F450097

General Info

Members Datasets Scaffolds Average Seq Length
468 210 449 181

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0011366|Ga0495590_0011366_2066_2650
Length 194
Sequence MKKLLLSAVLALGFTGIAVAEKADSYKPMEIKFDNLEVDDVKQQRIATGNVILTRGTLTMKAARAVVSQTPEGFQHVVLTGGGGKATFRQKRDGEGDQWVEGEAERIEYDENVELVKMFSKAKIKRLEGAKPSDEVEGEFISYDSRKEFFSVKNTTTGESKPGGGRGTMVIQPTRTAPPATXXXXTNPTPAAGK

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2738541297 Duganella sp. GV083 Isolate Unclassified
6 2738541300 Massilia sp. GV016 Isolate Unclassified
7 2738541357 Duganella sp. GV053 Isolate Unclassified
8 2738543003 Duganella sp. GV066 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543026 Duganella sp. GV089 Isolate Unclassified
11 2738543029 Duganella sp. GV039 Isolate Unclassified
12 2738543030 Massilia sp. GV097 Isolate Unclassified
13 2821131069 Duganella sp. 1224 Isolate Unclassified
14 2842711865 Duganella sp. R-73148 Isolate Unclassified
15 2857553236 Duganella sp. R-74557 Isolate Unclassified
16 2857558681 Duganella sp. R-74565 Isolate Unclassified
17 2857564685 Duganella sp. R-74599 Isolate Unclassified
18 2904424332 Duganella sp. 1411 Isolate Rhizosphere
19 2919476304 Duganella sp. 3397 Isolate Unclassified
20 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
109 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
204 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
207 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
210 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0.21
Isolates 4.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.25
Nodule 0.64
Rhizoplane 3.85
Rhizosphere 76.28
Stem 0
Stem Tuber 0
Unclassified 5.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001466 3300002739 Bacteria 4123
2 JGI25150J39212_1001314 3300002774 Bacteria 7066
3 JGI25150J39212_1003851 3300002774 Bacteria 3446
4 JGI25159J45721_1004172 3300002987 Bacteria 4887
5 JGI25151J46595_10073400 3300003187 Bacteria 1024
6 JGI25153J46596_10051978 3300003215 Bacteria 1169
7 rootL2_10107754 3300003322 Bacteria 2415
8 rootH1_10212637 3300003323 Bacteria 2084
9 rootH1_10272748 3300003323 Bacteria 1431
10 JGI25160J50197_1002425 3300003354 Bacteria 8693
11 JGI25161J50226_1001720 3300003374 Bacteria 6225
12 Ga0007409J51694_1055849 3300003575 Bacteria 1466
13 Ga0055525_1000018 3300003759 Bacteria 393974
14 Ga0055529_1000079 3300003763 Bacteria 149370
15 Ga0055526_1000211 3300003771 Bacteria 50334
16 Ga0055526_1004432 3300003771 Bacteria 8438
17 Ga0055526_1013585 3300003771 Bacteria 3429
18 Ga0055524_1000024 3300003775 Bacteria 217953
19 Ga0055524_1002758 3300003775 Bacteria 8832
20 Ga0055524_1010733 3300003775 Bacteria 3627
21 Ga0055534_1000893 3300003784 Bacteria 13525
22 Ga0055534_1007654 3300003784 Bacteria 2542
23 Ga0055528_1002464 3300003790 Bacteria 9901
24 Ga0055530_10006433 3300003791 Bacteria 5250
25 Ga0055530_10010403 3300003791 Bacteria 3441
26 Ga0055530_10010491 3300003791 Bacteria 3420
27 Ga0055531_10009994 3300003794 Bacteria 4782
28 Ga0055531_10014997 3300003794 Bacteria 3447
29 Ga0065165_1000379 3300005262 Bacteria 72513
30 Ga0065165_1000936 3300005262 Bacteria 37330
31 Ga0070658_10091484 3300005327 Bacteria 2507
32 Ga0070680_100098630 3300005336 Bacteria 2424
33 Ga0070660_100074499 3300005339 Bacteria 2656
34 Ga0070660_100127255 3300005339 Bacteria 2036
35 Ga0070660_100292380 3300005339 Bacteria 1334
36 Ga0070661_100092452 3300005344 Bacteria 2241
37 Ga0070659_100064087 3300005366 Bacteria 2908
38 Ga0070659_100244331 3300005366 Bacteria 1486
39 Ga0070659_100619342 3300005366 Bacteria 931
40 Ga0070662_100248291 3300005457 Bacteria 1430
41 Ga0068867_100535089 3300005459 Bacteria 1012
42 Ga0068853_101168502 3300005539 Bacteria 743
43 Ga0068853_101448556 3300005539 Bacteria 665
44 Ga0070672_100286868 3300005543 Bacteria 1393
45 Ga0068855_101132600 3300005563 Bacteria 816
46 Ga0070664_100214044 3300005564 Bacteria 1722
47 Ga0068871_100098847 3300006358 Bacteria 2442
48 Ga0079104_1002533 3300006946 Bacteria 9653
49 Ga0099826_10000010 3300006948 Bacteria 314346
50 Ga0105244_10000158 3300009036 Bacteria 70253
51 Ga0105244_10000402 3300009036 Bacteria 40241
52 Ga0105242_10086742 3300009176 Bacteria 2627
