F450161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 298 | 936 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300003187|JGI25151J46595_10000993|JGI25151J46595_1000099319 |
| Length | 168 |
| Sequence | MMVIHDFQIDFYIIRGGILMDTSISKTTVDVLNKQIADWNVLFVKLHNYHWYVKGSDFFTLHAKFEELYNEAILHIDVLAERVLIIGGKPIATMREYLDASGIEEANQRATSKEMVQDIVHNFNYLIEELKNGMEITTQESDFVTHDILSAIRKNLSKHIWMLNAYLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 16 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 33 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 35 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 37 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 54 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 55 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 56 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 57 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 58 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 59 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 60 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 61 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 62 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 63 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 64 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 65 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 66 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 67 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 68 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 69 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 70 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 86 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 87 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 88 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 89 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 90 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 91 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 92 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 93 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 96 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 97 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 98 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 99 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 100 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 101 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 102 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 103 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 104 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 105 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 106 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 107 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 108 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 109 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 110 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 113 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 122 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 123 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 124 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 125 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 126 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 127 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 128 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 129 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 130 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 131 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 132 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 133 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 134 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 135 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 136 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 137 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 138 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 139 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 140 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 141 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 142 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 143 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 144 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 145 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 146 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 147 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 148 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 149 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 150 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 151 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 152 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 153 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 154 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 155 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 156 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 157 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 158 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 159 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 160 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 161 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 162 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 163 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 164 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 165 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 166 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 167 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 168 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 169 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 170 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 171 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 172 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 173 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 174 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 175 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 176 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 177 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 178 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 179 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 180 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 181 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 182 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 183 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 184 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 185 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 186 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 187 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 188 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 189 