F450161

General Info

Members Datasets Scaffolds Average Seq Length
469 298 936 147

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10000993|JGI25151J46595_1000099319
Length 168
Sequence MMVIHDFQIDFYIIRGGILMDTSISKTTVDVLNKQIADWNVLFVKLHNYHWYVKGSDFFTLHAKFEELYNEAILHIDVLAERVLIIGGKPIATMREYLDASGIEEANQRATSKEMVQDIVHNFNYLIEELKNGMEITTQESDFVTHDILSAIRKNLSKHIWMLNAYLS

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
62 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
63 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
64 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
73 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
74 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
75 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
76 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
77 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
80 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
84 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
113 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
122 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
123 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
124 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
125 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
126 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
127 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
128 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
129 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
130 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
131 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
132 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
133 2554235283 Bacillus safensis VK Isolate Rhizosphere
134 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
135 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
136 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
137 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
138 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
139 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
140 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
141 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
142 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
143 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
144 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
145 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
146 2643221729 Bacillus sp. Root11 Isolate Unclassified
147 2643221730 Bacillus sp. Root131 Isolate Unclassified
148 2643221731 Bacillus sp. Root147 Isolate Unclassified
149 2643221732 Bacillus sp. Root239 Isolate Unclassified
150 2643221735 Bacillus sp. Root920 Isolate Unclassified
151 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
152 2671180694 Paenibacillus sp. A3 Isolate Unclassified
153 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
154 2684622632 Bacillus cereus 905 Isolate Unclassified
155 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
156 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
157 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
158 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
159 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
160 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
161 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
162 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
163 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
164 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
165 2738541295 Bacillus sp. OK085 Isolate Unclassified
166 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
167 2738541358 Bacillus sp. OV752 Isolate Unclassified
168 2738543006 Bacillus sp. OK077 Isolate Unclassified
169 2738543010 Bacillus sp. YR335 Isolate Unclassified
170 2738543017 Bacillus sp. OV186 Isolate Unclassified
171 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
172 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
173 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
174 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
175 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
176 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
177 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
178 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
179 2811994870 Bacillus sp. JB4 Isolate Unclassified
180 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
181 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
182 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
183 2818991459 Paenibacillus sp. 597 Isolate Unclassified
184 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
185 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
186 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
187 2842882022 Bacillus sp. R-71893 Isolate Unclassified
188 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
189 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
190 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
191 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
192 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
193 2857586860 Bacillus sp. R-71935 Isolate Unclassified
194 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
195 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
196 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
