F450223

General Info

Members Datasets Scaffolds Average Seq Length
469 243 938 322

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10635109|Ga0111539_106351091
Length 356
Sequence MRGRVEIRGFLMRRGVFVTALVVAVGITIAGVGGAAKTGPGTHVGSGSVFVPNPVQSLGDETLTDQKDADSAVPAAAYHTVTLTNLDGSGFLRGDYANVYSSTGNLAFSPTNTFAYTRHQDEFEQVMAYYWMTEAQKYIHSLGFGVTRRAINNEPQDARVDQWGQDNSFETDHPKDELRFGKGGVDDAEDAEVILHEYGHAIHDSQNFSFASEEAGAISEGFGDYWAVTVSDVVAKSLGVPEKEPLPCVMDWDATFYTSTVPHCLRRLDTNLHYPEDLDGEVHDDGRIWSRALWDIRLALGNVKADTIILQGSFDFPGTTMTDLANRTVAAAKQLYPGKPSVAAAVQKAFADRGIL

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
169 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 11.51
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10635109 3300009094 Bacteria 1243
2 JGI25407J50210_10003226 3300003373 Bacteria 3882
3 JGI25407J50210_10017459 3300003373 Bacteria 1863
4 JGI25404J52841_10019978 3300003659 Bacteria 1451
5 Ga0070658_10019997 3300005327 Bacteria 5362
6 Ga0070658_10047563 3300005327 Bacteria 3472
7 Ga0070683_100034973 3300005329 Bacteria 4592
8 Ga0070680_100020625 3300005336 Bacteria 5232
9 Ga0070680_100037492 3300005336 Bacteria 3917
10 Ga0070680_100352011 3300005336 Bacteria 1252
11 Ga0070682_100218250 3300005337 Bacteria 1355
12 Ga0068868_100170696 3300005338 Bacteria 1800
13 Ga0070660_100001150 3300005339 Bacteria 17854
14 Ga0070660_100011629 3300005339 Bacteria 6264
15 Ga0070660_100128103 3300005339 Bacteria 2029
16 Ga0070691_10045880 3300005341 Bacteria 2074
17 Ga0070691_10119714 3300005341 Unclassified 1324
18 Ga0070661_100012710 3300005344 Bacteria 5891
19 Ga0070661_100077682 3300005344 Bacteria 2448
20 Ga0070668_100030483 3300005347 Bacteria 4100
21 Ga0070669_100122927 3300005353 Bacteria 1983
22 Ga0070671_100145915 3300005355 Bacteria 1997
23 Ga0070671_100259501 3300005355 Bacteria 1477
24 Ga0070674_100068046 3300005356 Bacteria 2507
25 Ga0070674_100187523 3300005356 Bacteria 1588
26 Ga0070673_100048222 3300005364 Bacteria 3319
27 Ga0070688_100005746 3300005365 Bacteria 6557
28 Ga0070659_100156328 3300005366 Bacteria 1862
29 Ga0070703_10064421 3300005406 Bacteria 1208
30 Ga0070709_10004763 3300005434 Bacteria 7329
31 Ga0070709_10131468 3300005434 Bacteria 1709
32 Ga0070714_100277380 3300005435 Bacteria 1556
33 Ga0070713_100299366 3300005436 Bacteria 1480
34 Ga0070710_10018748 3300005437 Bacteria 3565
35 Ga0070710_10034158 3300005437 Bacteria 2765
36 Ga0070710_10057008 3300005437 Bacteria 2212
37 Ga0070701_10002385 3300005438 Bacteria 7221
38 Ga0070701_10002961 3300005438 Bacteria 6634
39 Ga0070705_100012538 3300005440 Bacteria 4312
40 Ga0070700_100013356 3300005441 Bacteria 4611
41 Ga0070694_100043881 3300005444 Bacteria 2991
42 Ga0070694_100325831 3300005444 Bacteria 1183
43 Ga0070663_100182875 3300005455 Bacteria 1627
44 Ga0070678_100007852 3300005456 Bacteria 6349
45 Ga0070678_100265129 3300005456 Bacteria 1446
46 Ga0070662_100040497 3300005457 Bacteria 3318
47 Ga0070662_100042956 3300005457 Bacteria 3231
48 Ga0070662_100089621 3300005457 Bacteria 2307
49 Ga0070681_10036797 3300005458 Bacteria 4914
50 Ga0070681_10098392 3300005458 Bacteria 2871
51 Ga0070681_10230762 3300005458 Bacteria 1765
52 Ga0070681_10328537 3300005458 Bacteria 1439
53 Ga0068867_100057457 3300005459 Bacteria 2882
54 Ga0070706_100105417 3300005467 Bacteria 2623
55 Ga0070706_100167758 3300005467 Bacteria 2050
56 Ga0070698_100002382 3300005471 Bacteria 20736
57 Ga0070698_100012645 3300005471 Bacteria 8937
58 Ga0070698_100125795 3300005471 Bacteria 2521
59 Ga0070698_100402597 3300005471 Bacteria 1302
60 Ga0070679_100019680 3300005530 Bacteria 6569
61 Ga0070679_100047536 3300005530 Bacteria 4276
62 Ga0070679_100067577 3300005530 Bacteria 3564
63 Ga0070679_100114974 3300005530 Bacteria 2676
64 Ga0070684_100008733 3300005535 Bacteria 7943
65 Ga0068853_100094378 3300005539 Bacteria 2636
66 Ga0068853_100125077 3300005539 Bacteria 2296
67 Ga0068853_100130225 3300005539 Bacteria 2252
68 Ga0070695_100086396 3300005545 Bacteria 2084
69 Ga0070696_100154489 3300005546 Bacteria 1687
70 Ga0070693_100067727 3300005547 Bacteria 2093
71 Ga0070704_100074554 3300005549 Bacteria 2475
72 Ga0068855_100017430 3300005563 Bacteria 8639
73 Ga0068855_100067085 3300005563 Bacteria 4182
74 Ga0068855_100164783 3300005563 Bacteria 2513
75 Ga0068855_100227546 3300005563 Bacteria 2089
76 Ga0068855_100275380 3300005563 Bacteria 1870
77 Ga0070664_100161997 3300005564 Bacteria 1979
78 Ga0068857_100119541 3300005577 Bacteria 2372