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 190 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 191 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 192 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 193 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 194 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 195 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 196 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 197 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 198 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 199 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 200 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 201 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 202 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 203 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 204 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 205 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 206 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 207 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 208 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 209 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 210 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 211 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 212 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 213 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 214 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 215 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 216 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 217 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 218 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 219 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 220 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 221 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 222 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 223 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 224 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 225 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 226 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 227 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 228 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 229 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 230 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 231 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 232 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 233 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 234 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 235 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 236 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 237 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 238 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 239 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 240 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 241 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 242 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 243 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 244 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 245 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 246 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 247 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 248 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 249 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 250 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 251 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 252 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 253 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 254 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 255 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 256 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 257 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 258 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 259 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 260 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 261 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 262 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 263 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 264 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 265 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 266 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 267 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 268 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 269 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 270 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 271 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 272 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 273 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 274 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 275 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 276 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 277 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 278 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 279 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 280 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 281 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 282 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 283 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 284 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 285 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 286 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 287 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 288 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 289 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 290 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 291 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 292 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 293 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 294 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 295 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 296 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 297 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 298 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 51.81 |
| Metatranscriptomes | 2.13 |
| Isolates | 46.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 13.43 |
| Nodule | 0.43 |
| Rhizoplane | 6.4 |
| Rhizosphere | 47.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000993 | 3300003187 | Bacteria | 21429 |
| 2 | JGI25159J45721_1009471 | 3300002987 | Bacteria | 2566 |
| 3 | JGI25151J46595_10000302 | 3300003187 | Bacteria | 54102 |
| 4 | JGI25151J46595_10000747 | 3300003187 | Bacteria | 26539 |
| 5 | JGI25151J46595_10012089 | 3300003187 | Bacteria | 3937 |
| 6 | JGI25151J46595_10013071 | 3300003187 | Bacteria | 3747 |