197 2860837431 Bacillus sp. WR11 Isolate Unclassified
198 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
199 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
200 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
201 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
202 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
203 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
204 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
205 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
206 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
207 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
208 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
209 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
210 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
211 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
212 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
213 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
214 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
215 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
216 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
217 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
218 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
219 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
220 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
221 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
222 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
223 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
224 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
225 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
226 2919720352 Priestia megaterium 4340 Isolate Unclassified
227 2919726948 Bacillus pumilus 4489 Isolate Unclassified
228 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
229 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
230 2929004312 Priestia megaterium 1104 Isolate Unclassified
231 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
232 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
233 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
234 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
235 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
236 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
237 2938917290 Bacillus sp. CR71 Isolate Unclassified
238 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
239 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
240 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
241 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
242 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
243 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
244 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
245 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
246 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
247 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
248 2965761152 Bacillus sp. COPE52 Isolate Unclassified
249 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
250 2969141011 Bacillus velezensis MH25 Isolate Unclassified
251 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
252 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
253 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
254 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
255 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
256 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
257 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
258 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
259 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
260 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
261 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
262 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
263 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
264 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
265 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
266 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
267 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
268 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
269 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
270 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
271 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
272 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
273 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
274 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
275 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
276 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
277 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
278 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
279 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
280 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
281 8022653035 Bacillus sp. Rc4 Isolate Unclassified
282 8022792930 Bacillus sp. Xin Isolate Rhizosphere
283 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
284 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
285 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
286 8023438354 Bacillus sp. BH2 Isolate Unclassified
287 8023444577 Bacillus sp. BH32 Isolate Unclassified
288 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
289 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