53 Ga0105239_10279952 3300010375 Bacteria 1878
54 Ga0105239_10695243 3300010375 Bacteria 1163
55 Ga0157370_10844247 3300013104 Bacteria 832
56 Ga0157370_11045353 3300013104 Bacteria 739
57 Ga0163162_11235728 3300013306 Bacteria 848
58 Ga0157372_10599150 3300013307 Bacteria 1284
59 Ga0182006_1000141 3300015261 Bacteria 77478
60 Ga0182006_1056325 3300015261 Bacteria 1498
61 Ga0182007_10181607 3300015262 Bacteria 728
62 Ga0182005_1000016 3300015265 Bacteria 346889
63 Ga0163161_10115624 3300017792 Bacteria 2011
64 Ga0213872_10000005 3300021361 Bacteria 290165
65 Ga0209436_102087 3300025208 Bacteria 6267
66 Ga0209563_100011 3300025230 Bacteria 1187808
67 Ga0207425_1000537 3300025245 Bacteria 22836
68 Ga0207425_1001616 3300025245 Bacteria 9092
69 Ga0209677_102498 3300025253 Bacteria 6865
70 Ga0209129_1012066 3300025258 Bacteria 2014
71 Ga0209565_1002327 3300025263 Bacteria 6960
72 Ga0209565_1004481 3300025263 Bacteria 4228
73 Ga0209455_1000070 3300025272 Bacteria 307867
74 Ga0209673_1004967 3300025273 Bacteria 6900
75 Ga0209130_1000589 3300025284 Bacteria 35424
76 Ga0209130_1002435 3300025284 Bacteria 9332
77 Ga0209130_1003248 3300025284 Bacteria 7128
78 Ga0209675_1002849 3300025291 Bacteria 8597
79 Ga0209675_1010989 3300025291 Bacteria 3041
80 Ga0209025_1004179 3300025294 Bacteria 12761
81 Ga0209564_1000027 3300025295 Bacteria 518458
82 Ga0209564_1000063 3300025295 Bacteria 318515
83 Ga0209564_1005608 3300025295 Bacteria 7070
84 Ga0209564_1026845 3300025295 Bacteria 1889
85 Ga0209758_1000322 3300025297 Bacteria 92458
86 Ga0209050_1000050 3300025298 Bacteria 362578
87 Ga0209050_1001394 3300025298 Bacteria 26226
88 Ga0209050_1014177 3300025298 Bacteria 3460
89 Ga0209256_1000054 3300025299 Bacteria 298431
90 Ga0209256_1001035 3300025299 Bacteria 32598
91 Ga0209256_1001215 3300025299 Bacteria 28711
92 Ga0209256_1006664 3300025299 Bacteria 6004
93 Ga0207426_1003614 3300025302 Bacteria 8201
94 Ga0207426_1087340 3300025302 Bacteria 832
95 Ga0209257_1000075 3300025304 Bacteria 324855
96 Ga0209257_1015089 3300025304 Bacteria 3250
97 Ga0207655_1008552 3300025728 Bacteria 6477
98 Ga0207655_1010967 3300025728 Bacteria 5443
99 Ga0207705_10001882 3300025909 Bacteria 16468
100 Ga0207654_10109668 3300025911 Bacteria 1715
101 Ga0207660_10165547 3300025917 Bacteria 1709
102 Ga0207657_10074275 3300025919 Bacteria 2871
103 Ga0207657_10137967 3300025919 Bacteria 1994
104 Ga0207657_10319019 3300025919 Bacteria 1229
105 Ga0207649_10029056 3300025920 Bacteria 3262
106 Ga0207690_10115599 3300025932 Bacteria 1939
107 Ga0207690_10345890 3300025932 Bacteria 1175
108 Ga0207690_10385101 3300025932 Bacteria 1115
109 Ga0207679_10088783 3300025945 Bacteria 2384
110 Ga0207667_10015412 3300025949 Bacteria 8687
111 Ga0207639_10770465 3300026041 Bacteria 895
112 Ga0207648_10047744 3300026089 Bacteria 3751
113 Ga0207674_10047425 3300026116 Bacteria 4404
114 Ga0209282_1000009 3300027666 Bacteria 233366
115 Ga0307515_10186357 3300028794 Bacteria 2003
116 Ga0307408_100001150 3300031548 Bacteria 20100
117 Ga0307408_100002743 3300031548 Bacteria 12225
118 Ga0307408_100031490 3300031548 Bacteria 3693
119 Ga0307408_100048577 3300031548 Bacteria 3044
120 Ga0307408_100049031 3300031548 Bacteria 3031
121 Ga0307408_101186331 3300031548 Bacteria 712
122 Ga0265314_10037192 3300031711 Bacteria 3530
123 Ga0307518_10133778 3300031838 Bacteria 1739
124 Ga0307412_10960080 3300031911 Bacteria 753
125 Ga0307412_11335727 3300031911 Bacteria 647
126 Ga0307416_100012949 3300032002 Bacteria 5646
127 Ga0307411_10346231 3300032005 Bacteria 1210
128 Ga0307415_101027394 3300032126 Bacteria 768
129 Ga0395899_0063930 3300037312 Bacteria 2706
130 Ga0395899_0121393 3300037312 Bacteria 1871
131 Ga0395899_0405361 3300037312 Bacteria 901
132 Ga0395900_0002597 3300037418 Bacteria 19748
133 Ga0395900_0039197 3300037418 Bacteria 4881
134 Ga0395900_0099288 3300037418 Bacteria 2990
135 Ga0395900_0159315 3300037418 Bacteria 2303
136 Ga0395900_0436221 3300037418 Bacteria 1268
137 Ga0395898_0106539 3300037466 Bacteria 2688
138 Ga0395898_0629455 3300037466 Bacteria 1015
139 Ga0395898_0802335 3300037466 Bacteria 881
140 Ga0395905_0017406 3300037471 Bacteria 6823
141 Ga0395905_0163335 3300037471 Bacteria 2093