| 7 | JGI25151J46595_10022227 | 3300003187 | Unclassified | 2637 |
| 8 | JGI25151J46595_10023653 | 3300003187 | Bacteria | 2526 |
| 9 | JGI25151J46595_10076031 | 3300003187 | Bacteria | 994 |
| 10 | JGI25151J46595_10082623 | 3300003187 | Bacteria | 924 |
| 11 | JGI25151J46595_10137708 | 3300003187 | Bacteria | 599 |
| 12 | rootH2_10041601 | 3300003320 | Bacteria | 4322 |
| 13 | rootL2_10013974 | 3300003322 | Bacteria | 148551 |
| 14 | rootH1_10364009 | 3300003323 | Bacteria | 4424 |
| 15 | Ga0006562J51391_1000700 | 3300003578 | Bacteria | 6310 |
| 16 | Ga0006562J51391_1010313 | 3300003578 | Bacteria | 611 |
| 17 | Ga0006562J51391_1017394 | 3300003578 | Bacteria | 1268 |
| 18 | Ga0055538_1000108 | 3300003751 | Bacteria | 65433 |
| 19 | Ga0055532_1000024 | 3300003758 | Bacteria | 244166 |
| 20 | Ga0055532_1000060 | 3300003758 | Bacteria | 150321 |
| 21 | Ga0055532_1000610 | 3300003758 | Bacteria | 14303 |
| 22 | Ga0055532_1000756 | 3300003758 | Bacteria | 11602 |
| 23 | Ga0055532_1002278 | 3300003758 | Bacteria | 4158 |
| 24 | Ga0055536_1002691 | 3300003781 | Bacteria | 9864 |
| 25 | Ga0055536_1009624 | 3300003781 | Bacteria | 3963 |
| 26 | Ga0055536_1014101 | 3300003781 | Bacteria | 2831 |
| 27 | Ga0055528_1003904 | 3300003790 | Bacteria | 7324 |
| 28 | Ga0070669_100176684 | 3300005353 | Bacteria | 1668 |
| 29 | Ga0070669_100551787 | 3300005353 | Bacteria | 961 |
| 30 | Ga0070675_100528416 | 3300005354 | Bacteria | 1065 |
| 31 | Ga0070671_100038401 | 3300005355 | Bacteria | 3975 |
| 32 | Ga0070715_10545523 | 3300006163 | Bacteria | 671 |
| 33 | Ga0075431_101171014 | 3300006847 | Bacteria | 732 |
| 34 | Ga0105251_10008147 | 3300009011 | Bacteria | 6340 |
| 35 | Ga0105251_10088663 | 3300009011 | Bacteria | 1423 |
| 36 | Ga0105244_10002902 | 3300009036 | Bacteria | 12656 |
| 37 | Ga0105244_10018217 | 3300009036 | Bacteria | 3947 |
| 38 | Ga0105244_10065935 | 3300009036 | Bacteria | 1813 |
| 39 | Ga0105244_10114274 | 3300009036 | Bacteria | 1311 |
| 40 | Ga0105244_10364364 | 3300009036 | Bacteria | 666 |
| 41 | Ga0105250_10005299 | 3300009092 | Bacteria | 5791 |
| 42 | Ga0105250_10141303 | 3300009092 | Bacteria | 998 |
| 43 | Ga0105250_10530617 | 3300009092 | Bacteria | 537 |
| 44 | Ga0105245_10292446 | 3300009098 | Bacteria | 1596 |
| 45 | Ga0105247_10018143 | 3300009101 | Bacteria | 4220 |
| 46 | Ga0105243_10001879 | 3300009148 | Bacteria | 17893 |
| 47 | Ga0105243_10373872 | 3300009148 | Bacteria | 1316 |
| 48 | Ga0105242_10079962 | 3300009176 | Bacteria | 2731 |
| 49 | Ga0105249_10295242 | 3300009553 | Bacteria | 1623 |
| 50 | Ga0105239_10201252 | 3300010375 | Bacteria | 2231 |
| 51 | Ga0105246_10008815 | 3300011119 | Bacteria | 6208 |
| 52 | Ga0105246_10018365 | 3300011119 | Bacteria | 4457 |
| 53 | Ga0105246_11786271 | 3300011119 | Bacteria | 587 |
| 54 | Ga0157378_10002050 | 3300013297 | Bacteria | 18043 |
| 55 | Ga0163163_11551489 | 3300014325 | Bacteria | 723 |
| 56 | Ga0157377_10007811 | 3300014745 | Bacteria | 5183 |
| 57 | Ga0157376_10064061 | 3300014969 | Bacteria | 3099 |
| 58 | Ga0209784_100100 | 3300025224 | Bacteria | 101657 |
| 59 | Ga0209566_100139 | 3300025225 | Bacteria | 89273 |
| 60 | Ga0209566_109691 | 3300025225 | Unclassified | 995 |
| 61 | Ga0209147_100020 | 3300025229 | Bacteria | 474055 |
| 62 | Ga0209147_100054 | 3300025229 | Bacteria | 266796 |
| 63 | Ga0209147_100080 | 3300025229 | Bacteria | 196308 |
| 64 | Ga0209147_100312 | 3300025229 | Bacteria | 37771 |
| 65 | Ga0209147_103242 | 3300025229 | Bacteria | 3302 |
| 66 | Ga0209147_110966 | 3300025229 | Bacteria | 1017 |
| 67 | Ga0209437_101010 | 3300025233 | Bacteria | 9730 |
| 68 | Ga0209673_1008737 | 3300025273 | Bacteria | 4477 |
| 69 | Ga0209130_1000320 | 3300025284 | Bacteria | 56333 |
| 70 | Ga0209130_1004430 | 3300025284 | Bacteria | 5331 |
| 71 | Ga0209130_1026010 | 3300025284 | Bacteria | 1260 |
| 72 | Ga0209675_1007411 | 3300025291 | Bacteria | 4212 |
| 73 | Ga0209675_1010349 | 3300025291 | Bacteria | 3193 |
| 74 | Ga0209675_1054879 | 3300025291 | Bacteria | 807 |
| 75 | Ga0209676_1000274 | 3300025292 | Bacteria | 107505 |
| 76 | Ga0209676_1000597 | 3300025292 | Bacteria | 53358 |
| 77 | Ga0209676_1009235 | 3300025292 | Bacteria | 4281 |
| 78 | Ga0209676_1054856 | 3300025292 | Bacteria | 1024 |
| 79 | Ga0209676_1090739 | 3300025292 | Bacteria | 672 |
| 80 | Ga0209025_1000001 | 3300025294 | Bacteria | 1888151 |
| 81 | Ga0209025_1000043 | 3300025294 | Bacteria | 350458 |
| 82 | Ga0209025_1000170 | 3300025294 | Bacteria | 160659 |
| 83 | Ga0209025_1000262 | 3300025294 | Bacteria | 123617 |
| 84 | Ga0209025_1000433 | 3300025294 | Bacteria | 82715 |
| 85 | Ga0209025_1001857 | 3300025294 | Bacteria | 24772 |
| 86 | Ga0209025_1002061 | 3300025294 | Bacteria | 22834 |
| 87 | Ga0209025_1002449 | 3300025294 | Bacteria | 19620 |
| 88 | Ga0209025_1003052 | 3300025294 | Bacteria | 16484 |
| 89 | Ga0209025_1005266 | 3300025294 | Bacteria | 10643 |
| 90 | Ga0209025_1006096 | 3300025294 | Bacteria | 9524 |
| 91 | Ga0209025_1008528 | 3300025294 | Bacteria | 7362 |
| 92 | Ga0209025_1009239 | 3300025294 | Bacteria | 6911 |
| 93 | Ga0209025_1009914 | 3300025294 | Bacteria | 6547 |
| 94 | Ga0209025_1014353 | 3300025294 | Bacteria | 4881 |
| 95 | Ga0209025_1035613 | 3300025294 | Bacteria | 2246 |
| 96 | Ga0209025_1073727 | 3300025294 | Bacteria | 1195 |
| 97 | Ga0209025_1089466 | 3300025294 | Bacteria | 1012 |
| 98 | Ga0207426_1060439 | 3300025302 | Bacteria | 1092 |
| 99 | Ga0207696_1000479 | 3300025711 | Bacteria | 33975 |
| 100 | Ga0207696_1001916 | 3300025711 | Bacteria | 10585 |
| 101 | Ga0207696_1002758 | 3300025711 | Bacteria | 8349 |
| 102 | Ga0207655_1017140 | 3300025728 | Bacteria | 3920 |
| 103 | Ga0207655_1033821 | 3300025728 | Bacteria | 2310 |
| 104 | Ga0207655_1073141 | 3300025728 | Bacteria | 1265 |
| 105 | Ga0207713_1004372 | 3300025735 | Bacteria | 9182 |
| 106 | Ga0207713_1034826 | 3300025735 | Bacteria | 2182 |
| 107 | Ga0207713_1040714 | 3300025735 | Bacteria | 1947 |
| 108 | Ga0207713_1048472 | 3300025735 | Bacteria | 1710 |
| 109 | Ga0207713_1064818 | 3300025735 | Bacteria | 1374 |
| 110 | Ga0207710_10033695 | 3300025900 | Bacteria | 2248 |
| 111 | Ga0207645_10559827 | 3300025907 | Bacteria | 776 |
| 112 | Ga0207681_10060786 | 3300025923 | Bacteria | 2595 |
| 113 | Ga0207681_10394181 | 3300025923 | Bacteria | 1117 |
| 114 | Ga0207650_10293087 | 3300025925 | Bacteria | 1327 |
| 115 | Ga0207659_10281347 | 3300025926 | Bacteria | 1360 |
| 116 | Ga0207659_10982227 | 3300025926 | Bacteria | 726 |
| 117 | Ga0207687_10435845 | 3300025927 | Bacteria | 1084 |
| 118 | Ga0207686_10048175 | 3300025934 | Bacteria | 2639 |
| 119 | Ga0207709_10016523 | 3300025935 | Bacteria | 4103 |
| 120 | Ga0207709_11097608 | 3300025935 | Bacteria | 653 |
| 121 | Ga0207712_10451146 | 3300025961 | Bacteria | 1090 |
| 122 | Ga0268266_10884380 | 3300028379 | Bacteria | 864 |
| 123 | Ga0237817_10024 | 3300030083 | Bacteria | 61782 |