290 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
291 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
292 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
293 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
294 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
295 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
296 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
297 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
298 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 51.81
Metatranscriptomes 2.13
Isolates 46.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 13.43
Nodule 0.43
Rhizoplane 6.4
Rhizosphere 47.12
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000993 3300003187 Bacteria 21429
2 JGI25159J45721_1009471 3300002987 Bacteria 2566
3 JGI25151J46595_10000302 3300003187 Bacteria 54102
4 JGI25151J46595_10000747 3300003187 Bacteria 26539
5 JGI25151J46595_10012089 3300003187 Bacteria 3937
6 JGI25151J46595_10013071 3300003187 Bacteria 3747
7 JGI25151J46595_10022227 3300003187 Unclassified 2637
8 JGI25151J46595_10023653 3300003187 Bacteria 2526
9 JGI25151J46595_10076031 3300003187 Bacteria 994
10 JGI25151J46595_10082623 3300003187 Bacteria 924
11 JGI25151J46595_10137708 3300003187 Bacteria 599
12 rootH2_10041601 3300003320 Bacteria 4322
13 rootL2_10013974 3300003322 Bacteria 148551
14 rootH1_10364009 3300003323 Bacteria 4424
15 Ga0006562J51391_1000700 3300003578 Bacteria 6310
16 Ga0006562J51391_1010313 3300003578 Bacteria 611
17 Ga0006562J51391_1017394 3300003578 Bacteria 1268
18 Ga0055538_1000108 3300003751 Bacteria 65433
19 Ga0055532_1000024 3300003758 Bacteria 244166
20 Ga0055532_1000060 3300003758 Bacteria 150321
21 Ga0055532_1000610 3300003758 Bacteria 14303
22 Ga0055532_1000756 3300003758 Bacteria 11602
23 Ga0055532_1002278 3300003758 Bacteria 4158
24 Ga0055536_1002691 3300003781 Bacteria 9864
25 Ga0055536_1009624 3300003781 Bacteria 3963
26 Ga0055536_1014101 3300003781 Bacteria 2831
27 Ga0055528_1003904 3300003790 Bacteria 7324
28 Ga0070669_100176684 3300005353 Bacteria 1668
29 Ga0070669_100551787 3300005353 Bacteria 961
30 Ga0070675_100528416 3300005354 Bacteria 1065
31 Ga0070671_100038401 3300005355 Bacteria 3975
32 Ga0070715_10545523 3300006163 Bacteria 671
33 Ga0075431_101171014 3300006847 Bacteria 732
34 Ga0105251_10008147 3300009011 Bacteria 6340
35 Ga0105251_10088663 3300009011 Bacteria 1423
36 Ga0105244_10002902 3300009036 Bacteria 12656
37 Ga0105244_10018217 3300009036 Bacteria 3947
38 Ga0105244_10065935 3300009036 Bacteria 1813
39 Ga0105244_10114274 3300009036 Bacteria 1311
40 Ga0105244_10364364 3300009036 Bacteria 666
41 Ga0105250_10005299 3300009092 Bacteria 5791
42 Ga0105250_10141303 3300009092 Bacteria 998
43 Ga0105250_10530617 3300009092 Bacteria 537
44 Ga0105245_10292446 3300009098 Bacteria 1596
45 Ga0105247_10018143 3300009101 Bacteria 4220
46 Ga0105243_10001879 3300009148 Bacteria 17893
47 Ga0105243_10373872 3300009148 Bacteria 1316
48 Ga0105242_10079962 3300009176 Bacteria 2731
49 Ga0105249_10295242 3300009553 Bacteria 1623
50 Ga0105239_10201252 3300010375 Bacteria 2231
51 Ga0105246_10008815 3300011119 Bacteria 6208
52 Ga0105246_10018365 3300011119 Bacteria 4457
53 Ga0105246_11786271 3300011119 Bacteria 587
54 Ga0157378_10002050 3300013297 Bacteria 18043
55 Ga0163163_11551489 3300014325 Bacteria 723
56 Ga0157377_10007811 3300014745 Bacteria 5183
57 Ga0157376_10064061 3300014969 Bacteria 3099
58 Ga0209784_100100 3300025224 Bacteria 101657
59 Ga0209566_100139 3300025225 Bacteria 89273
60 Ga0209566_109691 3300025225 Unclassified 995
61 Ga0209147_100020 3300025229 Bacteria 474055
62 Ga0209147_100054 3300025229 Bacteria 266796
63 Ga0209147_100080 3300025229 Bacteria 196308
64 Ga0209147_100312 3300025229 Bacteria 37771
65 Ga0209147_103242 3300025229 Bacteria 3302
66 Ga0209147_110966 3300025229 Bacteria 1017
67 Ga0209437_101010 3300025233 Bacteria 9730
68 Ga0209673_1008737 3300025273 Bacteria 4477
69 Ga0209130_1000320 3300025284 Bacteria 56333
70 Ga0209130_1004430 3300025284 Bacteria 5331
71 Ga0209130_1026010 3300025284 Bacteria 1260
72 Ga0209675_1007411 3300025291 Bacteria 4212
73 Ga0209675_1010349 3300025291 Bacteria 3193
74 Ga0209675_1054879 3300025291 Bacteria 807
75 Ga0209676_1000274 3300025292 Bacteria 107505
76 Ga0209676_1000597 3300025292 Bacteria 53358
77 Ga0209676_1009235 3300025292 Bacteria 4281
78 Ga0209676_1054856 3300025292 Bacteria 1024
79 Ga0209676_1090739 3300025292 Bacteria 672
80 Ga0209025_1000001 3300025294 Bacteria 1888151
81 Ga0209025_1000043 3300025294 Bacteria 350458
82 Ga0209025_1000170 3300025294 Bacteria 160659
83 Ga0209025_1000262 3300025294 Bacteria 123617
84 Ga0209025_1000433 3300025294 Bacteria 82715
85 Ga0209025_1001857 3300025294 Bacteria 24772
86 Ga0209025_1002061 3300025294 Bacteria 22834
87 Ga0209025_1002449 3300025294 Bacteria 19620
88 Ga0209025_1003052 3300025294 Bacteria 16484
89 Ga0209025_1005266 3300025294 Bacteria 10643
90 Ga0209025_1006096 3300025294 Bacteria 9524
91 Ga0209025_1008528 3300025294 Bacteria 7362
92 Ga0209025_1009239 3300025294 Bacteria 6911
93 Ga0209025_1009914 3300025294 Bacteria 6547
94 Ga0209025_1014353 3300025294 Bacteria 4881
95 Ga0209025_1035613 3300025294 Bacteria 2246
96 Ga0209025_1073727 3300025294 Bacteria 1195
97 Ga0209025_1089466 3300025294 Bacteria 1012
98 Ga0207426_1060439 3300025302 Bacteria 1092