79 Ga0068857_100240776 3300005577 Bacteria 1656
80 Ga0068854_100098046 3300005578 Bacteria 2192
81 Ga0068856_100041147 3300005614 Bacteria 4540
82 Ga0068856_100238134 3300005614 Bacteria 1835
83 Ga0068856_100341791 3300005614 Bacteria 1515
84 Ga0070702_100038879 3300005615 Bacteria 2652
85 Ga0068852_100081798 3300005616 Bacteria 2868
86 Ga0068866_10002203 3300005718 Bacteria 8111
87 Ga0068861_100008592 3300005719 Bacteria 7026
88 Ga0068861_100065032 3300005719 Bacteria 2808
89 Ga0068861_100109108 3300005719 Bacteria 2215
90 Ga0068861_100143158 3300005719 Bacteria 1954
91 Ga0068858_100098030 3300005842 Bacteria 2733
92 Ga0068860_100487152 3300005843 Bacteria 1230
93 Ga0068862_100089425 3300005844 Bacteria 2680
94 Ga0068862_100213678 3300005844 Bacteria 1743
95 Ga0081455_10007290 3300005937 Bacteria 11672
96 Ga0081455_10007402 3300005937 Bacteria 11567
97 Ga0081455_10007935 3300005937 Bacteria 11107
98 Ga0081455_10024118 3300005937 Bacteria 5642
99 Ga0081455_10053084 3300005937 Bacteria 3465
100 Ga0081455_10096043 3300005937 Bacteria 2391
101 Ga0081455_10101309 3300005937 Bacteria 2312
102 Ga0081455_10115741 3300005937 Bacteria 2122
103 Ga0081538_10002080 3300005981 Bacteria 19938
104 Ga0081538_10004862 3300005981 Bacteria 12237
105 Ga0081538_10035747 3300005981 Bacteria 3257
106 Ga0081538_10044229 3300005981 Bacteria 2781
107 Ga0081540_1017311 3300005983 Bacteria 4466
108 Ga0081540_1031623 3300005983 Bacteria 2906
109 Ga0081540_1079845 3300005983 Bacteria 1477
110 Ga0081539_10010925 3300005985 Bacteria 7285
111 Ga0075365_10126107 3300006038 Bacteria 1769
112 Ga0075363_100046207 3300006048 Bacteria 2310
113 Ga0075432_10024605 3300006058 Bacteria 2064
114 Ga0070715_10002850 3300006163 Bacteria 5390
115 Ga0070716_100067785 3300006173 Bacteria 2085
116 Ga0070712_100041049 3300006175 Bacteria 3174
117 Ga0070712_100073857 3300006175 Bacteria 2447
118 Ga0075427_10001601 3300006194 Bacteria 2927
119 Ga0097621_100017707 3300006237 Bacteria 5419
120 Ga0075428_100121652 3300006844 Bacteria 2842
121 Ga0075430_100092640 3300006846 Bacteria 2526
122 Ga0075431_100024717 3300006847 Bacteria 6160
123 Ga0075433_10000289 3300006852 Bacteria 30082
124 Ga0075433_10014492 3300006852 Bacteria 6442
125 Ga0075433_10075803 3300006852 Bacteria 2961
126 Ga0075434_100000777 3300006871 Bacteria 25288
127 Ga0075434_100001250 3300006871 Bacteria 21174
128 Ga0075434_100126371 3300006871 Bacteria 2574
129 Ga0075434_100176571 3300006871 Bacteria 2156
130 Ga0075434_100192549 3300006871 Bacteria 2060
131 Ga0075429_100017851 3300006880 Bacteria 6136
132 Ga0068865_100201129 3300006881 Bacteria 1546
133 Ga0075436_100004064 3300006914 Bacteria 10039
134 Ga0075436_100089342 3300006914 Bacteria 2141
135 Ga0075436_100098645 3300006914 Bacteria 2033
136 Ga0075435_100005837 3300007076 Bacteria 8659
137 Ga0075435_100006915 3300007076 Bacteria 8048
138 Ga0075435_100022836 3300007076 Bacteria 4830
139 Ga0075435_100105532 3300007076 Bacteria 2339
140 Ga0075435_100214411 3300007076 Bacteria 1634
141 Ga0075435_100353055 3300007076 Unclassified 1260
142 Ga0105240_10037012 3300009093 Bacteria 6273
143 Ga0105240_10113445 3300009093 Bacteria 3275
144 Ga0105240_10266912 3300009093 Bacteria 1972
145 Ga0111539_10005622 3300009094 Bacteria 16216
146 Ga0111539_10018260 3300009094 Bacteria 8688
147 Ga0105245_10148374 3300009098 Bacteria 2215
148 Ga0105245_10154439 3300009098 Bacteria 2173
149 Ga0105245_10220832 3300009098 Bacteria 1828
150 Ga0105245_10328964 3300009098 Bacteria 1508
151 Ga0114129_10032275 3300009147 Bacteria 7400
152 Ga0114129_10064027 3300009147 Bacteria 5131
153 Ga0114129_10282840 3300009147 Bacteria 2216
154 Ga0114129_10339793 3300009147 Bacteria 1992
155 Ga0114129_10356531 3300009147 Bacteria 1936
156 Ga0105243_10006389 3300009148 Bacteria 9104
157 Ga0105243_10354343 3300009148 Bacteria 1349
158 Ga0105241_10043887 3300009174 Bacteria 3386
159 Ga0105241_10281264 3300009174 Bacteria 1421
160 Ga0105241_10329926 3300009174 Bacteria 1318
161 Ga0105242_10082430 3300009176 Bacteria 2692
162 Ga0105248_10313705 3300009177 Bacteria 1766
163 Ga0105237_10039422 3300009545 Bacteria 4769
164 Ga0105237_10166216 3300009545 Bacteria 2205
165 Ga0105238_10013075 3300009551 Bacteria 8374
166 Ga0105249_10005795 3300009553 Bacteria 10686
167 Ga0105249_10081165 3300009553 Bacteria 3014
168 Ga0105239_10171462 3300010375 Bacteria 2426
169 Ga0105239_10389414 3300010375 Bacteria 1576
170 Ga0105239_10412954 3300010375 Bacteria 1528