| 124 | Ga0237817_10986 | 3300030083 | Bacteria | 1758 |
| 125 | Ga0237817_11186 | 3300030083 | Bacteria | 1449 |
| 126 | Ga0307408_100354316 | 3300031548 | Bacteria | 1246 |
| 127 | Ga0307408_101729494 | 3300031548 | Bacteria | 596 |
| 128 | Ga0307405_11541321 | 3300031731 | Bacteria | 585 |
| 129 | Ga0307410_11635480 | 3300031852 | Bacteria | 570 |
| 130 | Ga0307409_100011167 | 3300031995 | Bacteria | 5642 |
| 131 | Ga0307409_100779355 | 3300031995 | Bacteria | 962 |
| 132 | Ga0307416_100014947 | 3300032002 | Bacteria | 5341 |
| 133 | Ga0307416_100242127 | 3300032002 | Bacteria | 1749 |
| 134 | Ga0395900_0787099 | 3300037418 | Bacteria | 880 |
| 135 | Ga0395898_1123493 | 3300037466 | Unclassified | 719 |
| 136 | Ga0237819_00348 | 3300038705 | Bacteria | 16676 |
| 137 | Ga0237819_00577 | 3300038705 | Bacteria | 12294 |
| 138 | Ga0439436_0003912 | 3300041404 | Bacteria | 4566 |
| 139 | Ga0439439_0001486 | 3300041406 | Bacteria | 4687 |
| 140 | Ga0439433_0019101 | 3300041999 | Bacteria | 1526 |
| 141 | Ga0439449_0001726 | 3300042007 | Bacteria | 8592 |
| 142 | Ga0439449_0031323 | 3300042007 | Bacteria | 1982 |
| 143 | Ga0439457_006140 | 3300042014 | Bacteria | 2964 |
| 144 | Ga0439462_0009116 | 3300042015 | Bacteria | 2509 |
| 145 | Ga0439462_0049205 | 3300042015 | Bacteria | 1131 |
| 146 | Ga0466969_0001169 | 3300044656 | Bacteria | 14137 |
| 147 | Ga0466967_0009686 | 3300045976 | Bacteria | 7169 |
| 148 | Ga0466967_0212078 | 3300045976 | Bacteria | 1837 |
| 149 | Ga0466967_1236348 | 3300045976 | Bacteria | 744 |
| 150 | Ga0495603_0064131 | 3300046455 | Bacteria | 2166 |
| 151 | Ga0495584_0044049 | 3300046491 | Bacteria | 2252 |
| 152 | Ga0495585_0008512 | 3300046492 | Bacteria | 6215 |
| 153 | Ga0495637_0138253 | 3300046520 | Bacteria | 926 |
| 154 | Ga0495654_0074503 | 3300046530 | Bacteria | 1603 |
| 155 | Ga0495597_0275085 | 3300046542 | Bacteria | 657 |
| 156 | Ga0495633_0234228 | 3300046558 | Bacteria | 839 |
| 157 | Ga0495611_0199652 | 3300046648 | Bacteria | 933 |
| 158 | Ga0495661_0051259 | 3300046665 | Bacteria | 2493 |
| 159 | Ga0495661_0068887 | 3300046665 | Bacteria | 2075 |
| 160 | Ga0495661_0107384 | 3300046665 | Bacteria | 1561 |
| 161 | Ga0495670_0039371 | 3300046691 | Bacteria | 2358 |
| 162 | Ga0495649_0287622 | 3300046694 | Bacteria | 839 |
| 163 | Ga0495660_0031812 | 3300046810 | Bacteria | 2965 |
| 164 | Ga0495676_0058790 | 3300047321 | Bacteria | 3023 |
| 165 | Ga0495683_0096267 | 3300047323 | Bacteria | 1428 |
| 166 | Ga0495626_0124350 | 3300048091 | Unclassified | 1106 |
| 167 | Ga0495626_0191172 | 3300048091 | Bacteria | 844 |
| 168 | Ga0495626_0300586 | 3300048091 | Bacteria | 634 |
| 169 | Ga0496100_0000519 | 3300048903 | Bacteria | 18430 |
| 170 | Ga0496101_0007109 | 3300048904 | Bacteria | 7237 |
| 171 | Ga0496102_0001666 | 3300048905 | Bacteria | 19511 |
| 172 | Ga0496102_0018785 | 3300048905 | Bacteria | 6080 |
| 173 | Ga0496102_0058745 | 3300048905 | Bacteria | 3515 |
| 174 | Ga0496102_0841706 | 3300048905 | Bacteria | 840 |
| 175 | Ga0496103_0001204 | 3300048906 | Bacteria | 17760 |
| 176 | Ga0496103_0122348 | 3300048906 | Bacteria | 1658 |
| 177 | Ga0496104_0000832 | 3300048907 | Bacteria | 26638 |
| 178 | Ga0496105_0000067 | 3300048908 | Bacteria | 82959 |
| 179 | Ga0496106_0002301 | 3300048909 | Bacteria | 14244 |
| 180 | Ga0496106_1050127 | 3300048909 | Bacteria | 640 |
| 181 | Ga0496107_0000724 | 3300048910 | Bacteria | 18866 |
| 182 | Ga0496108_0003318 | 3300048911 | Bacteria | 12929 |
| 183 | Ga0496109_0000906 | 3300048912 | Bacteria | 24668 |
| 184 | Ga0496110_0009002 | 3300048913 | Bacteria | 8053 |
| 185 | Ga0496110_0014535 | 3300048913 | Bacteria | 6541 |
| 186 | Ga0496110_0487214 | 3300048913 | Bacteria | 1123 |
| 187 | Ga0496110_1566952 | 3300048913 | Bacteria | 569 |
| 188 | Ga0496111_0002271 | 3300048914 | Bacteria | 11544 |
| 189 | Ga0496111_0593968 | 3300048914 | Bacteria | 811 |
| 190 | Ga0496111_0807238 | 3300048914 | Bacteria | 679 |
| 191 | Ga0496112_0000487 | 3300048915 | Bacteria | 26669 |
| 192 | Ga0496112_0093707 | 3300048915 | Bacteria | 2973 |
| 193 | Ga0496113_0003580 | 3300048916 | Bacteria | 9323 |
| 194 | Ga0496116_0005397 | 3300048919 | Bacteria | 11893 |
| 195 | Ga0496116_0017773 | 3300048919 | Bacteria | 5507 |
| 196 | Ga0496116_0117296 | 3300048919 | Bacteria | 1549 |
| 197 | Ga0496116_0124041 | 3300048919 | Bacteria | 1487 |
| 198 | Ga0496116_0299540 | 3300048919 | Bacteria | 766 |
| 199 | Ga0496116_0326914 | 3300048919 | Bacteria | 715 |
| 200 | Ga0496116_0379933 | 3300048919 | Bacteria | 634 |
| 201 | Ga0496117_0020517 | 3300048920 | Bacteria | 5382 |
| 202 | Ga0496117_0048432 | 3300048920 | Bacteria | 3036 |
| 203 | Ga0496118_0008899 | 3300048921 | Bacteria | 10261 |
| 204 | Ga0496119_0000670 | 3300048922 | Bacteria | 45979 |
| 205 | Ga0496119_0022894 | 3300048922 | Bacteria | 4452 |
| 206 | Ga0496120_0022182 | 3300048923 | Bacteria | 3997 |
| 207 | Ga0496120_0024343 | 3300048923 | Bacteria | 3777 |
| 208 | Ga0496121_0060975 | 3300048924 | Bacteria | 3098 |
| 209 | Ga0496121_0081829 | 3300048924 | Bacteria | 2554 |
| 210 | Ga0496121_0752508 | 3300048924 | Bacteria | 579 |
| 211 | Ga0496122_0048200 | 3300048925 | Bacteria | 3279 |
| 212 | Ga0496122_0058381 | 3300048925 | Bacteria | 2857 |
| 213 | Ga0496122_0067091 | 3300048925 | Bacteria | 2586 |
| 214 | Ga0496122_0074795 | 3300048925 | Bacteria | 2394 |
| 215 | Ga0496122_0078545 | 3300048925 | Bacteria | 2311 |
| 216 | Ga0496122_0162524 | 3300048925 | Bacteria | 1359 |
| 217 | Ga0496122_0190162 | 3300048925 | Bacteria | 1213 |
| 218 | Ga0496122_0197788 | 3300048925 | Bacteria | 1179 |
| 219 | Ga0496122_0205444 | 3300048925 | Bacteria | 1147 |
| 220 | Ga0496122_0338720 | 3300048925 | Unclassified | 791 |
| 221 | Ga0496123_0002651 | 3300048926 | Bacteria | 21637 |
| 222 | Ga0496123_0133558 | 3300048926 | Bacteria | 1370 |
| 223 | Ga0496123_0142086 | 3300048926 | Bacteria | 1310 |
| 224 | Ga0496124_0001526 | 3300048927 | Bacteria | 33706 |
| 225 | Ga0496124_0027966 | 3300048927 | Bacteria | 5050 |
| 226 | Ga0496124_0029177 | 3300048927 | Bacteria | 4921 |
| 227 | Ga0496124_0032984 | 3300048927 | Bacteria | 4564 |
| 228 | Ga0496124_0041193 | 3300048927 | Bacteria | 3989 |
| 229 | Ga0496124_0084868 | 3300048927 | Bacteria | 2596 |
| 230 | Ga0496125_0001139 | 3300048928 | Bacteria | 40438 |
| 231 | Ga0496125_0004357 | 3300048928 | Bacteria | 16406 |
| 232 | Ga0496125_0060292 | 3300048928 | Bacteria | 3051 |
| 233 | Ga0496125_0304031 | 3300048928 | Bacteria | 976 |
| 234 | Ga0496126_0004828 | 3300048929 | Bacteria | 15811 |
| 235 | Ga0496126_0028467 | 3300048929 | Bacteria | 5324 |
| 236 | Ga0501343_003373 | 3300049132 | Bacteria | 1172 |
| 237 | Ga0501305_058946 | 3300049161 | Bacteria | 657 |
| 238 | Ga0501291_101265 | 3300049514 | Bacteria | 601 |
| 239 | Ga0501315_003493 | 3300049531 | Bacteria | 1578 |
| 240 | Ga0501315_074638 | 3300049531 | Bacteria | 568 |