99 Ga0207696_1000479 3300025711 Bacteria 33975
100 Ga0207696_1001916 3300025711 Bacteria 10585
101 Ga0207696_1002758 3300025711 Bacteria 8349
102 Ga0207655_1017140 3300025728 Bacteria 3920
103 Ga0207655_1033821 3300025728 Bacteria 2310
104 Ga0207655_1073141 3300025728 Bacteria 1265
105 Ga0207713_1004372 3300025735 Bacteria 9182
106 Ga0207713_1034826 3300025735 Bacteria 2182
107 Ga0207713_1040714 3300025735 Bacteria 1947
108 Ga0207713_1048472 3300025735 Bacteria 1710
109 Ga0207713_1064818 3300025735 Bacteria 1374
110 Ga0207710_10033695 3300025900 Bacteria 2248
111 Ga0207645_10559827 3300025907 Bacteria 776
112 Ga0207681_10060786 3300025923 Bacteria 2595
113 Ga0207681_10394181 3300025923 Bacteria 1117
114 Ga0207650_10293087 3300025925 Bacteria 1327
115 Ga0207659_10281347 3300025926 Bacteria 1360
116 Ga0207659_10982227 3300025926 Bacteria 726
117 Ga0207687_10435845 3300025927 Bacteria 1084
118 Ga0207686_10048175 3300025934 Bacteria 2639
119 Ga0207709_10016523 3300025935 Bacteria 4103
120 Ga0207709_11097608 3300025935 Bacteria 653
121 Ga0207712_10451146 3300025961 Bacteria 1090
122 Ga0268266_10884380 3300028379 Bacteria 864
123 Ga0237817_10024 3300030083 Bacteria 61782
124 Ga0237817_10986 3300030083 Bacteria 1758
125 Ga0237817_11186 3300030083 Bacteria 1449
126 Ga0307408_100354316 3300031548 Bacteria 1246
127 Ga0307408_101729494 3300031548 Bacteria 596
128 Ga0307405_11541321 3300031731 Bacteria 585
129 Ga0307410_11635480 3300031852 Bacteria 570
130 Ga0307409_100011167 3300031995 Bacteria 5642
131 Ga0307409_100779355 3300031995 Bacteria 962
132 Ga0307416_100014947 3300032002 Bacteria 5341
133 Ga0307416_100242127 3300032002 Bacteria 1749
134 Ga0395900_0787099 3300037418 Bacteria 880
135 Ga0395898_1123493 3300037466 Unclassified 719
136 Ga0237819_00348 3300038705 Bacteria 16676
137 Ga0237819_00577 3300038705 Bacteria 12294
138 Ga0439436_0003912 3300041404 Bacteria 4566
139 Ga0439439_0001486 3300041406 Bacteria 4687
140 Ga0439433_0019101 3300041999 Bacteria 1526
141 Ga0439449_0001726 3300042007 Bacteria 8592
142 Ga0439449_0031323 3300042007 Bacteria 1982
143 Ga0439457_006140 3300042014 Bacteria 2964
144 Ga0439462_0009116 3300042015 Bacteria 2509
145 Ga0439462_0049205 3300042015 Bacteria 1131
146 Ga0466969_0001169 3300044656 Bacteria 14137
147 Ga0466967_0009686 3300045976 Bacteria 7169
148 Ga0466967_0212078 3300045976 Bacteria 1837
149 Ga0466967_1236348 3300045976 Bacteria 744
150 Ga0495603_0064131 3300046455 Bacteria 2166
151 Ga0495584_0044049 3300046491 Bacteria 2252
152 Ga0495585_0008512 3300046492 Bacteria 6215
153 Ga0495637_0138253 3300046520 Bacteria 926
154 Ga0495654_0074503 3300046530 Bacteria 1603
155 Ga0495597_0275085 3300046542 Bacteria 657
156 Ga0495633_0234228 3300046558 Bacteria 839
157 Ga0495611_0199652 3300046648 Bacteria 933
158 Ga0495661_0051259 3300046665 Bacteria 2493
159 Ga0495661_0068887 3300046665 Bacteria 2075
160 Ga0495661_0107384 3300046665 Bacteria 1561
161 Ga0495670_0039371 3300046691 Bacteria 2358
162 Ga0495649_0287622 3300046694 Bacteria 839
163 Ga0495660_0031812 3300046810 Bacteria 2965
164 Ga0495676_0058790 3300047321 Bacteria 3023
165 Ga0495683_0096267 3300047323 Bacteria 1428
166 Ga0495626_0124350 3300048091 Unclassified 1106
167 Ga0495626_0191172 3300048091 Bacteria 844
168 Ga0495626_0300586 3300048091 Bacteria 634
169 Ga0496100_0000519 3300048903 Bacteria 18430
170 Ga0496101_0007109 3300048904 Bacteria 7237
171 Ga0496102_0001666 3300048905 Bacteria 19511
172 Ga0496102_0018785 3300048905 Bacteria 6080
173 Ga0496102_0058745 3300048905 Bacteria 3515
174 Ga0496102_0841706 3300048905 Bacteria 840
175 Ga0496103_0001204 3300048906 Bacteria 17760
176 Ga0496103_0122348 3300048906 Bacteria 1658
177 Ga0496104_0000832 3300048907 Bacteria 26638
178 Ga0496105_0000067 3300048908 Bacteria 82959
179 Ga0496106_0002301 3300048909 Bacteria 14244
180 Ga0496106_1050127 3300048909 Bacteria 640
181 Ga0496107_0000724 3300048910 Bacteria 18866
182 Ga0496108_0003318 3300048911 Bacteria 12929
183 Ga0496109_0000906 3300048912 Bacteria 24668
184 Ga0496110_0009002 3300048913 Bacteria 8053
185 Ga0496110_0014535 3300048913 Bacteria 6541
186 Ga0496110_0487214 3300048913 Bacteria 1123
187 Ga0496110_1566952 3300048913 Bacteria 569
188 Ga0496111_0002271 3300048914 Bacteria 11544
189 Ga0496111_0593968 3300048914 Bacteria 811
190 Ga0496111_0807238 3300048914 Bacteria 679
191 Ga0496112_0000487 3300048915 Bacteria 26669
192 Ga0496112_0093707 3300048915 Bacteria 2973
193 Ga0496113_0003580 3300048916 Bacteria 9323
194 Ga0496116_0005397 3300048919 Bacteria 11893
195 Ga0496116_0017773 3300048919 Bacteria 5507
196 Ga0496116_0117296 3300048919 Bacteria 1549
197 Ga0496116_0124041 3300048919 Bacteria 1487
198 Ga0496116_0299540 3300048919 Bacteria 766
199 Ga0496116_0326914 3300048919 Bacteria 715
200 Ga0496116_0379933 3300048919 Bacteria 634
201 Ga0496117_0020517 3300048920 Bacteria 5382
202 Ga0496117_0048432 3300048920 Bacteria 3036
203 Ga0496118_0008899 3300048921 Bacteria 10261
204 Ga0496119_0000670 3300048922 Bacteria 45979
205 Ga0496119_0022894 3300048922 Bacteria 4452
206 Ga0496120_0022182 3300048923 Bacteria 3997
207 Ga0496120_0024343 3300048923 Bacteria 3777
208 Ga0496121_0060975 3300048924 Bacteria 3098
209 Ga0496121_0081829 3300048924 Bacteria 2554
210 Ga0496121_0752508 3300048924 Bacteria 579
211 Ga0496122_0048200 3300048925 Bacteria 3279
212 Ga0496122_0058381 3300048925 Bacteria 2857