171 Ga0105246_10399423 3300011119 Bacteria 1141
172 Ga0157371_10072322 3300013102 Bacteria 2442
173 Ga0157371_10195400 3300013102 Bacteria 1449
174 Ga0157370_10142123 3300013104 Bacteria 2236
175 Ga0157370_10252573 3300013104 Bacteria 1631
176 Ga0157369_10353961 3300013105 Bacteria 1525
177 Ga0157374_10011794 3300013296 Bacteria 7584
178 Ga0157378_10164232 3300013297 Bacteria 2079
179 Ga0163162_10013061 3300013306 Bacteria 8105
180 Ga0163162_10476130 3300013306 Bacteria 1380
181 Ga0157372_10031631 3300013307 Bacteria 5794
182 Ga0157372_10223373 3300013307 Bacteria 2183
183 Ga0157375_10020360 3300013308 Bacteria 6059
184 Ga0157375_10040295 3300013308 Bacteria 4502
185 Ga0157375_10221950 3300013308 Bacteria 2048
186 Ga0157380_10079559 3300014326 Bacteria 2677
187 Ga0157380_10094190 3300014326 Bacteria 2478
188 Ga0157377_10158130 3300014745 Bacteria 1407
189 Ga0157379_10101318 3300014968 Bacteria 2585
190 Ga0157376_10074308 3300014969 Bacteria 2898
191 Ga0163161_10057458 3300017792 Bacteria 2827
192 Ga0163161_10265699 3300017792 Bacteria 1341
193 Ga0197907_10739812 3300020069 Bacteria 1443
194 Ga0197907_11179901 3300020069 Bacteria 3288
195 Ga0206356_10884815 3300020070 Bacteria 1300
196 Ga0206354_10892430 3300020081 Bacteria 2095
197 Ga0206353_10697922 3300020082 Bacteria 3743
198 Ga0206353_11785927 3300020082 Bacteria 1897
199 Ga0207642_10078640 3300025899 Bacteria 1594
200 Ga0207688_10074151 3300025901 Bacteria 1935
201 Ga0207680_10088354 3300025903 Bacteria 1965
202 Ga0207685_10001568 3300025905 Bacteria 4870
203 Ga0207699_10000955 3300025906 Bacteria 13781
204 Ga0207699_10040037 3300025906 Bacteria 2698
205 Ga0207705_10027274 3300025909 Bacteria 4073
206 Ga0207705_10113013 3300025909 Bacteria 2008
207 Ga0207707_10001873 3300025912 Bacteria 19222
208 Ga0207707_10033462 3300025912 Bacteria 4499
209 Ga0207707_10054964 3300025912 Bacteria 3464
210 Ga0207707_10188272 3300025912 Bacteria 1801
211 Ga0207695_10181902 3300025913 Bacteria 2023
212 Ga0207695_10264204 3300025913 Bacteria 1618
213 Ga0207671_10194036 3300025914 Bacteria 1584
214 Ga0207693_10051288 3300025915 Bacteria 3238
215 Ga0207693_10089995 3300025915 Bacteria 2405
216 Ga0207693_10175541 3300025915 Bacteria 1686
217 Ga0207663_10002455 3300025916 Bacteria 8919
218 Ga0207660_10005664 3300025917 Bacteria 8104
219 Ga0207660_10030248 3300025917 Bacteria 3722
220 Ga0207660_10082012 3300025917 Bacteria 2371
221 Ga0207660_10149087 3300025917 Bacteria 1796
222 Ga0207662_10114121 3300025918 Bacteria 1687
223 Ga0207657_10000073 3300025919 Bacteria 93299
224 Ga0207657_10004118 3300025919 Bacteria 15438
225 Ga0207657_10010451 3300025919 Bacteria 9260
226 Ga0207657_10015553 3300025919 Bacteria 7369
227 Ga0207657_10069377 3300025919 Bacteria 2991
228 Ga0207657_10139815 3300025919 Bacteria 1979
229 Ga0207649_10024540 3300025920 Bacteria 3506
230 Ga0207649_10040938 3300025920 Bacteria 2819
231 Ga0207652_10046292 3300025921 Bacteria 3711
232 Ga0207652_10108743 3300025921 Bacteria 2457
233 Ga0207694_10152503 3300025924 Bacteria 1862
234 Ga0207687_10029801 3300025927 Bacteria 3673
235 Ga0207687_10068197 3300025927 Bacteria 2533
236 Ga0207687_10203457 3300025927 Bacteria 1549
237 Ga0207700_10077856 3300025928 Bacteria 2577
238 Ga0207700_10098860 3300025928 Bacteria 2322
239 Ga0207664_10001086 3300025929 Bacteria 18131
240 Ga0207690_10134924 3300025932 Bacteria 1811
241 Ga0207690_10193802 3300025932 Bacteria 1538
242 Ga0207706_10005233 3300025933 Bacteria 12112
243 Ga0207706_10005602 3300025933 Bacteria 11698
244 Ga0207706_10116149 3300025933 Bacteria 2353
245 Ga0207686_10014320 3300025934 Bacteria 4411
246 Ga0207669_10005652 3300025937 Bacteria 5638
247 Ga0207669_10140514 3300025937 Bacteria 1675
248 Ga0207704_10013907 3300025938 Bacteria 4047
249 Ga0207665_10004341 3300025939 Bacteria 9417
250 Ga0207665_10007299 3300025939 Bacteria 7312
251 Ga0207691_10001877 3300025940 Bacteria 20548
252 Ga0207667_10078515 3300025949 Bacteria 3421
253 Ga0207667_10110181 3300025949 Bacteria 2840
254 Ga0207667_10468505 3300025949 Bacteria 1279
255 Ga0207712_10193299 3300025961 Bacteria 1608
256 Ga0207668_10295450 3300025972 Bacteria 1335
257 Ga0207640_10059404 3300025981 Bacteria 2523
258 Ga0207677_10083027 3300026023 Bacteria 2305
259 Ga0207677_10400140 3300026023 Bacteria 1164
260 Ga0207703_10073215 3300026035 Bacteria 2834
261 Ga0207639_10014805 3300026041 Bacteria 5493
262 Ga0207678_10059878 3300026067 Bacteria 3276
263 Ga0207708_10097343 3300026075 Bacteria 2274