| 241 | Ga0501317_105235 | 3300049533 | Bacteria | 513 |
| 242 | Ga0501332_03837 | 3300049548 | Bacteria | 878 |
| 243 | Ga0501337_022057 | 3300049553 | Bacteria | 523 |
| 244 | Ga0501031_0501427 | 3300049568 | Bacteria | 783 |
| 245 | Ga0501042_0988864 | 3300049578 | Bacteria | 613 |
| 246 | Ga0501076_1636551 | 3300049592 | Bacteria | 528 |
| 247 | Ga0501077_0671615 | 3300049593 | Bacteria | 666 |
| 248 | Ga0501198_032177 | 3300049649 | Bacteria | 880 |
| 249 | Ga0501217_010691 | 3300049661 | Bacteria | 2016 |
| 250 | Ga0501217_114150 | 3300049661 | Bacteria | 778 |
| 251 | Ga0501253_157496 | 3300049683 | Bacteria | 577 |
| 252 | Ga0501221_008626 | 3300049704 | Bacteria | 1776 |
| 253 | 2511177942 | 2510917027 | Bacteria | 5287437 |
| 254 | 2511180179 | 2510917027 | Bacteria | 5287437 |
| 255 | 2511700728 | 2511231119 | Bacteria | 4019861 |
| 256 | 2511701008 | 2511231119 | Bacteria | 4019861 |
| 257 | 2512638344 | 2512564013 | Bacteria | 6286191 |
| 258 | 2512639830 | 2512564013 | Bacteria | 6286191 |
| 259 | 2512731828 | 2512564039 | Bacteria | 8739048 |
| 260 | 2512736790 | 2512564039 | Bacteria | 8739048 |
| 261 | 2524188752 | 2524023129 | Bacteria | 6762600 |
| 262 | 2524189200 | 2524023129 | Bacteria | 6762600 |
| 263 | 2540607946 | 2540341094 | Bacteria | 4061186 |
| 264 | 2545557425 | 2545555800 | Bacteria | 4222588 |
| 265 | 2545559471 | 2545555800 | Bacteria | 4222588 |
| 266 | 2553397059 | 2551306519 | Bacteria | 5465154 |
| 267 | 2555470013 | 2554235283 | Bacteria | 3683090 |
| 268 | 2556062574 | 2554235469 | Bacteria | 3590176 |
| 269 | 2578930427 | 2576861599 | Bacteria | 4217202 |
| 270 | 2578931692 | 2576861599 | Bacteria | 4217202 |
| 271 | 2580930867 | 2579778775 | Bacteria | 5360914 |
| 272 | 2587739673 | 2585428059 | Bacteria | 8696589 |
| 273 | 2587740817 | 2585428059 | Bacteria | 8696589 |
| 274 | 2587741848 | 2585428059 | Bacteria | 8696589 |
| 275 | 2595090068 | 2593339131 | Bacteria | 5116855 |
| 276 | 2595091392 | 2593339131 | Bacteria | 5116855 |
| 277 | 2595317335 | 2593339198 | Bacteria | 7267884 |
| 278 | 2600199721 | 2599185353 | Bacteria | 2219443 |
| 279 | 2600402702 | 2600254943 | Bacteria | 2613887 |
| 280 | 2601639865 | 2600255286 | Bacteria | 5390125 |
| 281 | 2621273736 | 2619619294 | Bacteria | 5575484 |
| 282 | 2631986333 | 2630968484 | Bacteria | 3876276 |
| 283 | 2631986470 | 2630968484 | Bacteria | 3876276 |
| 284 | 2644424704 | 2643221676 | Bacteria | 8119172 |
| 285 | 2644426140 | 2643221676 | Bacteria | 8119172 |
| 286 | 2644427781 | 2643221676 | Bacteria | 8119172 |
| 287 | 2644707359 | 2643221729 | Bacteria | 6621700 |
| 288 | 2644714316 | 2643221730 | Bacteria | 6523787 |
| 289 | 2644715446 | 2643221731 | Bacteria | 5623886 |
| 290 | 2644726749 | 2643221732 | Bacteria | 5756404 |
| 291 | 2644740374 | 2643221735 | Bacteria | 3676263 |
| 292 | 2651530626 | 2648501850 | Bacteria | 3975476 |
| 293 | 2651532554 | 2648501850 | Bacteria | 3975476 |
| 294 | 2673818086 | 2671180694 | Bacteria | 7506943 |
| 295 | 2674418449 | 2671180844 | Bacteria | 4164150 |
| 296 | 2674422052 | 2671180844 | Bacteria | 4164150 |
| 297 | 2685153020 | 2684622632 | Bacteria | 5380049 |
| 298 | 2686998021 | 2684623153 | Bacteria | 3878815 |
| 299 | 2687499367 | 2687453109 | Bacteria | 3860091 |
| 300 | 2695628718 | 2695420354 | Bacteria | 3922431 |
| 301 | 2695628963 | 2695420354 | Bacteria | 3922431 |
| 302 | 2698320161 | 2695420987 | Bacteria | 6152737 |
| 303 | 2705996949 | 2703719227 | Bacteria | 5631989 |
| 304 | 2712197813 | 2711768088 | Bacteria | 3195027 |
| 305 | 2717915337 | 2716884898 | Bacteria | 3928789 |
| 306 | 2717915587 | 2716884898 | Bacteria | 3928789 |
| 307 | 2721508168 | 2718218445 | Bacteria | 5113413 |
| 308 | 2723606519 | 2721755693 | Bacteria | 6126117 |
| 309 | 2730137115 | 2728369359 | Bacteria | 5621728 |
| 310 | 2738816877 | 2738541295 | Bacteria | 5730091 |
| 311 | 2738840596 | 2738541299 | Bacteria | 4020721 |
| 312 | 2739157205 | 2738541358 | Bacteria | 5932299 |
| 313 | 2739209045 | 2738543006 | Bacteria | 5904091 |
| 314 | 2739234552 | 2738543010 | Bacteria | 5583595 |
| 315 | 2739269076 | 2738543017 | Bacteria | 4271950 |
| 316 | 2739271135 | 2738543017 | Bacteria | 4271950 |
| 317 | 2753808826 | 2751185905 | Bacteria | 6142767 |
| 318 | 2757566718 | 2757320391 | Bacteria | 4746095 |
| 319 | 2757567591 | 2757320391 | Bacteria | 4746095 |
| 320 | 2777760855 | 2775507177 | Bacteria | 4384303 |
| 321 | 2777761925 | 2775507177 | Bacteria | 4384303 |
| 322 | 2777836269 | 2775507192 | Bacteria | 4622234 |
| 323 | 2777838981 | 2775507192 | Bacteria | 4622234 |
| 324 | 2791212899 | 2788500588 | Bacteria | 4584915 |
| 325 | 2793183571 | 2791355222 | Bacteria | 5898266 |
| 326 | 2802437814 | 2802428803 | Bacteria | 5806948 |
| 327 | 2809056314 | 2808606399 | Bacteria | 4021018 |
| 328 | 2812317220 | 2811994870 | Bacteria | 3776934 |
| 329 | 2817481314 | 2816332295 | Bacteria | 4352468 |
| 330 | 2819582482 | 2818991443 | Bacteria | 6598732 |
| 331 | 2819625265 | 2818991451 | Bacteria | 4697364 |
| 332 | 2819672098 | 2818991459 | Bacteria | 8736032 |
| 333 | 2819675290 | 2818991459 | Bacteria | 8736032 |
| 334 | 2819708914 | 2818991465 | Bacteria | 5388835 |
| 335 | 2819724296 | 2818991468 | Bacteria | 3723169 |
| 336 | 2823529185 | 2823526263 | Bacteria | 3765752 |
| 337 | 2842884851 | 2842882022 | Bacteria | 6158489 |
| 338 | 2852676331 | 2852673933 | Bacteria | 3347676 |
| 339 | 2857362322 | 2857357740 | Bacteria | 9937880 |
| 340 | 2857455882 | 2857453340 | Bacteria | 8090534 |
| 341 | 2857460618 | 2857460504 | Bacteria | 5194327 |
| 342 | 2857470328 | 2857465823 | Bacteria | 6772595 |
| 343 | 2857471914 | 2857465823 | Bacteria | 6772595 |
| 344 | 2857588023 | 2857586860 | Bacteria | 4354574 |
| 345 | 2857590098 | 2857586860 | Bacteria | 4354574 |
| 346 | 2857594028 | 2857591370 | Bacteria | 6569758 |
| 347 | 2857594233 | 2857591370 | Bacteria | 6569758 |
| 348 | 2857595352 | 2857591370 | Bacteria | 6569758 |
| 349 | 2857604668 | 2857604169 | Bacteria | 5111450 |
| 350 | 2857610475 | 2857609550 | Bacteria | 3753890 |
| 351 | 2860840728 | 2860837431 | Bacteria | 4202080 |
| 352 | 2864998124 | 2864997549 | Bacteria | 5139696 |
| 353 | 2865005428 | 2865002811 | Bacteria | 6333767 |
| 354 | 2877771644 | 2877768649 | Bacteria | 3957164 |
| 355 | 2877771895 | 2877768649 | Bacteria | 3957164 |
| 356 | 2880172488 | 2880169592 | Bacteria | 3900066 |
| 357 | 2880172734 | 2880169592 | Bacteria | 3900066 |
| 358 | 2881638207 | 2881636855 | Bacteria | 5205297 |
| 359 | 2881648683 | 2881644220 | Bacteria | 5302661 |
| 360 | 2888579622 | 2888578766 | Bacteria | 6743310 |
| 361 | 2889048314 | 2889042446 | Bacteria | 7618936 |
| 362 | 2889051758 | 2889049205 | Bacteria | 7524325 |
| 363 | 2889277073 | 2889276214 | Bacteria | 5979355 |
| 364 | 2889299086 | 2889295896 | Bacteria | 4704906 |
| 365 | 2897112761 | 2897109615 | Bacteria | 4009619 |
| 366 | 2897113010 | 2897109615 | Bacteria | 4009619 |