142 Ga0395905_0198691 3300037471 Bacteria 1880
143 Ga0395905_0201389 3300037471 Bacteria 1866
144 Ga0395905_0245847 3300037471 Bacteria 1671
145 Ga0395905_0310876 3300037471 Bacteria 1464
146 Ga0395905_0378380 3300037471 Bacteria 1309
147 Ga0395905_0672411 3300037471 Bacteria 938
148 Ga0395901_0001076 3300038443 Bacteria 29192
149 Ga0395901_0544721 3300038443 Bacteria 1176
150 Ga0436361_0126888 3300039447 Bacteria 24870
151 Ga0450904_000164 3300042139 Bacteria 14610
152 Ga0439458_0005599 3300042157 Bacteria 2822
153 Ga0466972_0062329 3300044658 Bacteria 1787
154 Ga0466965_0021005 3300044683 Bacteria 3140
155 Ga0466965_0054518 3300044683 Bacteria 1988
156 Ga0466966_0118286 3300044684 Bacteria 1629
157 Ga0466966_0159291 3300044684 Bacteria 1374
158 Ga0466963_0150187 3300044694 Bacteria 1617
159 Ga0466964_0001019 3300044706 Bacteria 9316
160 Ga0466968_0001262 3300044735 Bacteria 9004
161 Ga0466970_0057046 3300044765 Bacteria 2087
162 Ga0466957_0161027 3300044842 Bacteria 1457
163 Ga0466960_0054080 3300044901 Bacteria 1948
164 Ga0466959_0124826 3300045049 Bacteria 1827
165 Ga0466958_0092383 3300045836 Bacteria 1873
166 Ga0466967_0025158 3300045976 Bacteria 4905
167 Ga0466967_0186168 3300045976 Bacteria 1960
168 Ga0495617_003529 3300046452 Bacteria 5853
169 Ga0495617_058564 3300046452 Bacteria 1276
170 Ga0495627_000011 3300046453 Bacteria 354522
171 Ga0495590_0011366 3300046457 Bacteria 3331
172 Ga0495590_0035383 3300046457 Bacteria 1744
173 Ga0495590_0048121 3300046457 Bacteria 1487
174 Ga0495590_0166896 3300046457 Bacteria 801
175 Ga0495591_041838 3300046458 Bacteria 1298
176 Ga0495638_0001941 3300046460 Bacteria 17738
177 Ga0495638_0061088 3300046460 Bacteria 2329
178 Ga0495638_0171806 3300046460 Bacteria 1243
179 Ga0495638_0343021 3300046460 Bacteria 791
180 Ga0495638_0423969 3300046460 Bacteria 685
181 Ga0495653_0025873 3300046463 Bacteria 4708
182 Ga0495650_0000431 3300046471 Bacteria 67716
183 Ga0495650_0000485 3300046471 Bacteria 60761
184 Ga0495650_0001065 3300046471 Bacteria 30418
185 Ga0495650_0001516 3300046471 Bacteria 22098
186 Ga0495650_0009179 3300046471 Bacteria 5662
187 Ga0495605_0000061 3300046474 Bacteria 145286
188 Ga0495605_0000641 3300046474 Bacteria 26838
189 Ga0495605_0020640 3300046474 Bacteria 3499
190 Ga0495605_0021349 3300046474 Bacteria 3430
191 Ga0495605_0035618 3300046474 Bacteria 2514
192 Ga0495605_0056179 3300046474 Bacteria 1899
193 Ga0495584_0001109 3300046491 Bacteria 16710
194 Ga0495584_0001470 3300046491 Bacteria 14140
195 Ga0495584_0026770 3300046491 Bacteria 2922
196 Ga0495584_0061582 3300046491 Bacteria 1886
197 Ga0495584_0062957 3300046491 Bacteria 1864
198 Ga0495584_0136331 3300046491 Bacteria 1246
199 Ga0495584_0144695 3300046491 Bacteria 1207
200 Ga0495585_0006816 3300046492 Bacteria 7048
201 Ga0495585_0008237 3300046492 Bacteria 6328
202 Ga0495585_0012462 3300046492 Bacteria 5009
203 Ga0495585_0066993 3300046492 Bacteria 1965
204 Ga0495585_0089000 3300046492 Bacteria 1664
205 Ga0495585_0116368 3300046492 Bacteria 1417
206 Ga0495596_0007284 3300046500 Bacteria 5002
207 Ga0495596_0104439 3300046500 Bacteria 1100
208 Ga0495607_0002410 3300046501 Bacteria 15261
209 Ga0495607_0004458 3300046501 Bacteria 10274
210 Ga0495607_0006913 3300046501 Bacteria 7910
211 Ga0495607_0013095 3300046501 Bacteria 5447
212 Ga0495607_0112948 3300046501 Bacteria 1437
213 Ga0495607_0155840 3300046501 Bacteria 1165
214 Ga0495583_0000947 3300046506 Bacteria 33746
215 Ga0495583_0002934 3300046506 Bacteria 13746
216 Ga0495583_0003787 3300046506 Bacteria 11232
217 Ga0495583_0004595 3300046506 Bacteria 9786
218 Ga0495583_0013027 3300046506 Bacteria 4667
219 Ga0495583_0043161 3300046506 Bacteria 2101
220 Ga0495606_0000120 3300046507 Bacteria 133907
221 Ga0495606_0003134 3300046507 Bacteria 17935
222 Ga0495606_0006009 3300046507 Bacteria 11375
223 Ga0495606_0006559 3300046507 Bacteria 10699
224 Ga0495606_0022485 3300046507 Bacteria 4593
225 Ga0495606_0028793 3300046507 Bacteria 3911
226 Ga0495606_0061007 3300046507 Bacteria 2413
227 Ga0495610_0001967 3300046512 Bacteria 17647
228 Ga0495610_0019707 3300046512 Bacteria 3764
229 Ga0495610_0035711 3300046512 Bacteria 2548
230 Ga0495616_0000570 3300046513 Bacteria 27850