213 Ga0496122_0067091 3300048925 Bacteria 2586
214 Ga0496122_0074795 3300048925 Bacteria 2394
215 Ga0496122_0078545 3300048925 Bacteria 2311
216 Ga0496122_0162524 3300048925 Bacteria 1359
217 Ga0496122_0190162 3300048925 Bacteria 1213
218 Ga0496122_0197788 3300048925 Bacteria 1179
219 Ga0496122_0205444 3300048925 Bacteria 1147
220 Ga0496122_0338720 3300048925 Unclassified 791
221 Ga0496123_0002651 3300048926 Bacteria 21637
222 Ga0496123_0133558 3300048926 Bacteria 1370
223 Ga0496123_0142086 3300048926 Bacteria 1310
224 Ga0496124_0001526 3300048927 Bacteria 33706
225 Ga0496124_0027966 3300048927 Bacteria 5050
226 Ga0496124_0029177 3300048927 Bacteria 4921
227 Ga0496124_0032984 3300048927 Bacteria 4564
228 Ga0496124_0041193 3300048927 Bacteria 3989
229 Ga0496124_0084868 3300048927 Bacteria 2596
230 Ga0496125_0001139 3300048928 Bacteria 40438
231 Ga0496125_0004357 3300048928 Bacteria 16406
232 Ga0496125_0060292 3300048928 Bacteria 3051
233 Ga0496125_0304031 3300048928 Bacteria 976
234 Ga0496126_0004828 3300048929 Bacteria 15811
235 Ga0496126_0028467 3300048929 Bacteria 5324
236 Ga0501343_003373 3300049132 Bacteria 1172
237 Ga0501305_058946 3300049161 Bacteria 657
238 Ga0501291_101265 3300049514 Bacteria 601
239 Ga0501315_003493 3300049531 Bacteria 1578
240 Ga0501315_074638 3300049531 Bacteria 568
241 Ga0501317_105235 3300049533 Bacteria 513
242 Ga0501332_03837 3300049548 Bacteria 878
243 Ga0501337_022057 3300049553 Bacteria 523
244 Ga0501031_0501427 3300049568 Bacteria 783
245 Ga0501042_0988864 3300049578 Bacteria 613
246 Ga0501076_1636551 3300049592 Bacteria 528
247 Ga0501077_0671615 3300049593 Bacteria 666
248 Ga0501198_032177 3300049649 Bacteria 880
249 Ga0501217_010691 3300049661 Bacteria 2016
250 Ga0501217_114150 3300049661 Bacteria 778
251 Ga0501253_157496 3300049683 Bacteria 577
252 Ga0501221_008626 3300049704 Bacteria 1776
253 2511177942 2510917027 Bacteria 5287437
254 2511180179 2510917027 Bacteria 5287437
255 2511700728 2511231119 Bacteria 4019861
256 2511701008 2511231119 Bacteria 4019861
257 2512638344 2512564013 Bacteria 6286191
258 2512639830 2512564013 Bacteria 6286191
259 2512731828 2512564039 Bacteria 8739048
260 2512736790 2512564039 Bacteria 8739048
261 2524188752 2524023129 Bacteria 6762600
262 2524189200 2524023129 Bacteria 6762600
263 2540607946 2540341094 Bacteria 4061186
264 2545557425 2545555800 Bacteria 4222588
265 2545559471 2545555800 Bacteria 4222588
266 2553397059 2551306519 Bacteria 5465154
267 2555470013 2554235283 Bacteria 3683090
268 2556062574 2554235469 Bacteria 3590176
269 2578930427 2576861599 Bacteria 4217202
270 2578931692 2576861599 Bacteria 4217202
271 2580930867 2579778775 Bacteria 5360914
272 2587739673 2585428059 Bacteria 8696589
273 2587740817 2585428059 Bacteria 8696589
274 2587741848 2585428059 Bacteria 8696589
275 2595090068 2593339131 Bacteria 5116855
276 2595091392 2593339131 Bacteria 5116855
277 2595317335 2593339198 Bacteria 7267884
278 2600199721 2599185353 Bacteria 2219443
279 2600402702 2600254943 Bacteria 2613887
280 2601639865 2600255286 Bacteria 5390125
281 2621273736 2619619294 Bacteria 5575484
282 2631986333 2630968484 Bacteria 3876276
283 2631986470 2630968484 Bacteria 3876276
284 2644424704 2643221676 Bacteria 8119172
285 2644426140 2643221676 Bacteria 8119172
286 2644427781 2643221676 Bacteria 8119172
287 2644707359 2643221729 Bacteria 6621700
288 2644714316 2643221730 Bacteria 6523787
289 2644715446 2643221731 Bacteria 5623886
290 2644726749 2643221732 Bacteria 5756404
291 2644740374 2643221735 Bacteria 3676263
292 2651530626 2648501850 Bacteria 3975476
293 2651532554 2648501850 Bacteria 3975476
294 2673818086 2671180694 Bacteria 7506943
295 2674418449 2671180844 Bacteria 4164150
296 2674422052 2671180844 Bacteria 4164150
297 2685153020 2684622632 Bacteria 5380049
298 2686998021 2684623153 Bacteria 3878815
299 2687499367 2687453109 Bacteria 3860091
300 2695628718 2695420354 Bacteria 3922431
301 2695628963 2695420354 Bacteria 3922431
302 2698320161 2695420987 Bacteria 6152737
303 2705996949 2703719227 Bacteria 5631989
304 2712197813 2711768088 Bacteria 3195027
305 2717915337 2716884898 Bacteria 3928789
306 2717915587 2716884898 Bacteria 3928789
307 2721508168 2718218445 Bacteria 5113413
308 2723606519 2721755693 Bacteria 6126117
309 2730137115 2728369359 Bacteria 5621728
310 2738816877 2738541295 Bacteria 5730091
311 2738840596 2738541299 Bacteria 4020721
312 2739157205 2738541358 Bacteria 5932299
313 2739209045 2738543006 Bacteria 5904091
314 2739234552 2738543010 Bacteria 5583595
315 2739269076 2738543017 Bacteria 4271950
316 2739271135 2738543017 Bacteria 4271950
317 2753808826 2751185905 Bacteria 6142767
318 2757566718 2757320391 Bacteria 4746095
319 2757567591 2757320391 Bacteria 4746095
320 2777760855 2775507177 Bacteria 4384303
321 2777761925 2775507177 Bacteria 4384303
322 2777836269 2775507192 Bacteria 4622234
323 2777838981 2775507192 Bacteria 4622234
324 2791212899 2788500588 Bacteria 4584915
325 2793183571 2791355222 Bacteria 5898266
326 2802437814 2802428803 Bacteria 5806948
327 2809056314 2808606399 Bacteria 4021018
328 2812317220 2811994870 Bacteria 3776934
329 2817481314 2816332295 Bacteria 4352468
330 2819582482 2818991443 Bacteria 6598732
331 2819625265 2818991451 Bacteria 4697364
332 2819672098 2818991459 Bacteria 8736032
333 2819675290 2818991459 Bacteria 8736032