264 Ga0207702_10035094 3300026078 Bacteria 4193
265 Ga0207702_10175448 3300026078 Bacteria 1969
266 Ga0207648_10001473 3300026089 Bacteria 25919
267 Ga0207648_10033914 3300026089 Bacteria 4501
268 Ga0207674_10008792 3300026116 Bacteria 11627
269 Ga0207674_10103494 3300026116 Bacteria 2826
270 Ga0207675_100001015 3300026118 Bacteria 27803
271 Ga0207675_100002032 3300026118 Bacteria 20174
272 Ga0207675_100018569 3300026118 Bacteria 6488
273 Ga0207683_10000041 3300026121 Bacteria 94017
274 Ga0207683_10061592 3300026121 Bacteria 3303
275 Ga0207683_10172788 3300026121 Bacteria 1958
276 Ga0207683_10326220 3300026121 Bacteria 1407
277 Ga0207698_10103699 3300026142 Bacteria 2364
278 Ga0207428_10003150 3300027907 Bacteria 16165
279 Ga0207428_10007875 3300027907 Bacteria 9688
280 Ga0268266_10093328 3300028379 Bacteria 2641
281 Ga0307416_100158444 3300032002 Bacteria 2088
282 Ga0307415_100155389 3300032126 Bacteria 1766
283 Ga0373949_0010708 3300035090 Bacteria 2012
284 Ga0373932_0004125 3300035112 Bacteria 3453
285 Ga0373932_0010185 3300035112 Bacteria 2272
286 Ga0373939_0007793 3300035114 Bacteria 2608
287 Ga0373943_0077986 3300035170 Bacteria 1693
288 Ga0373931_0031340 3300035691 Bacteria 2744
289 Ga0373935_0100144 3300035692 Bacteria 1909
290 Ga0373927_0168383 3300035695 Bacteria 1436
291 Ga0373947_0162851 3300035725 Bacteria 1444
292 Ga0373925_0242280 3300037068 Bacteria 1444
293 Ga0395899_0002477 3300037312 Bacteria 14979
294 Ga0395899_0024001 3300037312 Bacteria 4613
295 Ga0395899_0036099 3300037312 Bacteria 3709
296 Ga0395900_0003203 3300037418 Bacteria 17718
297 Ga0395900_0020260 3300037418 Bacteria 6787
298 Ga0395900_0065158 3300037418 Bacteria 3742
299 Ga0395900_0402385 3300037418 Bacteria 1333
300 Ga0395900_0598924 3300037418 Bacteria 1043
301 Ga0395898_0006664 3300037466 Bacteria 12316
302 Ga0395898_0014301 3300037466 Bacteria 8156
303 Ga0395898_0036511 3300037466 Bacteria 4879
304 Ga0395898_0078524 3300037466 Bacteria 3185
305 Ga0395898_0393624 3300037466 Bacteria 1321
306 Ga0395905_0000568 3300037471 Bacteria 50013
307 Ga0395905_0053423 3300037471 Bacteria 3781
308 Ga0395901_0006480 3300038443 Bacteria 11848
309 Ga0395901_0119540 3300038443 Bacteria 2769
310 Ga0395901_0298004 3300038443 Bacteria 1672
311 Ga0395901_0497778 3300038443 Bacteria 1241
312 Ga0439453_0006518 3300041408 Bacteria 1820
313 Ga0439448_0001673 3300042005 Bacteria 5819
314 Ga0439451_008618 3300042009 Bacteria 2067
315 Ga0439455_0018985 3300042012 Bacteria 1617
316 Ga0450888_000138 3300042126 Bacteria 6094
317 Ga0439459_0010409 3300042438 Bacteria 1622
318 Ga0439460_0016772 3300042461 Bacteria 1955
319 Ga0466963_0017610 3300044694 Bacteria 4456
320 Ga0466963_0189730 3300044694 Bacteria 1436
321 Ga0466963_0248398 3300044694 Bacteria 1248
322 Ga0466964_0012228 3300044706 Bacteria 3247
323 Ga0466964_0014353 3300044706 Bacteria 3012
324 Ga0451576_0014317 3300045051 Bacteria 8834
325 Ga0466967_0025277 3300045976 Bacteria 4895
326 Ga0466967_0037211 3300045976 Bacteria 4162
327 Ga0466967_0056070 3300045976 Bacteria 3473
328 Ga0495580_0290608 3300046472 Bacteria 1114
329 Ga0495664_0155976 3300046477 Bacteria 1385
330 Ga0495664_0158742 3300046477 Bacteria 1372
331 Ga0495584_0067292 3300046491 Bacteria 1801
332 Ga0495585_0117186 3300046492 Bacteria 1412
333 Ga0495594_0071472 3300046499 Bacteria 1930
334 Ga0495596_0038393 3300046500 Bacteria 1893
335 Ga0495596_0092252 3300046500 Bacteria 1176
336 Ga0495616_0066832 3300046513 Bacteria 1749
337 Ga0495631_0121604 3300046518 Bacteria 1123
338 Ga0495631_0154754 3300046518 Bacteria 984
339 Ga0495644_0029520 3300046523 Bacteria 2072
340 Ga0495598_0023997 3300046537 Bacteria 1649
341 Ga0495656_0088062 3300046615 Bacteria 1415
342 Ga0495670_0122056 3300046691 Bacteria 1354
343 Ga0495589_0136351 3300046794 Bacteria 1177
344 Ga0495581_0002130 3300047315 Bacteria 11164
345 Ga0495581_0097555 3300047315 Bacteria 1707
346 Ga0495676_0011598 3300047321 Bacteria 7952
347 Ga0495676_0162793 3300047321 Bacteria 1577
348 Ga0496100_0011130 3300048903 Bacteria 5109
349 Ga0496100_0084426 3300048903 Bacteria 2152
350 Ga0496100_0113062 3300048903 Bacteria 1889
351 Ga0496100_0143697 3300048903 Bacteria 1694
352 Ga0496101_0001478 3300048904 Bacteria 14045
353 Ga0496101_0031930 3300048904 Bacteria 3704
354 Ga0496101_0077656 3300048904 Bacteria 2447
355 Ga0496101_0134895 3300048904 Bacteria 1877
356 Ga0496101_0155911 3300048904 Bacteria 1749
357 Ga0496101_0168256 3300048904 Bacteria 1683