231 Ga0495616_0002996 3300046513 Bacteria 10961
232 Ga0495616_0003871 3300046513 Bacteria 9539
233 Ga0495616_0004627 3300046513 Bacteria 8635
234 Ga0495616_0010983 3300046513 Bacteria 5212
235 Ga0495616_0015793 3300046513 Bacteria 4190
236 Ga0495616_0128540 3300046513 Bacteria 1163
237 Ga0495616_0207081 3300046513 Bacteria 859
238 Ga0495631_0001600 3300046518 Bacteria 13546
239 Ga0495631_0004324 3300046518 Bacteria 7576
240 Ga0495631_0010049 3300046518 Bacteria 4701
241 Ga0495631_0128436 3300046518 Bacteria 1089
242 Ga0495632_0001178 3300046519 Bacteria 22245
243 Ga0495632_0001980 3300046519 Bacteria 16262
244 Ga0495637_0001342 3300046520 Bacteria 14760
245 Ga0495637_0018645 3300046520 Bacteria 3216
246 Ga0495637_0120095 3300046520 Bacteria 1012
247 Ga0495643_0000455 3300046522 Bacteria 52002
248 Ga0495643_0000759 3300046522 Bacteria 36249
249 Ga0495643_0003928 3300046522 Bacteria 10651
250 Ga0495643_0005232 3300046522 Bacteria 8828
251 Ga0495643_0019848 3300046522 Bacteria 3885
252 Ga0495643_0062224 3300046522 Bacteria 1976
253 Ga0495643_0064153 3300046522 Bacteria 1941
254 Ga0495643_0075349 3300046522 Bacteria 1765
255 Ga0495644_0003729 3300046523 Bacteria 5997
256 Ga0495644_0016264 3300046523 Bacteria 2848
257 Ga0495648_0005858 3300046524 Bacteria 10113
258 Ga0495648_0026099 3300046524 Bacteria 3939
259 Ga0495648_0027822 3300046524 Bacteria 3777
260 Ga0495648_0040572 3300046524 Bacteria 2950
261 Ga0495648_0093913 3300046524 Bacteria 1672
262 Ga0495648_0167398 3300046524 Bacteria 1130
263 Ga0495663_0150027 3300046525 Bacteria 795
264 Ga0495642_0001360 3300046528 Bacteria 10926
265 Ga0495642_0002790 3300046528 Bacteria 6992
266 Ga0495642_0007892 3300046528 Bacteria 4077
267 Ga0495642_0026595 3300046528 Bacteria 2299
268 Ga0495642_0036440 3300046528 Bacteria 1988
269 Ga0495642_0079201 3300046528 Bacteria 1381
270 Ga0495642_0159283 3300046528 Bacteria 978
271 Ga0495654_0000060 3300046530 Bacteria 134307
272 Ga0495654_0013481 3300046530 Bacteria 4373
273 Ga0495654_0022962 3300046530 Bacteria 3233
274 Ga0495654_0063796 3300046530 Bacteria 1763
275 Ga0495586_0012830 3300046535 Bacteria 4441
276 Ga0495586_0030539 3300046535 Bacteria 2883
277 Ga0495609_0000007 3300046538 Bacteria 398812
278 Ga0495609_0000314 3300046538 Bacteria 43536
279 Ga0495609_0001024 3300046538 Bacteria 19749
280 Ga0495609_0003230 3300046538 Bacteria 9449
281 Ga0495609_0007604 3300046538 Bacteria 5387
282 Ga0495609_0023991 3300046538 Bacteria 2800
283 Ga0495609_0050843 3300046538 Bacteria 1846
284 Ga0495609_0087037 3300046538 Bacteria 1361
285 Ga0495621_0003674 3300046539 Bacteria 4244
286 Ga0495597_0001361 3300046542 Bacteria 17716
287 Ga0495597_0010558 3300046542 Bacteria 4506
288 Ga0495597_0018903 3300046542 Bacteria 3228
289 Ga0495597_0023145 3300046542 Bacteria 2875
290 Ga0495597_0039850 3300046542 Bacteria 2101
291 Ga0495597_0101632 3300046542 Bacteria 1212
292 Ga0495622_0001345 3300046557 Bacteria 12548
293 Ga0495622_0131427 3300046557 Bacteria 1140
294 Ga0495633_0000537 3300046558 Bacteria 37833
295 Ga0495633_0001086 3300046558 Bacteria 21974
296 Ga0495633_0002449 3300046558 Bacteria 13105
297 Ga0495633_0008912 3300046558 Bacteria 5593
298 Ga0495633_0011756 3300046558 Bacteria 4699
299 Ga0495633_0021099 3300046558 Bacteria 3262
300 Ga0495656_0018221 3300046615 Bacteria 2692
301 Ga0495656_0183696 3300046615 Bacteria 1029
302 Ga0495656_0226824 3300046615 Bacteria 936
303 Ga0495656_0239455 3300046615 Bacteria 913
304 Ga0495668_0000162 3300046616 Bacteria 101114
305 Ga0495668_0000343 3300046616 Bacteria 61962
306 Ga0495668_0000962 3300046616 Bacteria 32005
307 Ga0495668_0003586 3300046616 Bacteria 11517
308 Ga0495668_0041299 3300046616 Bacteria 2569
309 Ga0495668_0049698 3300046616 Bacteria 2325
310 Ga0495668_0102627 3300046616 Bacteria 1564
311 Ga0495668_0118307 3300046616 Bacteria 1449
312 Ga0495611_0255127 3300046648 Bacteria 812
313 Ga0495625_0001374 3300046660 Bacteria 29921
314 Ga0495625_0002210 3300046660 Bacteria 21514
315 Ga0495625_0005443 3300046660 Bacteria 11608
316 Ga0495625_0010651 3300046660 Bacteria 7579
317 Ga0495625_0023402 3300046660 Bacteria 4719
318 Ga0495625_0029959 3300046660 Bacteria 4064
319 Ga0495625_0108728 3300046660 Bacteria 1897