334 2819708914 2818991465 Bacteria 5388835
335 2819724296 2818991468 Bacteria 3723169
336 2823529185 2823526263 Bacteria 3765752
337 2842884851 2842882022 Bacteria 6158489
338 2852676331 2852673933 Bacteria 3347676
339 2857362322 2857357740 Bacteria 9937880
340 2857455882 2857453340 Bacteria 8090534
341 2857460618 2857460504 Bacteria 5194327
342 2857470328 2857465823 Bacteria 6772595
343 2857471914 2857465823 Bacteria 6772595
344 2857588023 2857586860 Bacteria 4354574
345 2857590098 2857586860 Bacteria 4354574
346 2857594028 2857591370 Bacteria 6569758
347 2857594233 2857591370 Bacteria 6569758
348 2857595352 2857591370 Bacteria 6569758
349 2857604668 2857604169 Bacteria 5111450
350 2857610475 2857609550 Bacteria 3753890
351 2860840728 2860837431 Bacteria 4202080
352 2864998124 2864997549 Bacteria 5139696
353 2865005428 2865002811 Bacteria 6333767
354 2877771644 2877768649 Bacteria 3957164
355 2877771895 2877768649 Bacteria 3957164
356 2880172488 2880169592 Bacteria 3900066
357 2880172734 2880169592 Bacteria 3900066
358 2881638207 2881636855 Bacteria 5205297
359 2881648683 2881644220 Bacteria 5302661
360 2888579622 2888578766 Bacteria 6743310
361 2889048314 2889042446 Bacteria 7618936
362 2889051758 2889049205 Bacteria 7524325
363 2889277073 2889276214 Bacteria 5979355
364 2889299086 2889295896 Bacteria 4704906
365 2897112761 2897109615 Bacteria 4009619
366 2897113010 2897109615 Bacteria 4009619
367 2904113784 2904113452 Bacteria 7796941
368 2904494571 2904490793 Bacteria 7046938
369 2904524119 2904524088 Bacteria 5887454
370 2904561331 2904560550 Bacteria 4029838
371 2904564088 2904560550 Bacteria 4029838
372 2904596240 2904595352 Bacteria 6124848
373 2904607229 2904606771 Bacteria 4684500
374 2904759001 2904755435 Bacteria 7986759
375 2908667612 2908665501 Bacteria 3678115
376 2915599703 2915597211 Bacteria 6475886
377 2915599846 2915597211 Bacteria 6475886
378 2915609293 2915606848 Bacteria 6032732
379 2915609397 2915606848 Bacteria 6032732
380 2919095406 2919093281 Bacteria 3660974
381 2919147304 2919143609 Bacteria 6219228
382 2919164281 2919160200 Bacteria 6929020
383 2919419540 2919414237 Bacteria 5429133
384 2919426210 2919425241 Bacteria 8055701
385 2919429924 2919425241 Bacteria 8055701
386 2919519209 2919517244 Bacteria 5858162
387 2919723578 2919720352 Bacteria 5986006
388 2919728886 2919726948 Bacteria 3696050
389 2928095896 2928093941 Bacteria 5965005
390 2928513765 2928510474 Bacteria 4815308
391 2929006733 2929004312 Bacteria 5678476
392 2929184863 2929183550 Bacteria 6377511
393 2929185023 2929183550 Bacteria 6377511
394 2929208083 2929206907 Bacteria 5918291
395 2929238740 2929233124 Bacteria 5948380
396 2931385431 2931384279 Bacteria 7299545
397 2936345180 2936340661 Bacteria 5139038
398 2936345516 2936340661 Bacteria 5139038
399 2936362319 2936361878 Bacteria 5632809
400 2938922945 2938917290 Bacteria 5914775
401 2939594317 2939593269 Bacteria 4798695
402 2939680387 2939679117 Bacteria 6921672
403 2939703053 2939702853 Bacteria 5139229
404 2945995929 2945991243 Bacteria 7008369
405 2946058635 2946053406 Bacteria 6978655
406 2947431822 2947426588 Bacteria 5357194
407 2954773274 2954773129 Bacteria 3741715
408 2960319515 2960319331 Bacteria 5502575
409 2960381274 2960375949 Bacteria 5361395
410 2962293949 2962290636 Bacteria 4072939
411 2965766348 2965761152 Bacteria 5806513
412 2969139934 2969136845 Bacteria 3923176
413 2969144087 2969141011 Bacteria 4118468
414 2969144446 2969141011 Bacteria 4118468
415 2969769598 2969765954 Bacteria 4216713
416 2969772662 2969770375 Bacteria 4271280
417 2971412100 2971410472 Bacteria 8311090
418 2971896310 2971893375 Bacteria 3929648
419 2971896568 2971893375 Bacteria 3929648
420 2977256116 2977254563 Bacteria 4828420
421 2979088728 2979083700 Bacteria 5894929
422 2980126069 2980125574 Bacteria 5567337
423 2980186456 2980182181 Bacteria 9454109
424 2980495722 2980492589 Bacteria 4072961
425 2981288524 2981284811 Bacteria 4641497
426 2981293345 2981289755 Bacteria 4641509
427 2981983970 2981980479 Bacteria 4641628
428 2981988893 2981985349 Bacteria 4641497
429 2984531478 2984527788 Bacteria 5288478
430 2984532732 2984532647 Bacteria 5288506
431 2990276997 2990275345 Bacteria 4887158
432 2996339999 2996336353 Bacteria 5511628
433 2996710751 2996706504 Bacteria 5757485
434 3001268851 3001267043 Bacteria 4823521
435 3001274326 3001272096 Bacteria 4729684
436 3006861738 3006858327 Bacteria 4317835
437 3006882098 3006879489 Bacteria 4064221
438 3006971687 3006969106 Bacteria 4739423
439 3006982369 3006978542 Bacteria 5328100
440 3006983284 3006978542 Bacteria 5328100
441 3006984120 3006984091 Bacteria 4207523
442 3006988514 3006988479 Bacteria 4767936
443 648172498 648028048 Bacteria 5394884
444 8002317760 8002317523 Bacteria 8051857
445 8022626531 8022621104 Bacteria 5241040
446 8022632369 8022630665 Bacteria 3886130
447 8022633160 8022630665 Bacteria 3886130
448 8022654888 8022653035 Bacteria 4035078
449 8022797811 8022792930 Bacteria 5693794
450 8022898555 8022893055 Bacteria 5300455
451 8022917705 8022914991 Bacteria 5584517
452 8022950246 8022948649 Bacteria 5366783
453 8023441171 8023438354 Bacteria 5779374
454 8023448718 8023444577 Bacteria 5661597
455 8046997057 8046991243 Bacteria 8497463
456 8051954490 8051952484 Bacteria 3926774
457 8051954739 8051952484 Bacteria 3926774
458 8052175118 8052174270 Bacteria 3881265