358 Ga0496102_0275913 3300048905 Bacteria 1584
359 Ga0496102_0417607 3300048905 Bacteria 1260
360 Ga0496103_0002527 3300048906 Bacteria 11463
361 Ga0496103_0033421 3300048906 Bacteria 3142
362 Ga0496103_0049007 3300048906 Bacteria 2612
363 Ga0496103_0096228 3300048906 Bacteria 1871
364 Ga0496104_0002684 3300048907 Bacteria 15318
365 Ga0496104_0018322 3300048907 Bacteria 6387
366 Ga0496104_0020305 3300048907 Bacteria 6088
367 Ga0496104_0260701 3300048907 Bacteria 1646
368 Ga0496104_0299811 3300048907 Bacteria 1519
369 Ga0496105_0002686 3300048908 Bacteria 12962
370 Ga0496105_0032959 3300048908 Bacteria 4253
371 Ga0496105_0033259 3300048908 Bacteria 4232
372 Ga0496106_0050181 3300048909 Bacteria 3144
373 Ga0496106_0331779 3300048909 Bacteria 1221
374 Ga0496107_0039137 3300048910 Bacteria 3401
375 Ga0496107_0041491 3300048910 Bacteria 3304
376 Ga0496107_0235789 3300048910 Bacteria 1361
377 Ga0496108_0003002 3300048911 Bacteria 13560
378 Ga0496108_0030976 3300048911 Bacteria 4434
379 Ga0496109_0005124 3300048912 Bacteria 10941
380 Ga0496109_0050483 3300048912 Bacteria 3789
381 Ga0496109_0145918 3300048912 Bacteria 2214
382 Ga0496109_0489480 3300048912 Bacteria 1161
383 Ga0496110_0003512 3300048913 Bacteria 12032
384 Ga0496110_0027297 3300048913 Bacteria 4893
385 Ga0496111_0006286 3300048914 Bacteria 7703
386 Ga0496112_0000720 3300048915 Bacteria 22965
387 Ga0496112_0021075 3300048915 Bacteria 6191
388 Ga0496112_0022442 3300048915 Bacteria 6015
389 Ga0496112_0045877 3300048915 Bacteria 4284
390 Ga0496113_0006401 3300048916 Bacteria 7458
391 Ga0496113_0044795 3300048916 Bacteria 3279
392 Ga0496113_0187158 3300048916 Bacteria 1643
393 Ga0496114_0005832 3300048917 Bacteria 9671
394 Ga0496114_0014884 3300048917 Bacteria 6252
395 Ga0496114_0022461 3300048917 Bacteria 5143
396 Ga0496114_0023746 3300048917 Bacteria 5004
397 Ga0496114_0035825 3300048917 Bacteria 4099
398 Ga0496114_0049163 3300048917 Bacteria 3508
399 Ga0496114_0298780 3300048917 Bacteria 1421
400 Ga0496115_0036490 3300048918 Bacteria 3892
401 Ga0496115_0052761 3300048918 Bacteria 3262
402 Ga0501031_0039455 3300049568 Bacteria 3081
403 Ga0501031_0041179 3300049568 Bacteria 3016
404 Ga0501032_0050085 3300049569 Bacteria 2817
405 Ga0501032_0162669 3300049569 Bacteria 1465
406 Ga0501033_0040180 3300049570 Bacteria 3493
407 Ga0501036_0043485 3300049572 Bacteria 3805
408 Ga0501037_0018290 3300049573 Bacteria 5163
409 Ga0501038_0008236 3300049574 Bacteria 9596
410 Ga0501038_0045494 3300049574 Bacteria 3811
411 Ga0501039_0054638 3300049575 Bacteria 3091
412 Ga0501040_0000533 3300049576 Bacteria 22972
413 Ga0501040_0020317 3300049576 Bacteria 4424
414 Ga0501041_0001115 3300049577 Bacteria 14737
415 Ga0501042_0002592 3300049578 Bacteria 11122
416 Ga0501046_0000268 3300049580 Bacteria 53036
417 Ga0501048_0000869 3300049582 Bacteria 22293
418 Ga0501048_0170640 3300049582 Bacteria 1541
419 Ga0501067_0132851 3300049583 Bacteria 1385
420 Ga0501068_0026185 3300049584 Bacteria 3435
421 Ga0501071_0014828 3300049587 Bacteria 5338
422 Ga0501071_0050166 3300049587 Bacteria 3006
423 Ga0501071_0110585 3300049587 Bacteria 2030
424 Ga0501072_0005753 3300049588 Bacteria 9440
425 Ga0501072_0296683 3300049588 Bacteria 1285
426 Ga0501074_0014233 3300049590 Bacteria 5786
427 Ga0501074_0084477 3300049590 Bacteria 2275
428 Ga0501075_0021035 3300049591 Bacteria 4753
429 Ga0501076_0000818 3300049592 Bacteria 20188
430 Ga0501077_0021503 3300049593 Bacteria 4082
431 Ga0501079_0000180 3300049741 Bacteria 35938
432 Ga0501079_0033107 3300049741 Bacteria 3975
433 Ga0501081_0197332 3300049743 Bacteria 1459
434 Ga0501083_0017240 3300049744 Bacteria 5035
435 Ga0501045_0028905 3300049824 Bacteria 4002
436 Ga0501045_0062126 3300049824 Bacteria 2740
437 nmdc:mga03n38_87546_c1 3300050490 Bacteria 1476
438 nmdc:mga0yw44_70113_c1 3300050492 Bacteria 2173
439 nmdc:mga05p37_14223_c1 3300050507 Bacteria 9556
440 nmdc:mga05p37_24523_c1 3300050507 Bacteria 7332
441 nmdc:mga05p37_383973_c1 3300050507 Bacteria 1645
442 nmdc:mga05p37_45408_c1 3300050507 Bacteria 5403
443 nmdc:mga09592_49816_c1 3300050508 Bacteria 3532
444 nmdc:mga0qj67_72070_c1 3300050509 Bacteria 2758
445 nmdc:mga06r32_224383_c1 3300050510 Bacteria 1867
446 nmdc:mga06r32_3097_c1 3300050510 Bacteria 14893
447 nmdc:mga08y16_10615_c1 3300050511 Bacteria 9663
448 nmdc:mga08y16_113497_c1 3300050511 Bacteria 2821
449 nmdc:mga08y16_2533_c1 3300050511 Bacteria 18792