320 Ga0495625_0297096 3300046660 Bacteria 1034
321 Ga0495625_0405642 3300046660 Bacteria 850
322 Ga0495635_0005841 3300046663 Bacteria 8576
323 Ga0495659_0000127 3300046664 Bacteria 33507
324 Ga0495659_0003238 3300046664 Bacteria 5219
325 Ga0495661_0000549 3300046665 Bacteria 38859
326 Ga0495661_0000776 3300046665 Bacteria 30561
327 Ga0495661_0008659 3300046665 Bacteria 7030
328 Ga0495661_0017352 3300046665 Bacteria 4755
329 Ga0495661_0025119 3300046665 Bacteria 3852
330 Ga0495661_0043918 3300046665 Bacteria 2743
331 Ga0495661_0061188 3300046665 Bacteria 2235
332 Ga0495661_0097529 3300046665 Bacteria 1660
333 Ga0495661_0110527 3300046665 Bacteria 1532
334 Ga0495588_0213768 3300046674 Bacteria 1018
335 Ga0495669_0000791 3300046684 Bacteria 13518
336 Ga0495613_0043544 3300046689 Bacteria 3321
337 Ga0495670_0002459 3300046691 Bacteria 9144
338 Ga0495670_0016970 3300046691 Bacteria 3579
339 Ga0495670_0069138 3300046691 Bacteria 1785
340 Ga0495670_0082971 3300046691 Bacteria 1634
341 Ga0495670_0190606 3300046691 Bacteria 1084
342 Ga0495671_0000266 3300046692 Bacteria 44137
343 Ga0495671_0027831 3300046692 Bacteria 2915
344 Ga0495671_0039703 3300046692 Bacteria 2375
345 Ga0495649_0009645 3300046694 Bacteria 5723
346 Ga0495649_0009889 3300046694 Bacteria 5643
347 Ga0495649_0016333 3300046694 Bacteria 4207
348 Ga0495649_0023317 3300046694 Bacteria 3459
349 Ga0495649_0025560 3300046694 Bacteria 3289
350 Ga0495649_0261804 3300046694 Bacteria 886
351 Ga0495589_0000081 3300046794 Bacteria 88067
352 Ga0495589_0002218 3300046794 Bacteria 10925
353 Ga0495589_0007240 3300046794 Bacteria 5812
354 Ga0495660_0001122 3300046810 Bacteria 19111
355 Ga0495660_0001641 3300046810 Bacteria 15009
356 Ga0495660_0003018 3300046810 Bacteria 10501
357 Ga0495660_0003901 3300046810 Bacteria 9114
358 Ga0495660_0075701 3300046810 Bacteria 1775
359 Ga0495660_0175400 3300046810 Bacteria 1041
360 Ga0495660_0223158 3300046810 Bacteria 887
361 Ga0495604_0071080 3300047317 Bacteria 2633
362 Ga0495636_0005873 3300047318 Bacteria 4815
363 Ga0495636_0035219 3300047318 Bacteria 2062
364 Ga0495672_0000297 3300047320 Bacteria 68017
365 Ga0495672_0000847 3300047320 Bacteria 32544
366 Ga0495672_0276935 3300047320 Bacteria 803
367 Ga0495680_0032272 3300047322 Bacteria 4252
368 Ga0495683_0001476 3300047323 Bacteria 15354
369 Ga0495683_0007113 3300047323 Bacteria 6072
370 Ga0495683_0032704 3300047323 Bacteria 2649
371 Ga0495683_0036383 3300047323 Bacteria 2499
372 Ga0495687_000030 3300047443 Bacteria 279992
373 Ga0495687_000120 3300047443 Bacteria 120987
374 Ga0495687_000374 3300047443 Bacteria 55800
375 Ga0495687_000814 3300047443 Bacteria 33460
376 Ga0495687_005336 3300047443 Bacteria 8232
377 Ga0495687_008018 3300047443 Bacteria 6110
378 Ga0495675_0028627 3300047444 Bacteria 3552
379 Ga0495677_0000045 3300047445 Bacteria 73995
380 Ga0495677_0001504 3300047445 Bacteria 9372
381 Ga0495677_0003277 3300047445 Bacteria 6310
382 Ga0495677_0010359 3300047445 Bacteria 3425
383 Ga0495677_0011757 3300047445 Bacteria 3199
384 Ga0495677_0015843 3300047445 Bacteria 2737
385 Ga0495679_005794 3300047446 Bacteria 5438
386 Ga0495679_008295 3300047446 Bacteria 4240
387 Ga0495679_018010 3300047446 Bacteria 2516
388 Ga0495685_000125 3300047447 Bacteria 26465
389 Ga0495685_262308 3300047447 Bacteria 547
390 Ga0495673_0000391 3300047469 Bacteria 51513
391 Ga0495673_0020688 3300047469 Bacteria 3271
392 Ga0495681_0001259 3300047470 Bacteria 19226
393 Ga0495681_0001523 3300047470 Bacteria 17287
394 Ga0495681_0005040 3300047470 Bacteria 8903
395 Ga0495681_0034447 3300047470 Bacteria 2523
396 Ga0495681_0040480 3300047470 Bacteria 2268
397 Ga0495681_0069965 3300047470 Bacteria 1593
398 Ga0495681_0078481 3300047470 Bacteria 1479
399 Ga0495681_0133394 3300047470 Bacteria 1055
400 Ga0495686_0002181 3300047472 Bacteria 19042
401 Ga0495686_0021171 3300047472 Bacteria 4324
402 Ga0495686_0040167 3300047472 Bacteria 2985
403 Ga0495593_0007740 3300047673 Bacteria 6265
404 Ga0495626_0001251 3300048091 Bacteria 20847
405 Ga0495626_0009393 3300048091 Bacteria 5287
406 Ga0495626_0014390 3300048091 Bacteria 4083
407 Ga0495626_0022201 3300048091 Bacteria 3136
408 Ga0495626_0034106 3300048091 Bacteria 2436