| 367 | 2904113784 | 2904113452 | Bacteria | 7796941 |
| 368 | 2904494571 | 2904490793 | Bacteria | 7046938 |
| 369 | 2904524119 | 2904524088 | Bacteria | 5887454 |
| 370 | 2904561331 | 2904560550 | Bacteria | 4029838 |
| 371 | 2904564088 | 2904560550 | Bacteria | 4029838 |
| 372 | 2904596240 | 2904595352 | Bacteria | 6124848 |
| 373 | 2904607229 | 2904606771 | Bacteria | 4684500 |
| 374 | 2904759001 | 2904755435 | Bacteria | 7986759 |
| 375 | 2908667612 | 2908665501 | Bacteria | 3678115 |
| 376 | 2915599703 | 2915597211 | Bacteria | 6475886 |
| 377 | 2915599846 | 2915597211 | Bacteria | 6475886 |
| 378 | 2915609293 | 2915606848 | Bacteria | 6032732 |
| 379 | 2915609397 | 2915606848 | Bacteria | 6032732 |
| 380 | 2919095406 | 2919093281 | Bacteria | 3660974 |
| 381 | 2919147304 | 2919143609 | Bacteria | 6219228 |
| 382 | 2919164281 | 2919160200 | Bacteria | 6929020 |
| 383 | 2919419540 | 2919414237 | Bacteria | 5429133 |
| 384 | 2919426210 | 2919425241 | Bacteria | 8055701 |
| 385 | 2919429924 | 2919425241 | Bacteria | 8055701 |
| 386 | 2919519209 | 2919517244 | Bacteria | 5858162 |
| 387 | 2919723578 | 2919720352 | Bacteria | 5986006 |
| 388 | 2919728886 | 2919726948 | Bacteria | 3696050 |
| 389 | 2928095896 | 2928093941 | Bacteria | 5965005 |
| 390 | 2928513765 | 2928510474 | Bacteria | 4815308 |
| 391 | 2929006733 | 2929004312 | Bacteria | 5678476 |
| 392 | 2929184863 | 2929183550 | Bacteria | 6377511 |
| 393 | 2929185023 | 2929183550 | Bacteria | 6377511 |
| 394 | 2929208083 | 2929206907 | Bacteria | 5918291 |
| 395 | 2929238740 | 2929233124 | Bacteria | 5948380 |
| 396 | 2931385431 | 2931384279 | Bacteria | 7299545 |
| 397 | 2936345180 | 2936340661 | Bacteria | 5139038 |
| 398 | 2936345516 | 2936340661 | Bacteria | 5139038 |
| 399 | 2936362319 | 2936361878 | Bacteria | 5632809 |
| 400 | 2938922945 | 2938917290 | Bacteria | 5914775 |
| 401 | 2939594317 | 2939593269 | Bacteria | 4798695 |
| 402 | 2939680387 | 2939679117 | Bacteria | 6921672 |
| 403 | 2939703053 | 2939702853 | Bacteria | 5139229 |
| 404 | 2945995929 | 2945991243 | Bacteria | 7008369 |
| 405 | 2946058635 | 2946053406 | Bacteria | 6978655 |
| 406 | 2947431822 | 2947426588 | Bacteria | 5357194 |
| 407 | 2954773274 | 2954773129 | Bacteria | 3741715 |
| 408 | 2960319515 | 2960319331 | Bacteria | 5502575 |
| 409 | 2960381274 | 2960375949 | Bacteria | 5361395 |
| 410 | 2962293949 | 2962290636 | Bacteria | 4072939 |
| 411 | 2965766348 | 2965761152 | Bacteria | 5806513 |
| 412 | 2969139934 | 2969136845 | Bacteria | 3923176 |
| 413 | 2969144087 | 2969141011 | Bacteria | 4118468 |
| 414 | 2969144446 | 2969141011 | Bacteria | 4118468 |
| 415 | 2969769598 | 2969765954 | Bacteria | 4216713 |
| 416 | 2969772662 | 2969770375 | Bacteria | 4271280 |
| 417 | 2971412100 | 2971410472 | Bacteria | 8311090 |
| 418 | 2971896310 | 2971893375 | Bacteria | 3929648 |
| 419 | 2971896568 | 2971893375 | Bacteria | 3929648 |
| 420 | 2977256116 | 2977254563 | Bacteria | 4828420 |
| 421 | 2979088728 | 2979083700 | Bacteria | 5894929 |
| 422 | 2980126069 | 2980125574 | Bacteria | 5567337 |
| 423 | 2980186456 | 2980182181 | Bacteria | 9454109 |
| 424 | 2980495722 | 2980492589 | Bacteria | 4072961 |
| 425 | 2981288524 | 2981284811 | Bacteria | 4641497 |
| 426 | 2981293345 | 2981289755 | Bacteria | 4641509 |
| 427 | 2981983970 | 2981980479 | Bacteria | 4641628 |
| 428 | 2981988893 | 2981985349 | Bacteria | 4641497 |
| 429 | 2984531478 | 2984527788 | Bacteria | 5288478 |
| 430 | 2984532732 | 2984532647 | Bacteria | 5288506 |
| 431 | 2990276997 | 2990275345 | Bacteria | 4887158 |
| 432 | 2996339999 | 2996336353 | Bacteria | 5511628 |
| 433 | 2996710751 | 2996706504 | Bacteria | 5757485 |
| 434 | 3001268851 | 3001267043 | Bacteria | 4823521 |
| 435 | 3001274326 | 3001272096 | Bacteria | 4729684 |
| 436 | 3006861738 | 3006858327 | Bacteria | 4317835 |
| 437 | 3006882098 | 3006879489 | Bacteria | 4064221 |
| 438 | 3006971687 | 3006969106 | Bacteria | 4739423 |
| 439 | 3006982369 | 3006978542 | Bacteria | 5328100 |
| 440 | 3006983284 | 3006978542 | Bacteria | 5328100 |
| 441 | 3006984120 | 3006984091 | Bacteria | 4207523 |
| 442 | 3006988514 | 3006988479 | Bacteria | 4767936 |
| 443 | 648172498 | 648028048 | Bacteria | 5394884 |
| 444 | 8002317760 | 8002317523 | Bacteria | 8051857 |
| 445 | 8022626531 | 8022621104 | Bacteria | 5241040 |
| 446 | 8022632369 | 8022630665 | Bacteria | 3886130 |
| 447 | 8022633160 | 8022630665 | Bacteria | 3886130 |
| 448 | 8022654888 | 8022653035 | Bacteria | 4035078 |
| 449 | 8022797811 | 8022792930 | Bacteria | 5693794 |
| 450 | 8022898555 | 8022893055 | Bacteria | 5300455 |
| 451 | 8022917705 | 8022914991 | Bacteria | 5584517 |
| 452 | 8022950246 | 8022948649 | Bacteria | 5366783 |
| 453 | 8023441171 | 8023438354 | Bacteria | 5779374 |
| 454 | 8023448718 | 8023444577 | Bacteria | 5661597 |
| 455 | 8046997057 | 8046991243 | Bacteria | 8497463 |
| 456 | 8051954490 | 8051952484 | Bacteria | 3926774 |
| 457 | 8051954739 | 8051952484 | Bacteria | 3926774 |
| 458 | 8052175118 | 8052174270 | Bacteria | 3881265 |
| 459 | 8052175428 | 8052174270 | Bacteria | 3881265 |
| 460 | 8054280694 | 8054280661 | Bacteria | 4232245 |
| 461 | 8055533782 | 8055531788 | Bacteria | 5249694 |
| 462 | 8055632991 | 8055632911 | Bacteria | 5283357 |
| 463 | 8055634393 | 8055632911 | Bacteria | 5283357 |
| 464 | 8056535102 | 8056533031 | Bacteria | 8964429 |
| 465 | 8057478016 | 8057473075 | Bacteria | 5892720 |
| 466 | 8057587482 | 8057582654 | Bacteria | 5218944 |
| 467 | 8057635906 | 8057632132 | Bacteria | 4726859 |
| 468 | 8057981342 | 8057977335 | Bacteria | 5694872 |
| 469 | JGI25151J46595_10000993 | |||
| 470 | JGI25159J45721_1009471 | |||
| 471 | JGI25151J46595_10000302 | |||
| 472 | JGI25151J46595_10000747 | |||
| 473 | JGI25151J46595_10012089 | |||
| 474 | JGI25151J46595_10013071 | |||
| 475 | JGI25151J46595_10022227 | |||
| 476 | JGI25151J46595_10023653 | |||
| 477 | JGI25151J46595_10076031 | |||
| 478 | JGI25151J46595_10082623 | |||
| 479 | JGI25151J46595_10137708 | |||
| 480 | rootH2_10041601 | |||
| 481 | rootL2_10013974 | |||
| 482 | rootH1_10364009 | |||
| 483 | Ga0006562J51391_1000700 | |||
| 484 | Ga0006562J51391_1010313 | |||
| 485 | Ga0006562J51391_1017394 | |||
| 486 | Ga0055538_1000108 | |||
| 487 | Ga0055532_1000024 | |||
| 488 | Ga0055532_1000060 | |||
| 489 | Ga0055532_1000610 | |||
| 490 | Ga0055532_1000756 | |||
| 491 | Ga0055532_1002278 | |||
| 492 | Ga0055536_1002691 | |||
| 493 | Ga0055536_1009624 | |||
| 494 | Ga0055536_1014101 | |||
| 495 | Ga0055528_1003904 | |||
| 496 | Ga0070669_100176684 | |||
| 497 | Ga0070669_100551787 | |||
| 498 | Ga0070675_100528416 | |||
| 499 | Ga0070671_100038401 | |||
| 500 | Ga0070715_10545523 | |||
| 501 | Ga0075431_101171014 | |||
| 502 | Ga0105251_10008147 | |||
| 503 | Ga0105251_10088663 | |||
| 504 | Ga0105244_10002902 | |||
| 505 | Ga0105244_10018217 | |||