450 nmdc:mga08y16_291954_c1 3300050511 Bacteria 1681
451 nmdc:mga0n895_108809_c1 3300050512 Bacteria 2787
452 nmdc:mga0n895_2198_c1 3300050512 Bacteria 15092
453 nmdc:mga0n895_2462_c1 3300050512 Bacteria 14478
454 nmdc:mga0n895_29982_c1 3300050512 Bacteria 5194
455 nmdc:mga0rr50_123917_c1 3300050513 Bacteria 2061
456 nmdc:mga0rr50_2744_c1 3300050513 Bacteria 9999
457 nmdc:mga0rr50_3266_c1 3300050513 Bacteria 9297
458 nmdc:mga08x19_37557_c1 3300050514 Bacteria 3074
459 nmdc:mga08x19_43923_c1 3300050514 Bacteria 2852
460 nmdc:mga08x19_57117_c1 3300050514 Bacteria 2521
461 nmdc:mga0a205_14618_c1 3300050515 Bacteria 7325
462 nmdc:mga0a205_2006_c1 3300050515 Bacteria 17756
463 nmdc:mga0a205_32918_c1 3300050515 Bacteria 4971
464 Ga0501084_0001556 3300054114 Bacteria 18209
465 Ga0501084_0023399 3300054114 Bacteria 5155
466 Ga0501084_0026747 3300054114 Bacteria 4818
467 Ga0501082_0002639 3300060353 Bacteria 15682
468 Ga0501082_0022274 3300060353 Bacteria 5459
469 Ga0530510_0109176 3300061734 Bacteria 2025
470 Ga0111539_10635109
471 JGI25407J50210_10003226
472 JGI25407J50210_10017459
473 JGI25404J52841_10019978
474 Ga0070658_10019997
475 Ga0070658_10047563
476 Ga0070683_100034973
477 Ga0070680_100020625
478 Ga0070680_100037492
479 Ga0070680_100352011
480 Ga0070682_100218250
481 Ga0068868_100170696
482 Ga0070660_100001150
483 Ga0070660_100011629
484 Ga0070660_100128103
485 Ga0070691_10045880
486 Ga0070691_10119714
487 Ga0070661_100012710
488 Ga0070661_100077682
489 Ga0070668_100030483
490 Ga0070669_100122927
491 Ga0070671_100145915
492 Ga0070671_100259501
493 Ga0070674_100068046
494 Ga0070674_100187523
495 Ga0070673_100048222
496 Ga0070688_100005746
497 Ga0070659_100156328
498 Ga0070703_10064421
499 Ga0070709_10004763
500 Ga0070709_10131468
501 Ga0070714_100277380
502 Ga0070713_100299366
503 Ga0070710_10018748
504 Ga0070710_10034158
505 Ga0070710_10057008
506 Ga0070701_10002385
507 Ga0070701_10002961
508 Ga0070705_100012538
509 Ga0070700_100013356
510 Ga0070694_100043881
511 Ga0070694_100325831
512 Ga0070663_100182875
513 Ga0070678_100007852
514 Ga0070678_100265129
515 Ga0070662_100040497
516 Ga0070662_100042956
517 Ga0070662_100089621
518 Ga0070681_10036797
519 Ga0070681_10098392
520 Ga0070681_10230762
521 Ga0070681_10328537
522 Ga0068867_100057457
523 Ga0070706_100105417
524 Ga0070706_100167758
525 Ga0070698_100002382
526 Ga0070698_100012645
527 Ga0070698_100125795
528 Ga0070698_100402597
529 Ga0070679_100019680
530 Ga0070679_100047536
531 Ga0070679_100067577
532 Ga0070679_100114974
533 Ga0070684_100008733
534 Ga0068853_100094378
535 Ga0068853_100125077
536 Ga0068853_100130225
537 Ga0070695_100086396
538 Ga0070696_100154489
539 Ga0070693_100067727
540 Ga0070704_100074554
541 Ga0068855_100017430
542 Ga0068855_100067085
543 Ga0068855_100164783
544 Ga0068855_100227546
545 Ga0068855_100275380
546 Ga0070664_100161997
547 Ga0068857_100119541
548 Ga0068857_100240776
549 Ga0068854_100098046
550 Ga0068856_100041147
551 Ga0068856_100238134
552 Ga0068856_100341791
553 Ga0070702_100038879
554 Ga0068852_100081798
555 Ga0068866_10002203
556 Ga0068861_100008592
557 Ga0068861_100065032
558 Ga0068861_100109108
559 Ga0068861_100143158
560 Ga0068858_100098030
561 Ga0068860_100487152
562 Ga0068862_100089425
563 Ga0068862_100213678
564 Ga0081455_10007290
565 Ga0081455_10007402
566 Ga0081455_10007935
567 Ga0081455_10024118
568 Ga0081455_10053084
569 Ga0081455_10096043
570 Ga0081455_10101309
571 Ga0081455_10115741
572 Ga0081538_10002080
573 Ga0081538_10004862
574 Ga0081538_10035747
575 Ga0081538_10044229
576 Ga0081540_1017311
577 Ga0081540_1031623
578 Ga0081540_1079845
579 Ga0081539_10010925
580 Ga0075365_10126107
581 Ga0075363_100046207
582 Ga0075432_10024605
583 Ga0070715_10002850
584 Ga0070716_100067785
585 Ga0070712_100041049
586 Ga0070712_100073857
587 Ga0075427_10001601
588 Ga0097621_100017707
589 Ga0075428_100121652
590 Ga0075430_100092640
591 Ga0075431_100024717
592 Ga0075433_10000289
593 Ga0075433_10014492
594 Ga0075433_10075803
595 Ga0075434_100000777
596 Ga0075434_100001250
597 Ga0075434_100126371
598 Ga0075434_100176571
599 Ga0075434_100192549
600 Ga0075429_100017851
601 Ga0068865_100201129
602 Ga0075436_100004064
603 Ga0075436_100089342
604 Ga0075436_100098645
605 Ga0075435_100005837
606 Ga0075435_100006915
607 Ga0075435_100022836
608 Ga0075435_100105532
609 Ga0075435_100214411
610 Ga0075435_100353055
611 Ga0105240_10037012
612 Ga0105240_10113445
613 Ga0105240_10266912
614 Ga0111539_10005622