409 Ga0495626_0044201 3300048091 Bacteria 2086
410 Ga0496100_0248560 3300048903 Bacteria 1315
411 Ga0496100_0338383 3300048903 Bacteria 1134
412 Ga0496101_0248987 3300048904 Bacteria 1384
413 Ga0496102_0043475 3300048905 Bacteria 4074
414 Ga0496103_0005598 3300048906 Bacteria 7515
415 Ga0496103_0018515 3300048906 Bacteria 4178
416 Ga0496104_0416575 3300048907 Bacteria 1256
417 Ga0496107_0135742 3300048910 Bacteria 1817
418 Ga0496107_0802108 3300048910 Unclassified 689
419 Ga0496108_0193585 3300048911 Bacteria 1763
420 Ga0496109_0562191 3300048912 Bacteria 1076
421 Ga0496110_0052780 3300048913 Bacteria 3572
422 Ga0496110_0783836 3300048913 Bacteria 857
423 Ga0496111_0307022 3300048914 Bacteria 1176
424 Ga0496112_0256759 3300048915 Bacteria 1698
425 Ga0496113_0013871 3300048916 Bacteria 5477
426 Ga0496114_0299840 3300048917 Bacteria 1419
427 Ga0496115_0393733 3300048918 Bacteria 1125
428 Ga0496116_0128644 3300048919 Bacteria 1448
429 Ga0496122_0008754 3300048925 Bacteria 10828
430 Ga0496123_0095665 3300048926 Bacteria 1746
431 Ga0496124_0106458 3300048927 Bacteria 2264
432 Ga0496124_0140388 3300048927 Bacteria 1907
433 Ga0495678_000010 3300049459 Bacteria 357896
434 Ga0495678_000190 3300049459 Bacteria 71878
435 Ga0495678_001091 3300049459 Bacteria 22890
436 Ga0495678_004786 3300049459 Bacteria 7704
437 Ga0495678_004860 3300049459 Bacteria 7612
438 Ga0495678_009080 3300049459 Bacteria 4960
439 Ga0495678_071675 3300049459 Bacteria 1268
440 Ga0495682_0000380 3300049460 Bacteria 32186
441 Ga0501214_039372 3300049659 Bacteria 681
442 Ga0501238_007967 3300049671 Bacteria 1385
443 Ga0501249_010146 3300049679 Bacteria 1966
444 Ga0501269_000199 3300049766 Bacteria 18071
445 Ga0501279_002690 3300049775 Bacteria 2322
446 Ga0500594_0001066 3300053118 Bacteria 5868
447 Ga0500618_000364 3300053125 Bacteria 31481
448 Ga0500618_026403 3300053125 Bacteria 1387
449 Ga0500586_104606 3300053145 Bacteria 990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0026770 Ga0495584_0026770_358_966 150
2 3300046492 Ga0495585_0008237 Ga0495585_0008237_549_1157 150
3 3300046518 Ga0495631_0001600 Ga0495631_0001600_7481_8077 150
4 3300046558 Ga0495633_0002449 Ga0495633_0002449_10564_11172 150
5 3300046616 Ga0495668_0102627 Ga0495668_0102627_530_1138 150
6 3300046665 Ga0495661_0000549 Ga0495661_0000549_21497_22105 150
7 3300046691 Ga0495670_0002459 Ga0495670_0002459_8049_8657 150
8 3300047445 Ga0495677_0015843 Ga0495677_0015843_2008_2616 150
9 3300047470 Ga0495681_0034447 Ga0495681_0034447_617_1225 150
10 3300046524 Ga0495648_0040572 Ga0495648_0040572_2175_2777 151
11 3300046691 Ga0495670_0190606 Ga0495670_0190606_186_782 151
12 3300046528 Ga0495642_0079201 Ga0495642_0079201_530_1108 152
13 3300046457 Ga0495590_0048121 Ga0495590_0048121_482_1045 153
14 3300046474 Ga0495605_0056179 Ga0495605_0056179_1099_1662 153
15 3300046491 Ga0495584_0001109 Ga0495584_0001109_15644_16207 153
16 3300046492 Ga0495585_0006816 Ga0495585_0006816_977_1540 153
17 3300046500 Ga0495596_0007284 Ga0495596_0007284_2964_3527 153
18 3300046501 Ga0495607_0006913 Ga0495607_0006913_1173_1736 153
19 3300046506 Ga0495583_0003787 Ga0495583_0003787_8638_9201 153
20 3300046518 Ga0495631_0004324 Ga0495631_0004324_3971_4534 153
21 3300046519 Ga0495632_0001980 Ga0495632_0001980_6506_7069 153
22 3300046523 Ga0495644_0003729 Ga0495644_0003729_3554_4117 153
23 3300046528 Ga0495642_0159283 Ga0495642_0159283_385_948 153
24 3300046558 Ga0495633_0008912 Ga0495633_0008912_2085_2648 153
25 3300046616 Ga0495668_0049698 Ga0495668_0049698_590_1153 153
26 3300046648 Ga0495611_0255127 Ga0495611_0255127_86_649 153
27 3300046665 Ga0495661_0110527 Ga0495661_0110527_884_1447 153
28 3300046691 Ga0495670_0082971 Ga0495670_0082971_924_1487 153
29 3300046794 Ga0495589_0007240 Ga0495589_0007240_418_981 153
30 3300046810 Ga0495660_0003901 Ga0495660_0003901_8536_9099 153
31 3300047320 Ga0495672_0276935 Ga0495672_0276935_207_770 153
32 3300047323 Ga0495683_0007113 Ga0495683_0007113_2587_3150 153
33 3300047445 Ga0495677_0011757 Ga0495677_0011757_369_932 153
34 3300047446 Ga0495679_008295 Ga0495679_008295_2015_2578 153
35 3300047470 Ga0495681_0001523 Ga0495681_0001523_3697_4260 153
36 3300049459 Ga0495678_004860 Ga0495678_004860_2032_2595 153