| 506 | Ga0105244_10065935 | |||
| 507 | Ga0105244_10114274 | |||
| 508 | Ga0105244_10364364 | |||
| 509 | Ga0105250_10005299 | |||
| 510 | Ga0105250_10141303 | |||
| 511 | Ga0105250_10530617 | |||
| 512 | Ga0105245_10292446 | |||
| 513 | Ga0105247_10018143 | |||
| 514 | Ga0105243_10001879 | |||
| 515 | Ga0105243_10373872 | |||
| 516 | Ga0105242_10079962 | |||
| 517 | Ga0105249_10295242 | |||
| 518 | Ga0105239_10201252 | |||
| 519 | Ga0105246_10008815 | |||
| 520 | Ga0105246_10018365 | |||
| 521 | Ga0105246_11786271 | |||
| 522 | Ga0157378_10002050 | |||
| 523 | Ga0163163_11551489 | |||
| 524 | Ga0157377_10007811 | |||
| 525 | Ga0157376_10064061 | |||
| 526 | Ga0209784_100100 | |||
| 527 | Ga0209566_100139 | |||
| 528 | Ga0209566_109691 | |||
| 529 | Ga0209147_100020 | |||
| 530 | Ga0209147_100054 | |||
| 531 | Ga0209147_100080 | |||
| 532 | Ga0209147_100312 | |||
| 533 | Ga0209147_103242 | |||
| 534 | Ga0209147_110966 | |||
| 535 | Ga0209437_101010 | |||
| 536 | Ga0209673_1008737 | |||
| 537 | Ga0209130_1000320 | |||
| 538 | Ga0209130_1004430 | |||
| 539 | Ga0209130_1026010 | |||
| 540 | Ga0209675_1007411 | |||
| 541 | Ga0209675_1010349 | |||
| 542 | Ga0209675_1054879 | |||
| 543 | Ga0209676_1000274 | |||
| 544 | Ga0209676_1000597 | |||
| 545 | Ga0209676_1009235 | |||
| 546 | Ga0209676_1054856 | |||
| 547 | Ga0209676_1090739 | |||
| 548 | Ga0209025_1000001 | |||
| 549 | Ga0209025_1000043 | |||
| 550 | Ga0209025_1000170 | |||
| 551 | Ga0209025_1000262 | |||
| 552 | Ga0209025_1000433 | |||
| 553 | Ga0209025_1001857 | |||
| 554 | Ga0209025_1002061 | |||
| 555 | Ga0209025_1002449 | |||
| 556 | Ga0209025_1003052 | |||
| 557 | Ga0209025_1005266 | |||
| 558 | Ga0209025_1006096 | |||
| 559 | Ga0209025_1008528 | |||
| 560 | Ga0209025_1009239 | |||
| 561 | Ga0209025_1009914 | |||
| 562 | Ga0209025_1014353 | |||
| 563 | Ga0209025_1035613 | |||
| 564 | Ga0209025_1073727 | |||
| 565 | Ga0209025_1089466 | |||
| 566 | Ga0207426_1060439 | |||
| 567 | Ga0207696_1000479 | |||
| 568 | Ga0207696_1001916 | |||
| 569 | Ga0207696_1002758 | |||
| 570 | Ga0207655_1017140 | |||
| 571 | Ga0207655_1033821 | |||
| 572 | Ga0207655_1073141 | |||
| 573 | Ga0207713_1004372 | |||
| 574 | Ga0207713_1034826 | |||
| 575 | Ga0207713_1040714 | |||
| 576 | Ga0207713_1048472 | |||
| 577 | Ga0207713_1064818 | |||
| 578 | Ga0207710_10033695 | |||
| 579 | Ga0207645_10559827 | |||
| 580 | Ga0207681_10060786 | |||
| 581 | Ga0207681_10394181 | |||
| 582 | Ga0207650_10293087 | |||
| 583 | Ga0207659_10281347 | |||
| 584 | Ga0207659_10982227 | |||
| 585 | Ga0207687_10435845 | |||
| 586 | Ga0207686_10048175 | |||
| 587 | Ga0207709_10016523 | |||
| 588 | Ga0207709_11097608 | |||
| 589 | Ga0207712_10451146 | |||
| 590 | Ga0268266_10884380 | |||
| 591 | Ga0237817_10024 | |||
| 592 | Ga0237817_10986 | |||
| 593 | Ga0237817_11186 | |||
| 594 | Ga0307408_100354316 | |||
| 595 | Ga0307408_101729494 | |||
| 596 | Ga0307405_11541321 | |||
| 597 | Ga0307410_11635480 | |||
| 598 | Ga0307409_100011167 | |||
| 599 | Ga0307409_100779355 | |||
| 600 | Ga0307416_100014947 | |||
| 601 | Ga0307416_100242127 | |||
| 602 | Ga0395900_0787099 | |||
| 603 | Ga0395898_1123493 | |||
| 604 | Ga0237819_00348 | |||
| 605 | Ga0237819_00577 | |||
| 606 | Ga0439436_0003912 | |||
| 607 | Ga0439439_0001486 | |||
| 608 | Ga0439433_0019101 | |||
| 609 | Ga0439449_0001726 | |||
| 610 | Ga0439449_0031323 | |||
| 611 | Ga0439457_006140 | |||
| 612 | Ga0439462_0009116 | |||
| 613 | Ga0439462_0049205 | |||
| 614 | Ga0466969_0001169 | |||
| 615 | Ga0466967_0009686 | |||
| 616 | Ga0466967_0212078 | |||
| 617 | Ga0466967_1236348 | |||
| 618 | Ga0495603_0064131 | |||
| 619 | Ga0495584_0044049 | |||
| 620 | Ga0495585_0008512 | |||
| 621 | Ga0495637_0138253 | |||
| 622 | Ga0495654_0074503 | |||
| 623 | Ga0495597_0275085 | |||
| 624 | Ga0495633_0234228 | |||
| 625 | Ga0495611_0199652 | |||
| 626 | Ga0495661_0051259 | |||
| 627 | Ga0495661_0068887 | |||
| 628 | Ga0495661_0107384 | |||
| 629 | Ga0495670_0039371 | |||
| 630 | Ga0495649_0287622 | |||
| 631 | Ga0495660_0031812 | |||
| 632 | Ga0495676_0058790 | |||
| 633 | Ga0495683_0096267 | |||
| 634 | Ga0495626_0124350 | |||
| 635 | Ga0495626_0191172 | |||
| 636 | Ga0495626_0300586 | |||
| 637 | Ga0496100_0000519 | |||
| 638 | Ga0496101_0007109 | |||
| 639 | Ga0496102_0001666 | |||
| 640 | Ga0496102_0018785 | |||
| 641 | Ga0496102_0058745 | |||
| 642 | Ga0496102_0841706 | |||
| 643 | Ga0496103_0001204 | |||
| 644 | Ga0496103_0122348 | |||
| 645 | Ga0496104_0000832 | |||
| 646 | Ga0496105_0000067 | |||
| 647 | Ga0496106_0002301 | |||
| 648 | Ga0496106_1050127 | |||
| 649 | Ga0496107_0000724 | |||
| 650 | Ga0496108_0003318 | |||
| 651 | Ga0496109_0000906 | |||
| 652 | Ga0496110_0009002 | |||
| 653 | Ga0496110_0014535 | |||
| 654 | Ga0496110_0487214 | |||
| 655 | Ga0496110_1566952 | |||
| 656 | Ga0496111_0002271 | |||
| 657 | Ga0496111_0593968 | |||
| 658 | Ga0496111_0807238 | |||
| 659 | Ga0496112_0000487 | |||
| 660 | Ga0496112_0093707 | |||
| 661 | Ga0496113_0003580 | |||
| 662 | Ga0496116_0005397 | |||
| 663 | Ga0496116_0017773 | |||
| 664 | Ga0496116_0117296 | |||
| 665 | Ga0496116_0124041 | |||
| 666 | Ga0496116_0299540 | |||
| 667 | Ga0496116_0326914 | |||
| 668 | Ga0496116_0379933 | |||
| 669 | Ga0496117_0020517 | |||
| 670 | Ga0496117_0048432 | |||
| 671 | Ga0496118_0008899 | |||
| 672 | Ga0496119_0000670 | |||
| 673 | Ga0496119_0022894 | |||
| 674 | Ga0496120_0022182 | |||
| 675 | Ga0496120_0024343 | |||
| 676 | Ga0496121_0060975 | |||
| 677 | Ga0496121_0081829 | |||
| 678 | Ga0496121_0752508 | |||
| 679 | Ga0496122_0048200 | |||
| 680 | Ga0496122_0058381 | |||
| 681 | Ga0496122_0067091 | |||
| 682 | Ga0496122_0074795 | |||
| 683 | Ga0496122_0078545 | |||
| 684 | Ga0496122_0162524 | |||
| 685 | Ga0496122_0190162 | |||
| 686 | Ga0496122_0197788 | |||
| 687 | Ga0496122_0205444 | |||
| 688 | Ga0496122_0338720 | |||
| 689 | Ga0496123_0002651 | |||
| 690 | Ga0496123_0133558 | |||
| 691 | Ga0496123_0142086 | |||
| 692 | Ga0496124_0001526 | |||
| 693 | Ga0496124_0027966 | |||
| 694 | Ga0496124_0029177 | |||
| 695 | Ga0496124_0032984 | |||
| 696 | Ga0496124_0041193 | |||
| 697 | Ga0496124_0084868 | |||
| 698 | Ga0496125_0001139 | |||
| 699 | Ga0496125_0004357 | |||
| 700 | Ga0496125_0060292 | |||
| 701 | Ga0496125_0304031 | |||
| 702 | Ga0496126_0004828 | |||
| 703 | Ga0496126_0028467 | |||
| 704 | Ga0501343_003373 | |||
| 705 | Ga0501305_058946 | |||
| 706 | Ga0501291_101265 | |||
| 707 | Ga0501315_003493 | |||
| 708 | Ga0501315_074638 | |||
| 709 | Ga0501317_105235 | |||
| 710 | Ga0501332_03837 | |||
| 711 | Ga0501337_022057 | |||
| 712 | Ga0501031_0501427 | |||
| 713 | Ga0501042_0988864 | |||
| 714 | Ga0501076_1636551 | |||
| 715 | Ga0501077_0671615 | |||
| 716 | Ga0501198_032177 | |||
| 717 | Ga0501217_010691 | |||
| 718 | Ga0501217_114150 | |||
| 719 | Ga0501253_157496 | |||
| 720 | Ga0501221_008626 | |||
| 721 | 2511177942 | |||
| 722 | 2511180179 | |||