615 Ga0111539_10018260
616 Ga0105245_10148374
617 Ga0105245_10154439
618 Ga0105245_10220832
619 Ga0105245_10328964
620 Ga0114129_10032275
621 Ga0114129_10064027
622 Ga0114129_10282840
623 Ga0114129_10339793
624 Ga0114129_10356531
625 Ga0105243_10006389
626 Ga0105243_10354343
627 Ga0105241_10043887
628 Ga0105241_10281264
629 Ga0105241_10329926
630 Ga0105242_10082430
631 Ga0105248_10313705
632 Ga0105237_10039422
633 Ga0105237_10166216
634 Ga0105238_10013075
635 Ga0105249_10005795
636 Ga0105249_10081165
637 Ga0105239_10171462
638 Ga0105239_10389414
639 Ga0105239_10412954
640 Ga0105246_10399423
641 Ga0157371_10072322
642 Ga0157371_10195400
643 Ga0157370_10142123
644 Ga0157370_10252573
645 Ga0157369_10353961
646 Ga0157374_10011794
647 Ga0157378_10164232
648 Ga0163162_10013061
649 Ga0163162_10476130
650 Ga0157372_10031631
651 Ga0157372_10223373
652 Ga0157375_10020360
653 Ga0157375_10040295
654 Ga0157375_10221950
655 Ga0157380_10079559
656 Ga0157380_10094190
657 Ga0157377_10158130
658 Ga0157379_10101318
659 Ga0157376_10074308
660 Ga0163161_10057458
661 Ga0163161_10265699
662 Ga0197907_10739812
663 Ga0197907_11179901
664 Ga0206356_10884815
665 Ga0206354_10892430
666 Ga0206353_10697922
667 Ga0206353_11785927
668 Ga0207642_10078640
669 Ga0207688_10074151
670 Ga0207680_10088354
671 Ga0207685_10001568
672 Ga0207699_10000955
673 Ga0207699_10040037
674 Ga0207705_10027274
675 Ga0207705_10113013
676 Ga0207707_10001873
677 Ga0207707_10033462
678 Ga0207707_10054964
679 Ga0207707_10188272
680 Ga0207695_10181902
681 Ga0207695_10264204
682 Ga0207671_10194036
683 Ga0207693_10051288
684 Ga0207693_10089995
685 Ga0207693_10175541
686 Ga0207663_10002455
687 Ga0207660_10005664
688 Ga0207660_10030248
689 Ga0207660_10082012
690 Ga0207660_10149087
691 Ga0207662_10114121
692 Ga0207657_10000073
693 Ga0207657_10004118
694 Ga0207657_10010451
695 Ga0207657_10015553
696 Ga0207657_10069377
697 Ga0207657_10139815
698 Ga0207649_10024540
699 Ga0207649_10040938
700 Ga0207652_10046292
701 Ga0207652_10108743
702 Ga0207694_10152503
703 Ga0207687_10029801
704 Ga0207687_10068197
705 Ga0207687_10203457
706 Ga0207700_10077856
707 Ga0207700_10098860
708 Ga0207664_10001086
709 Ga0207690_10134924
710 Ga0207690_10193802
711 Ga0207706_10005233
712 Ga0207706_10005602
713 Ga0207706_10116149
714 Ga0207686_10014320
715 Ga0207669_10005652
716 Ga0207669_10140514
717 Ga0207704_10013907
718 Ga0207665_10004341
719 Ga0207665_10007299
720 Ga0207691_10001877
721 Ga0207667_10078515
722 Ga0207667_10110181
723 Ga0207667_10468505
724 Ga0207712_10193299
725 Ga0207668_10295450
726 Ga0207640_10059404
727 Ga0207677_10083027
728 Ga0207677_10400140
729 Ga0207703_10073215
730 Ga0207639_10014805
731 Ga0207678_10059878
732 Ga0207708_10097343
733 Ga0207702_10035094
734 Ga0207702_10175448
735 Ga0207648_10001473
736 Ga0207648_10033914
737 Ga0207674_10008792
738 Ga0207674_10103494
739 Ga0207675_100001015
740 Ga0207675_100002032
741 Ga0207675_100018569
742 Ga0207683_10000041
743 Ga0207683_10061592
744 Ga0207683_10172788
745 Ga0207683_10326220
746 Ga0207698_10103699
747 Ga0207428_10003150
748 Ga0207428_10007875
749 Ga0268266_10093328
750 Ga0307416_100158444
751 Ga0307415_100155389
752 Ga0373949_0010708
753 Ga0373932_0004125
754 Ga0373932_0010185
755 Ga0373939_0007793
756 Ga0373943_0077986
757 Ga0373931_0031340
758 Ga0373935_0100144
759 Ga0373927_0168383
760 Ga0373947_0162851
761 Ga0373925_0242280
762 Ga0395899_0002477
763 Ga0395899_0024001
764 Ga0395899_0036099
765 Ga0395900_0003203
766 Ga0395900_0020260
767 Ga0395900_0065158
768 Ga0395900_0402385
769 Ga0395900_0598924
770 Ga0395898_0006664
771 Ga0395898_0014301
772 Ga0395898_0036511
773 Ga0395898_0078524
774 Ga0395898_0393624
775 Ga0395905_0000568
776 Ga0395905_0053423
777 Ga0395901_0006480
778 Ga0395901_0119540
779 Ga0395901_0298004
780 Ga0395901_0497778
781 Ga0439453_0006518
782 Ga0439448_0001673
783 Ga0439451_008618
784 Ga0439455_0018985
785 Ga0450888_000138
786 Ga0439459_0010409
787 Ga0439460_0016772
788 Ga0466963_0017610
789 Ga0466963_0189730
790 Ga0466963_0248398
791 Ga0466964_0012228
792 Ga0466964_0014353
793 Ga0451576_0014317
794 Ga0466967_0025277
795 Ga0466967_0037211
796 Ga0466967_0056070
797 Ga0495580_0290608
798 Ga0495664_0155976
799 Ga0495664_0158742
800 Ga0495584_0067292
801 Ga0495585_0117186
802 Ga0495594_0071472
803 Ga0495596_0038393
804 Ga0495596_0092252
805 Ga0495616_0066832
806 Ga0495631_0121604
807 Ga0495631_0154754
808 Ga0495644_0029520
809 Ga0495598_0023997
810 Ga0495656_0088062