37 3300046491 Ga0495584_0144695 Ga0495584_0144695_86_670 154
38 3300046542 Ga0495597_0039850 Ga0495597_0039850_243_827 154
39 3300015261 Ga0182006_1056325 Ga0182006_10563252 157
40 3300015262 Ga0182007_10181607 Ga0182007_101816072 157
41 3300046463 Ga0495653_0025873 Ga0495653_0025873_1238_1846 157
42 3300046474 Ga0495605_0021349 Ga0495605_0021349_1745_2317 157
43 3300046535 Ga0495586_0012830 Ga0495586_0012830_1677_2285 157
44 3300046663 Ga0495635_0005841 Ga0495635_0005841_4340_4948 157
45 3300047317 Ga0495604_0071080 Ga0495604_0071080_1502_2110 157
46 3300047322 Ga0495680_0032272 Ga0495680_0032272_764_1372 157
47 3300047444 Ga0495675_0028627 Ga0495675_0028627_1208_1816 157
48 3300047673 Ga0495593_0007740 Ga0495593_0007740_3972_4580 157
49 3300048906 Ga0496103_0005598 Ga0496103_0005598_2913_3506 157
50 3300005262 Ga0065165_1000379 Ga0065165_100037938 158
51 3300046458 Ga0495591_041838 Ga0495591_041838_299_877 158
52 3300046524 Ga0495648_0026099 Ga0495648_0026099_2041_2619 158
53 3300046492 Ga0495585_0012462 Ga0495585_0012462_347_937 159
54 3300046506 Ga0495583_0043161 Ga0495583_0043161_1254_1844 159
55 3300049459 Ga0495678_004786 Ga0495678_004786_1914_2522 159
56 3300046538 Ga0495609_0050843 Ga0495609_0050843_273_863 160
57 3300047443 Ga0495687_000030 Ga0495687_000030_135619_136221 160
58 3300047470 Ga0495681_0133394 Ga0495681_0133394_35_625 160
59 3300049679 Ga0501249_010146 Ga0501249_010146_64_651 160
60 3300049766 Ga0501269_000199 Ga0501269_000199_15786_16373 160
61 3300046471 Ga0495650_0001065 Ga0495650_0001065_24910_25467 161
62 3300046522 Ga0495643_0062224 Ga0495643_0062224_57_659 161
63 3300037471 Ga0395905_0378380 Ga0395905_0378380_507_1085 162
64 3300046528 Ga0495642_0001360 Ga0495642_0001360_3793_4377 162
65 3300047443 Ga0495687_000374 Ga0495687_000374_28445_29005 162
66 3300003771 Ga0055526_1000211 Ga0055526_10002112 163
67 3300006358 Ga0068871_100098847 Ga0068871_1000988472 163
68 3300025295 Ga0209564_1000027 Ga0209564_1000027256 163
69 3300037312 Ga0395899_0405361 Ga0395899_0405361_169_783 163
70 3300047445 Ga0495677_0001504 Ga0495677_0001504_7215_7784 163
71 3300044658 Ga0466972_0062329 Ga0466972_0062329_80_688 165
72 3300046460 Ga0495638_0343021 Ga0495638_0343021_119_700 165
73 3300003759 Ga0055525_1000018 Ga0055525_1000018266 166
74 3300005336 Ga0070680_100098630 Ga0070680_1000986302 166
75 3300005339 Ga0070660_100074499 Ga0070660_1000744993 166
76 3300005366 Ga0070659_100064087 Ga0070659_1000640873 166
77 3300009036 Ga0105244_10000158 Ga0105244_1000015854 166
78 3300013104 Ga0157370_10844247 Ga0157370_108442472 166
79 3300013307 Ga0157372_10599150 Ga0157372_105991502 166
80 3300025230 Ga0209563_100011 Ga0209563_100011826 166
81 3300025253 Ga0209677_102498 Ga0209677_1024984 166
82 3300025728 Ga0207655_1010967 Ga0207655_10109672 166
83 3300025917 Ga0207660_10165547 Ga0207660_101655473 166
84 3300025919 Ga0207657_10074275 Ga0207657_100742752 166
85 3300025932 Ga0207690_10115599 Ga0207690_101155992 166
86 3300037418 Ga0395900_0099288 Ga0395900_0099288_1761_2363 166
87 3300037471 Ga0395905_0201389 Ga0395905_0201389_775_1377 166
88 3300038443 Ga0395901_0544721 Ga0395901_0544721_79_684 166
89 3300045976 Ga0466967_0186168 Ga0466967_0186168_1086_1700 166
90 3300046474 Ga0495605_0020640 Ga0495605_0020640_2620_3270 166
91 3300046491 Ga0495584_0062957 Ga0495584_0062957_576_1226 166
92 3300046500 Ga0495596_0104439 Ga0495596_0104439_300_860 166
93 3300046501 Ga0495607_0002410 Ga0495607_0002410_8972_9622 166
94 3300046513 Ga0495616_0010983 Ga0495616_0010983_2952_3602 166
95 3300046522 Ga0495643_0064153 Ga0495643_0064153_362_1012 166
96 3300046528 Ga0495642_0026595 Ga0495642_0026595_1196_1846 166
97 3300046538 Ga0495609_0000007 Ga0495609_0000007_311902_312552 166
98 3300046665 Ga0495661_0000776 Ga0495661_0000776_13754_14404 166
99 3300046794 Ga0495589_0000081 Ga0495589_0000081_8152_8802 166
100 3300047443 Ga0495687_000120 Ga0495687_000120_60619_61269 166
101 3300047445 Ga0495677_0000045 Ga0495677_0000045_64374_65024 166
102 3300047447 Ga0495685_262308 Ga0495685_262308_13_528 166
103 3300047470 Ga0495681_0069965 Ga0495681_0069965_393_986 166
104 3300048091 Ga0495626_0001251 Ga0495626_0001251_11335_11985 166