| 723 | 2511700728 | |||
| 724 | 2511701008 | |||
| 725 | 2512638344 | |||
| 726 | 2512639830 | |||
| 727 | 2512731828 | |||
| 728 | 2512736790 | |||
| 729 | 2524188752 | |||
| 730 | 2524189200 | |||
| 731 | 2540607946 | |||
| 732 | 2545557425 | |||
| 733 | 2545559471 | |||
| 734 | 2553397059 | |||
| 735 | 2555470013 | |||
| 736 | 2556062574 | |||
| 737 | 2578930427 | |||
| 738 | 2578931692 | |||
| 739 | 2580930867 | |||
| 740 | 2587739673 | |||
| 741 | 2587740817 | |||
| 742 | 2587741848 | |||
| 743 | 2595090068 | |||
| 744 | 2595091392 | |||
| 745 | 2595317335 | |||
| 746 | 2600199721 | |||
| 747 | 2600402702 | |||
| 748 | 2601639865 | |||
| 749 | 2621273736 | |||
| 750 | 2631986333 | |||
| 751 | 2631986470 | |||
| 752 | 2644424704 | |||
| 753 | 2644426140 | |||
| 754 | 2644427781 | |||
| 755 | 2644707359 | |||
| 756 | 2644714316 | |||
| 757 | 2644715446 | |||
| 758 | 2644726749 | |||
| 759 | 2644740374 | |||
| 760 | 2651530626 | |||
| 761 | 2651532554 | |||
| 762 | 2673818086 | |||
| 763 | 2674418449 | |||
| 764 | 2674422052 | |||
| 765 | 2685153020 | |||
| 766 | 2686998021 | |||
| 767 | 2687499367 | |||
| 768 | 2695628718 | |||
| 769 | 2695628963 | |||
| 770 | 2698320161 | |||
| 771 | 2705996949 | |||
| 772 | 2712197813 | |||
| 773 | 2717915337 | |||
| 774 | 2717915587 | |||
| 775 | 2721508168 | |||
| 776 | 2723606519 | |||
| 777 | 2730137115 | |||
| 778 | 2738816877 | |||
| 779 | 2738840596 | |||
| 780 | 2739157205 | |||
| 781 | 2739209045 | |||
| 782 | 2739234552 | |||
| 783 | 2739269076 | |||
| 784 | 2739271135 | |||
| 785 | 2753808826 | |||
| 786 | 2757566718 | |||
| 787 | 2757567591 | |||
| 788 | 2777760855 | |||
| 789 | 2777761925 | |||
| 790 | 2777836269 | |||
| 791 | 2777838981 | |||
| 792 | 2791212899 | |||
| 793 | 2793183571 | |||
| 794 | 2802437814 | |||
| 795 | 2809056314 | |||
| 796 | 2812317220 | |||
| 797 | 2817481314 | |||
| 798 | 2819582482 | |||
| 799 | 2819625265 | |||
| 800 | 2819672098 | |||
| 801 | 2819675290 | |||
| 802 | 2819708914 | |||
| 803 | 2819724296 | |||
| 804 | 2823529185 | |||
| 805 | 2842884851 | |||
| 806 | 2852676331 | |||
| 807 | 2857362322 | |||
| 808 | 2857455882 | |||
| 809 | 2857460618 | |||
| 810 | 2857470328 | |||
| 811 | 2857471914 | |||
| 812 | 2857588023 | |||
| 813 | 2857590098 | |||
| 814 | 2857594028 | |||
| 815 | 2857594233 | |||
| 816 | 2857595352 | |||
| 817 | 2857604668 | |||
| 818 | 2857610475 | |||
| 819 | 2860840728 | |||
| 820 | 2864998124 | |||
| 821 | 2865005428 | |||
| 822 | 2877771644 | |||
| 823 | 2877771895 | |||
| 824 | 2880172488 | |||
| 825 | 2880172734 | |||
| 826 | 2881638207 | |||
| 827 | 2881648683 | |||
| 828 | 2888579622 | |||
| 829 | 2889048314 | |||
| 830 | 2889051758 | |||
| 831 | 2889277073 | |||
| 832 | 2889299086 | |||
| 833 | 2897112761 | |||
| 834 | 2897113010 | |||
| 835 | 2904113784 | |||
| 836 | 2904494571 | |||
| 837 | 2904524119 | |||
| 838 | 2904561331 | |||
| 839 | 2904564088 | |||
| 840 | 2904596240 | |||
| 841 | 2904607229 | |||
| 842 | 2904759001 | |||
| 843 | 2908667612 | |||
| 844 | 2915599703 | |||
| 845 | 2915599846 | |||
| 846 | 2915609293 | |||
| 847 | 2915609397 | |||
| 848 | 2919095406 | |||
| 849 | 2919147304 | |||
| 850 | 2919164281 | |||
| 851 | 2919419540 | |||
| 852 | 2919426210 | |||
| 853 | 2919429924 | |||
| 854 | 2919519209 | |||
| 855 | 2919723578 | |||
| 856 | 2919728886 | |||
| 857 | 2928095896 | |||
| 858 | 2928513765 | |||
| 859 | 2929006733 | |||
| 860 | 2929184863 | |||
| 861 | 2929185023 | |||
| 862 | 2929208083 | |||
| 863 | 2929238740 | |||
| 864 | 2931385431 | |||
| 865 | 2936345180 | |||
| 866 | 2936345516 | |||
| 867 | 2936362319 | |||
| 868 | 2938922945 | |||
| 869 | 2939594317 | |||
| 870 | 2939680387 | |||
| 871 | 2939703053 | |||
| 872 | 2945995929 | |||
| 873 | 2946058635 | |||
| 874 | 2947431822 | |||
| 875 | 2954773274 | |||
| 876 | 2960319515 | |||
| 877 | 2960381274 | |||
| 878 | 2962293949 | |||
| 879 | 2965766348 | |||
| 880 | 2969139934 | |||
| 881 | 2969144087 | |||
| 882 | 2969144446 | |||
| 883 | 2969769598 | |||
| 884 | 2969772662 | |||
| 885 | 2971412100 | |||
| 886 | 2971896310 | |||
| 887 | 2971896568 | |||
| 888 | 2977256116 | |||
| 889 | 2979088728 | |||
| 890 | 2980126069 | |||
| 891 | 2980186456 | |||
| 892 | 2980495722 | |||
| 893 | 2981288524 | |||
| 894 | 2981293345 | |||
| 895 | 2981983970 | |||
| 896 | 2981988893 | |||
| 897 | 2984531478 | |||
| 898 | 2984532732 | |||
| 899 | 2990276997 | |||
| 900 | 2996339999 | |||
| 901 | 2996710751 | |||
| 902 | 3001268851 | |||
| 903 | 3001274326 | |||
| 904 | 3006861738 | |||
| 905 | 3006882098 | |||
| 906 | 3006971687 | |||
| 907 | 3006982369 | |||
| 908 | 3006983284 | |||
| 909 | 3006984120 | |||
| 910 | 3006988514 | |||
| 911 | 648172498 | |||
| 912 | 8002317760 | |||
| 913 | 8022626531 | |||
| 914 | 8022632369 | |||
| 915 | 8022633160 | |||
| 916 | 8022654888 | |||
| 917 | 8022797811 | |||
| 918 | 8022898555 | |||
| 919 | 8022917705 | |||
| 920 | 8022950246 | |||
| 921 | 8023441171 | |||
| 922 | 8023448718 | |||
| 923 | 8046997057 | |||
| 924 | 8051954490 | |||
| 925 | 8051954739 | |||
| 926 | 8052175118 | |||
| 927 | 8052175428 | |||
| 928 | 8054280694 | |||
| 929 | 8055533782 | |||
| 930 | 8055632991 | |||
| 931 | 8055634393 | |||
| 932 | 8056535102 | |||
| 933 | 8057478016 | |||
| 934 | 8057587482 | |||
| 935 | 8057635906 | |||
| 936 | 8057981342 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n1q-assembly1.cif.gz_A | crystal structure of a dps protein from bacillus brevis | 0.9988 | 2 | 144 |
| 2d5k-assembly1.cif.gz_B | crystal structure of dps from staphylococcus aureus | 0.9973 | 3 | 144 |
| 1ji5-assembly1.cif.gz_A | dlp-1 from bacillus anthracis | 0.9969 | 5 | 144 |
| 1jig-assembly1.cif.gz_A | dlp-2 from bacillus anthracis | 0.9914 | 1 | 144 |
| 2chp-assembly1.cif.gz_A | crystal structure of the dodecameric ferritin mrga from b. subtilis 168 | 0.9871 | 2 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n1qA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9988 | 2 | 144 | 1.20.1260.10 |
| 1ji5D00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9984 | 5 | 144 | 1.20.1260.10 |
| 2chpA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9871 | 2 | 144 | 1.20.1260.10 |
| 2d5kD00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9844 | 1 | 144 | 1.20.1260.10 |
| 1qghA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9784 | 5 | 146 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q8RPQ2-F1-model_v4 | DNA protection during starvation protein 2 (EC 1.16.-.-) | 1.004 | 1 | 146 |
GO:0005737
GO:0006879 GO:0008199 GO:0016722 |
| AF-A0A2B4MTW8-F1-model_v4 | DNA starvation/stationary phase protection protein | 1.003 | 1 | 146 |
GO:0008199
GO:0016722 |
| AF-A0A7Z1JKD0-F1-model_v4 | deleted | 1.002 | 1 | 146 |
|
| AF-A0A4V5TWF2-F1-model_v4 | deleted | 1.002 | 26 | 146 |
|
| AF-A0A4Q9E074-F1-model_v4 | DNA starvation/stationary phase protection protein | 1.001 | 5 | 144 |
GO:0008199
|