811 Ga0495670_0122056
812 Ga0495589_0136351
813 Ga0495581_0002130
814 Ga0495581_0097555
815 Ga0495676_0011598
816 Ga0495676_0162793
817 Ga0496100_0011130
818 Ga0496100_0084426
819 Ga0496100_0113062
820 Ga0496100_0143697
821 Ga0496101_0001478
822 Ga0496101_0031930
823 Ga0496101_0077656
824 Ga0496101_0134895
825 Ga0496101_0155911
826 Ga0496101_0168256
827 Ga0496102_0275913
828 Ga0496102_0417607
829 Ga0496103_0002527
830 Ga0496103_0033421
831 Ga0496103_0049007
832 Ga0496103_0096228
833 Ga0496104_0002684
834 Ga0496104_0018322
835 Ga0496104_0020305
836 Ga0496104_0260701
837 Ga0496104_0299811
838 Ga0496105_0002686
839 Ga0496105_0032959
840 Ga0496105_0033259
841 Ga0496106_0050181
842 Ga0496106_0331779
843 Ga0496107_0039137
844 Ga0496107_0041491
845 Ga0496107_0235789
846 Ga0496108_0003002
847 Ga0496108_0030976
848 Ga0496109_0005124
849 Ga0496109_0050483
850 Ga0496109_0145918
851 Ga0496109_0489480
852 Ga0496110_0003512
853 Ga0496110_0027297
854 Ga0496111_0006286
855 Ga0496112_0000720
856 Ga0496112_0021075
857 Ga0496112_0022442
858 Ga0496112_0045877
859 Ga0496113_0006401
860 Ga0496113_0044795
861 Ga0496113_0187158
862 Ga0496114_0005832
863 Ga0496114_0014884
864 Ga0496114_0022461
865 Ga0496114_0023746
866 Ga0496114_0035825
867 Ga0496114_0049163
868 Ga0496114_0298780
869 Ga0496115_0036490
870 Ga0496115_0052761
871 Ga0501031_0039455
872 Ga0501031_0041179
873 Ga0501032_0050085
874 Ga0501032_0162669
875 Ga0501033_0040180
876 Ga0501036_0043485
877 Ga0501037_0018290
878 Ga0501038_0008236
879 Ga0501038_0045494
880 Ga0501039_0054638
881 Ga0501040_0000533
882 Ga0501040_0020317
883 Ga0501041_0001115
884 Ga0501042_0002592
885 Ga0501046_0000268
886 Ga0501048_0000869
887 Ga0501048_0170640
888 Ga0501067_0132851
889 Ga0501068_0026185
890 Ga0501071_0014828
891 Ga0501071_0050166
892 Ga0501071_0110585
893 Ga0501072_0005753
894 Ga0501072_0296683
895 Ga0501074_0014233
896 Ga0501074_0084477
897 Ga0501075_0021035
898 Ga0501076_0000818
899 Ga0501077_0021503
900 Ga0501079_0000180
901 Ga0501079_0033107
902 Ga0501081_0197332
903 Ga0501083_0017240
904 Ga0501045_0028905
905 Ga0501045_0062126
906 nmdc:mga03n38_87546_c1
907 nmdc:mga0yw44_70113_c1
908 nmdc:mga05p37_14223_c1
909 nmdc:mga05p37_24523_c1
910 nmdc:mga05p37_383973_c1
911 nmdc:mga05p37_45408_c1
912 nmdc:mga09592_49816_c1
913 nmdc:mga0qj67_72070_c1
914 nmdc:mga06r32_224383_c1
915 nmdc:mga06r32_3097_c1
916 nmdc:mga08y16_10615_c1
917 nmdc:mga08y16_113497_c1
918 nmdc:mga08y16_2533_c1
919 nmdc:mga08y16_291954_c1
920 nmdc:mga0n895_108809_c1
921 nmdc:mga0n895_2198_c1
922 nmdc:mga0n895_2462_c1
923 nmdc:mga0n895_29982_c1
924 nmdc:mga0rr50_123917_c1
925 nmdc:mga0rr50_2744_c1
926 nmdc:mga0rr50_3266_c1
927 nmdc:mga08x19_37557_c1
928 nmdc:mga08x19_43923_c1
929 nmdc:mga08x19_57117_c1
930 nmdc:mga0a205_14618_c1
931 nmdc:mga0a205_2006_c1
932 nmdc:mga0a205_32918_c1
933 Ga0501084_0001556
934 Ga0501084_0023399
935 Ga0501084_0026747
936 Ga0501082_0002639
937 Ga0501082_0022274
938 Ga0530510_0109176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cr4-assembly1.cif.gz_A crystal structure of recombinant lasbartif from pseudomonas aeruginosa azpae14816 0.7496 49 320
8cr7-assembly2.cif.gz_B crystal structure of recombinant lasb from pseudomonas aeruginosa pa7 0.7404 49 320
2vqx-assembly1.cif.gz_A precursor of protealysin, metalloproteinase from serratia proteamaculans. 0.7269 71 323
3nqz-assembly1.cif.gz_B crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation 0.7261 14 321
3nqx-assembly1.cif.gz_A crystal structure of vibriolysin mcp-02 mature enzyme, a zinc metalloprotease from m4 family 0.7171 14 320
ID Description Score Start End Superfamily
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7671 183 323 1.10.390.10
1bqbA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7389 183 321 1.10.390.10
1bqbA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7061 183 321 1.10.390.10
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.6548 183 323 1.10.390.10
af_Q7PLV6_279_504_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.5763 68 318 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A2P2C5P1-F1-model_v4 Bacillolysin 0.9351 1 322 GO:0004222
GO:0005615
GO:0008270
AF-A0A2P2C5P1-F1-model_v4 Bacillolysin 0.9296 1 322 GO:0004222
GO:0005615
GO:0008270
AF-A0A2W5SSX8-F1-model_v4 FTP domain-containing protein 0.9247 14 322
AF-A0RDG4-F1-model_v4 deleted 0.9206 14 321
AF-C2XTH3-F1-model_v4 Bacillolysin 0.9172 14 321 GO:0004222
GO:0005615
GO:0006508
GO:0008270

Map