459 8052175428 8052174270 Bacteria 3881265
460 8054280694 8054280661 Bacteria 4232245
461 8055533782 8055531788 Bacteria 5249694
462 8055632991 8055632911 Bacteria 5283357
463 8055634393 8055632911 Bacteria 5283357
464 8056535102 8056533031 Bacteria 8964429
465 8057478016 8057473075 Bacteria 5892720
466 8057587482 8057582654 Bacteria 5218944
467 8057635906 8057632132 Bacteria 4726859
468 8057981342 8057977335 Bacteria 5694872
469 JGI25151J46595_10000993
470 JGI25159J45721_1009471
471 JGI25151J46595_10000302
472 JGI25151J46595_10000747
473 JGI25151J46595_10012089
474 JGI25151J46595_10013071
475 JGI25151J46595_10022227
476 JGI25151J46595_10023653
477 JGI25151J46595_10076031
478 JGI25151J46595_10082623
479 JGI25151J46595_10137708
480 rootH2_10041601
481 rootL2_10013974
482 rootH1_10364009
483 Ga0006562J51391_1000700
484 Ga0006562J51391_1010313
485 Ga0006562J51391_1017394
486 Ga0055538_1000108
487 Ga0055532_1000024
488 Ga0055532_1000060
489 Ga0055532_1000610
490 Ga0055532_1000756
491 Ga0055532_1002278
492 Ga0055536_1002691
493 Ga0055536_1009624
494 Ga0055536_1014101
495 Ga0055528_1003904
496 Ga0070669_100176684
497 Ga0070669_100551787
498 Ga0070675_100528416
499 Ga0070671_100038401
500 Ga0070715_10545523
501 Ga0075431_101171014
502 Ga0105251_10008147
503 Ga0105251_10088663
504 Ga0105244_10002902
505 Ga0105244_10018217
506 Ga0105244_10065935
507 Ga0105244_10114274
508 Ga0105244_10364364
509 Ga0105250_10005299
510 Ga0105250_10141303
511 Ga0105250_10530617
512 Ga0105245_10292446
513 Ga0105247_10018143
514 Ga0105243_10001879
515 Ga0105243_10373872
516 Ga0105242_10079962
517 Ga0105249_10295242
518 Ga0105239_10201252
519 Ga0105246_10008815
520 Ga0105246_10018365
521 Ga0105246_11786271
522 Ga0157378_10002050
523 Ga0163163_11551489
524 Ga0157377_10007811
525 Ga0157376_10064061
526 Ga0209784_100100
527 Ga0209566_100139
528 Ga0209566_109691
529 Ga0209147_100020
530 Ga0209147_100054
531 Ga0209147_100080
532 Ga0209147_100312
533 Ga0209147_103242
534 Ga0209147_110966
535 Ga0209437_101010
536 Ga0209673_1008737
537 Ga0209130_1000320
538 Ga0209130_1004430
539 Ga0209130_1026010
540 Ga0209675_1007411
541 Ga0209675_1010349
542 Ga0209675_1054879
543 Ga0209676_1000274
544 Ga0209676_1000597
545 Ga0209676_1009235
546 Ga0209676_1054856
547 Ga0209676_1090739
548 Ga0209025_1000001
549 Ga0209025_1000043
550 Ga0209025_1000170
551 Ga0209025_1000262
552 Ga0209025_1000433
553 Ga0209025_1001857
554 Ga0209025_1002061
555 Ga0209025_1002449
556 Ga0209025_1003052
557 Ga0209025_1005266
558 Ga0209025_1006096
559 Ga0209025_1008528
560 Ga0209025_1009239
561 Ga0209025_1009914
562 Ga0209025_1014353
563 Ga0209025_1035613
564 Ga0209025_1073727
565 Ga0209025_1089466
566 Ga0207426_1060439
567 Ga0207696_1000479
568 Ga0207696_1001916
569 Ga0207696_1002758
570 Ga0207655_1017140
571 Ga0207655_1033821
572 Ga0207655_1073141
573 Ga0207713_1004372
574 Ga0207713_1034826
575 Ga0207713_1040714
576 Ga0207713_1048472
577 Ga0207713_1064818
578 Ga0207710_10033695
579 Ga0207645_10559827
580 Ga0207681_10060786
581 Ga0207681_10394181
582 Ga0207650_10293087
583 Ga0207659_10281347
584 Ga0207659_10982227
585 Ga0207687_10435845
586 Ga0207686_10048175
587 Ga0207709_10016523
588 Ga0207709_11097608
589 Ga0207712_10451146
590 Ga0268266_10884380
591 Ga0237817_10024
592 Ga0237817_10986
593 Ga0237817_11186
594 Ga0307408_100354316
595 Ga0307408_101729494
596 Ga0307405_11541321
597 Ga0307410_11635480
598 Ga0307409_100011167
599 Ga0307409_100779355
600 Ga0307416_100014947
601 Ga0307416_100242127
602 Ga0395900_0787099
603 Ga0395898_1123493
604 Ga0237819_00348
605 Ga0237819_00577
606 Ga0439436_0003912
607 Ga0439439_0001486
608 Ga0439433_0019101
609 Ga0439449_0001726
610 Ga0439449_0031323
611 Ga0439457_006140
612 Ga0439462_0009116
613 Ga0439462_0049205
614 Ga0466969_0001169
615 Ga0466967_0009686
616 Ga0466967_0212078
617 Ga0466967_1236348
618 Ga0495603_0064131
619 Ga0495584_0044049
620 Ga0495585_0008512
621 Ga0495637_0138253
622 Ga0495654_0074503
623 Ga0495597_0275085
624 Ga0495633_0234228
625 Ga0495611_0199652
626 Ga0495661_0051259
627 Ga0495661_0068887
628 Ga0495661_0107384
629 Ga0495670_0039371
630 Ga0495649_0287622
631 Ga0495660_0031812
632 Ga0495676_0058790
633 Ga0495683_0096267
634 Ga0495626_0124350
635 Ga0495626_0191172
636 Ga0495626_0300586
637 Ga0496100_0000519
638 Ga0496101_0007109
639 Ga0496102_0001666
640 Ga0496102_0018785
641 Ga0496102_0058745
642 Ga0496102_0841706
643 Ga0496103_0001204
644 Ga0496103_0122348
645 Ga0496104_0000832
646 Ga0496105_0000067
647 Ga0496106_0002301
648 Ga0496106_1050127
649 Ga0496107_0000724
650 Ga0496108_0003318
651 Ga0496109_0000906
652 Ga0496110_0009002
653 Ga0496110_0014535
654 Ga0496110_0487214
655 Ga0496110_1566952
656 Ga0496111_0002271
657 Ga0496111_0593968
658 Ga0496111_0807238
659 Ga0496112_0000487
660 Ga0496112_0093707
661 Ga0496113_0003580
662 Ga0496116_0005397
663 Ga0496116_0017773
664 Ga0496116_0117296
665 Ga0496116_0124041
666 Ga0496116_0299540
667 Ga0496116_0326914
668 Ga0496116_0379933
669 Ga0496117_0020517
670 Ga0496117_0048432
671 Ga0496118_0008899
672 Ga0496119_0000670
673 Ga0496119_0022894
674 Ga0496120_0022182
675 Ga0496120_0024343
676 Ga0496121_0060975
677 Ga0496121_0081829
678 Ga0496121_0752508
679 Ga0496122_0048200
680 Ga0496122_0058381
681 Ga0496122_0067091
682 Ga0496122_0074795
683 Ga0496122_0078545
684 Ga0496122_0162524
685 Ga0496122_0190162
686 Ga0496122_0197788
687 Ga0496122_0205444
