813 Ga0451798_0053566
814 Ga0495592_0001184
815 Ga0495603_0049998
816 Ga0495603_0062269
817 Ga0495629_0316858
818 Ga0495629_0416200
819 Ga0495651_0000895
820 Ga0495653_0012511
821 Ga0495580_0101539
822 Ga0495639_0060117
823 Ga0495662_0012727
824 Ga0495664_0007609
825 Ga0495664_0036790
826 Ga0495594_0017031
827 Ga0495594_0023996
828 Ga0495594_0055671
829 Ga0495608_0000129
830 Ga0495618_0001726
831 Ga0495618_0144000
832 Ga0495628_0001570
833 Ga0495630_0304255
834 Ga0495666_0016940
835 Ga0495652_0004520
836 Ga0495652_0026867
837 Ga0495652_0081297
838 Ga0495665_0023523
839 Ga0495665_0201928
840 Ga0495640_0015297
841 Ga0495586_0180398
842 Ga0495587_0000354
843 Ga0495645_0000800
844 Ga0495667_0002315
845 Ga0495656_0149447
846 Ga0495634_0027037
847 Ga0495634_0232164
848 Ga0495635_0001388
849 Ga0495635_0008767
850 Ga0495657_0001374
851 Ga0495599_0000294
852 Ga0495623_0000055
853 Ga0495646_0000749
854 Ga0495646_0136883
855 Ga0495647_0019550
856 Ga0495647_0069323
857 Ga0495658_0030195
858 Ga0495658_0069406
859 Ga0495669_0046166
860 Ga0495613_0067413
861 Ga0495613_0106635
862 Ga0495624_0135693
863 Ga0495600_0014646
864 Ga0495600_0015473
865 Ga0495581_0062332
866 Ga0495581_0131641
867 Ga0495604_0001560
868 Ga0495674_0005151
869 Ga0495674_0033478
870 Ga0495680_0019769
871 Ga0495675_0000190
872 Ga0495684_0059163
873 Ga0495593_0039520
874 Ga0495602_0000445
875 Ga0495614_0176369
876 Ga0496100_0055665
877 Ga0496100_0244745
878 Ga0496101_0044728
879 Ga0496102_0034406
880 Ga0496102_0044759
881 Ga0496102_0072639
882 Ga0496102_0293414
883 Ga0496102_1308317
884 Ga0496103_0027825
885 Ga0496103_0144614
886 Ga0496103_0156755
887 Ga0496104_0010004
888 Ga0496104_0054678
889 Ga0496104_0134543
890 Ga0496105_0004757
891 Ga0496105_0009544
892 Ga0496105_0081943
893 Ga0496106_0037972
894 Ga0496106_0070257
895 Ga0496106_0136440
896 Ga0496107_0022645
897 Ga0496107_0054422
898 Ga0496108_0125528
899 Ga0496108_0176185
900 Ga0496109_0270424
901 Ga0496110_0055055
902 Ga0496110_0065084
903 Ga0496110_0761121
904 Ga0496111_0023791
905 Ga0496111_0124895
906 Ga0496111_0306101
907 Ga0496111_0420076
908 Ga0496112_0002056
909 Ga0496112_0252350
910 Ga0496112_0317788
911 Ga0496112_0327324
912 Ga0496112_0545811
913 Ga0496112_0868137
914 Ga0496113_0002197
915 Ga0496113_0101289
916 Ga0496113_0103007
917 Ga0496114_0030313
918 Ga0496115_0032563
919 Ga0496115_0343719
920 Ga0501068_0003577
921 Ga0501071_0052888
922 Ga0501073_0148314
923 Ga0501080_0134185
924 Ga0501080_0298357
925 nmdc:mga05p37_187903_c1
926 nmdc:mga0n895_697013_c1
927 nmdc:mga0n895_922464_c1
928 nmdc:mga0rr50_495088_c1
929 Ga0495601_0000677
930 Ga0495601_0022598
931 Ga0495612_0002567
932 Ga0495612_0005714
933 Ga0495595_0000369
934 Ga0495619_0002831
935 Ga0495619_0003693
936 Ga0500618_019254
937 Ga0500637_0001526
938 Ga0501082_0041323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qc6-assembly1.cif.gz_AK ovine respiratory complex i frc open class 1 0.3839 65 187
7tut-assembly1.cif.gz_6 structure of the rabbit 80s ribosome stalled on a 4-tmd rhodopsin intermediate in complex with the multipass translocon 0.3676 22 212
6n1l-assembly1.cif.gz_A the complement inhibitory domain of b. burgdorferi bbk32. 0.3654 69 215
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.3573 69 212
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.35 69 216
ID Description Score Start End Superfamily
af_A0A1D6KFG2_852_1087_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4565 103 213 1.10.510.10
af_A0A143ZVX7_1_298_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3981 28 216 1.20.1070.10
af_P76236_84_321_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3944 24 218 1.20.1070.10
af_Q0WPS2_24_230_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3636 69 223 1.20.120.1770
af_P76236_84_321_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3567 24 218 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2V5L8U2-F1-model_v4 Metal-dependent hydrolase 0.9175 1 224 GO:0016020
AF-A0A2V5S5B2-F1-model_v4 Metal-dependent hydrolase 0.913 1 200 GO:0016020
AF-A0A2V5SSZ3-F1-model_v4 Metal-dependent hydrolase 0.9116 1 222 GO:0016020
AF-A0A2V5SSZ3-F1-model_v4 Metal-dependent hydrolase 0.8997 1 222 GO:0016020
AF-A0A2M7RM10-F1-model_v4 Permease 0.8963 1 212 GO:0016020

Map