688 Ga0496122_0338720
689 Ga0496123_0002651
690 Ga0496123_0133558
691 Ga0496123_0142086
692 Ga0496124_0001526
693 Ga0496124_0027966
694 Ga0496124_0029177
695 Ga0496124_0032984
696 Ga0496124_0041193
697 Ga0496124_0084868
698 Ga0496125_0001139
699 Ga0496125_0004357
700 Ga0496125_0060292
701 Ga0496125_0304031
702 Ga0496126_0004828
703 Ga0496126_0028467
704 Ga0501343_003373
705 Ga0501305_058946
706 Ga0501291_101265
707 Ga0501315_003493
708 Ga0501315_074638
709 Ga0501317_105235
710 Ga0501332_03837
711 Ga0501337_022057
712 Ga0501031_0501427
713 Ga0501042_0988864
714 Ga0501076_1636551
715 Ga0501077_0671615
716 Ga0501198_032177
717 Ga0501217_010691
718 Ga0501217_114150
719 Ga0501253_157496
720 Ga0501221_008626
721 2511177942
722 2511180179
723 2511700728
724 2511701008
725 2512638344
726 2512639830
727 2512731828
728 2512736790
729 2524188752
730 2524189200
731 2540607946
732 2545557425
733 2545559471
734 2553397059
735 2555470013
736 2556062574
737 2578930427
738 2578931692
739 2580930867
740 2587739673
741 2587740817
742 2587741848
743 2595090068
744 2595091392
745 2595317335
746 2600199721
747 2600402702
748 2601639865
749 2621273736
750 2631986333
751 2631986470
752 2644424704
753 2644426140
754 2644427781
755 2644707359
756 2644714316
757 2644715446
758 2644726749
759 2644740374
760 2651530626
761 2651532554
762 2673818086
763 2674418449
764 2674422052
765 2685153020
766 2686998021
767 2687499367
768 2695628718
769 2695628963
770 2698320161
771 2705996949
772 2712197813
773 2717915337
774 2717915587
775 2721508168
776 2723606519
777 2730137115
778 2738816877
779 2738840596
780 2739157205
781 2739209045
782 2739234552
783 2739269076
784 2739271135
785 2753808826
786 2757566718
787 2757567591
788 2777760855
789 2777761925
790 2777836269
791 2777838981
792 2791212899
793 2793183571
794 2802437814
795 2809056314
796 2812317220
797 2817481314
798 2819582482
799 2819625265
800 2819672098
801 2819675290
802 2819708914
803 2819724296
804 2823529185
805 2842884851
806 2852676331
807 2857362322
808 2857455882
809 2857460618
810 2857470328
811 2857471914
812 2857588023
813 2857590098
814 2857594028
815 2857594233
816 2857595352
817 2857604668
818 2857610475
819 2860840728
820 2864998124
821 2865005428
822 2877771644
823 2877771895
824 2880172488
825 2880172734
826 2881638207
827 2881648683
828 2888579622
829 2889048314
830 2889051758
831 2889277073
832 2889299086
833 2897112761
834 2897113010
835 2904113784
836 2904494571
837 2904524119
838 2904561331
839 2904564088
840 2904596240
841 2904607229
842 2904759001
843 2908667612
844 2915599703
845 2915599846
846 2915609293
847 2915609397
848 2919095406
849 2919147304
850 2919164281
851 2919419540
852 2919426210
853 2919429924
854 2919519209
855 2919723578
856 2919728886
857 2928095896
858 2928513765
859 2929006733
860 2929184863
861 2929185023
862 2929208083
863 2929238740
864 2931385431
865 2936345180
866 2936345516
867 2936362319
868 2938922945
869 2939594317
870 2939680387
871 2939703053
872 2945995929
873 2946058635
874 2947431822
875 2954773274
876 2960319515
877 2960381274
878 2962293949
879 2965766348
880 2969139934
881 2969144087
882 2969144446
883 2969769598
884 2969772662
885 2971412100
886 2971896310
887 2971896568
888 2977256116
889 2979088728
890 2980126069
891 2980186456
892 2980495722
893 2981288524
894 2981293345
895 2981983970
896 2981988893
897 2984531478
898 2984532732
899 2990276997
900 2996339999
901 2996710751
902 3001268851
903 3001274326
904 3006861738
905 3006882098
906 3006971687
907 3006982369
908 3006983284
909 3006984120
910 3006988514
911 648172498
912 8002317760
913 8022626531
914 8022632369
915 8022633160
916 8022654888
917 8022797811
918 8022898555
919 8022917705
920 8022950246
921 8023441171
922 8023448718
923 8046997057
924 8051954490
925 8051954739
926 8052175118
927 8052175428
928 8054280694
929 8055533782
930 8055632991
931 8055634393
932 8056535102
933 8057478016
934 8057587482
935 8057635906
936 8057981342

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

29

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n1q-assembly1.cif.gz_A crystal structure of a dps protein from bacillus brevis 0.9988 2 144
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.9973 3 144
1ji5-assembly1.cif.gz_A dlp-1 from bacillus anthracis 0.9969 5 144
1jig-assembly1.cif.gz_A dlp-2 from bacillus anthracis 0.9914 1 144
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.9871 2 144
ID Description Score Start End Superfamily
1n1qA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9988 2 144 1.20.1260.10
1ji5D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9984 5 144 1.20.1260.10
2chpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9871 2 144 1.20.1260.10
2d5kD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9844 1 144 1.20.1260.10
1qghA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9784 5 146 1.20.1260.10
ID Description Score Start End GO Terms
AF-Q8RPQ2-F1-model_v4 DNA protection during starvation protein 2 (EC 1.16.-.-) 1.004 1 146 GO:0005737
GO:0006879
GO:0008199
GO:0016722
AF-A0A2B4MTW8-F1-model_v4 DNA starvation/stationary phase protection protein 1.003 1 146 GO:0008199
GO:0016722
AF-A0A7Z1JKD0-F1-model_v4 deleted 1.002 1 146
AF-A0A4V5TWF2-F1-model_v4 deleted 1.002 26 146
AF-A0A4Q9E074-F1-model_v4 DNA starvation/stationary phase protection protein 1.001 5 144 GO:0008199

Map