105 3300048903 Ga0496100_0248560 Ga0496100_0248560_564_1169 166
106 3300048907 Ga0496104_0416575 Ga0496104_0416575_615_1220 166
107 3300048910 Ga0496107_0135742 Ga0496107_0135742_364_969 166
108 3300048911 Ga0496108_0193585 Ga0496108_0193585_683_1297 166
109 3300048915 Ga0496112_0256759 Ga0496112_0256759_666_1280 166
110 3300048916 Ga0496113_0013871 Ga0496113_0013871_2997_3611 166
111 3300048925 Ga0496122_0008754 Ga0496122_0008754_2838_3452 166
112 3300048926 Ga0496123_0095665 Ga0496123_0095665_273_887 166
113 3300048927 Ga0496124_0140388 Ga0496124_0140388_394_999 166
114 3300005339 Ga0070660_100127255 Ga0070660_1001272553 167
115 3300005344 Ga0070661_100092452 Ga0070661_1000924523 167
116 3300005366 Ga0070659_100244331 Ga0070659_1002443312 167
117 3300005457 Ga0070662_100248291 Ga0070662_1002482912 167
118 3300005459 Ga0068867_100535089 Ga0068867_1005350892 167
119 3300005563 Ga0068855_101132600 Ga0068855_1011326001 167
120 3300005564 Ga0070664_100214044 Ga0070664_1002140442 167
121 3300010375 Ga0105239_10279952 Ga0105239_102799522 167
122 3300025919 Ga0207657_10137967 Ga0207657_101379672 167
123 3300025920 Ga0207649_10029056 Ga0207649_100290565 167
124 3300025932 Ga0207690_10385101 Ga0207690_103851012 167
125 3300025945 Ga0207679_10088783 Ga0207679_100887832 167
126 3300026089 Ga0207648_10047744 Ga0207648_100477445 167
127 3300037312 Ga0395899_0063930 Ga0395899_0063930_1974_2588 167
128 3300037418 Ga0395900_0039197 Ga0395900_0039197_2174_2788 167
129 3300037466 Ga0395898_0802335 Ga0395898_0802335_149_763 167
130 3300044684 Ga0466966_0159291 Ga0466966_0159291_677_1282 167
131 3300045049 Ga0466959_0124826 Ga0466959_0124826_1057_1662 167
132 3300046522 Ga0495643_0003928 Ga0495643_0003928_4190_4753 167
133 3300046694 Ga0495649_0009889 Ga0495649_0009889_924_1487 167
134 3300048091 Ga0495626_0034106 Ga0495626_0034106_1393_1956 167
135 3300044694 Ga0466963_0150187 Ga0466963_0150187_320_901 168
136 3300045976 Ga0466967_0025158 Ga0466967_0025158_160_741 168
137 3300048091 Ga0495626_0014390 Ga0495626_0014390_662_1225 168
138 3300048912 Ga0496109_0562191 Ga0496109_0562191_146_742 168
139 3300003763 Ga0055529_1000079 Ga0055529_100007984 169
140 3300005327 Ga0070658_10091484 Ga0070658_100914844 169
141 3300009176 Ga0105242_10086742 Ga0105242_100867422 169
142 3300025909 Ga0207705_10001882 Ga0207705_100018829 169
143 3300025911 Ga0207654_10109668 Ga0207654_101096683 169
144 3300025949 Ga0207667_10015412 Ga0207667_100154128 169
145 3300026041 Ga0207639_10770465 Ga0207639_107704652 169
146 3300046460 Ga0495638_0171806 Ga0495638_0171806_614_1219 169
147 3300046471 Ga0495650_0000485 Ga0495650_0000485_13613_14203 169
148 3300046471 Ga0495650_0001516 Ga0495650_0001516_4439_5044 169
149 3300046616 Ga0495668_0003586 Ga0495668_0003586_8953_9543 169
150 3300046665 Ga0495661_0097529 Ga0495661_0097529_325_891 169
151 3300025272 Ga0209455_1000070 Ga0209455_1000070189 170
152 3300037312 Ga0395899_0121393 Ga0395899_0121393_855_1451 170
153 3300037418 Ga0395900_0002597 Ga0395900_0002597_1974_2570 170
154 3300037466 Ga0395898_0106539 Ga0395898_0106539_1974_2570 170
155 3300037471 Ga0395905_0245847 Ga0395905_0245847_287_883 170
156 3300038443 Ga0395901_0001076 Ga0395901_0001076_1974_2570 170
157 3300045836 Ga0466958_0092383 Ga0466958_0092383_471_1067 170
158 3300046506 Ga0495583_0013027 Ga0495583_0013027_3296_3874 170
159 3300046524 Ga0495648_0027822 Ga0495648_0027822_2710_3288 170
160 3300046538 Ga0495609_0087037 Ga0495609_0087037_251_829 170
161 3300046542 Ga0495597_0001361 Ga0495597_0001361_2972_3541 170
162 3300046660 Ga0495625_0297096 Ga0495625_0297096_338_916 170
163 3300049459 Ga0495678_000190 Ga0495678_000190_31531_32109 170
164 3300003322 rootL2_10107754 rootL2_101077543 171
165 3300003775 Ga0055524_1000024 Ga0055524_100002466 171
166 3300005539 Ga0068853_101448556 Ga0068853_1014485561 171
167 3300005543 Ga0070672_100286868 Ga0070672_1002868682 171
168 3300047470 Ga0495681_0078481 Ga0495681_0078481_533_1111 171
169 3300046457 Ga0495590_0166896 Ga0495590_0166896_48_608 172
170 3300046513 Ga0495616_0128540 Ga0495616_0128540_445_1005 172
171 3300046542 Ga0495597_0010558 Ga0495597_0010558_2836_3396 172
172 3300046660 Ga0495625_0108728 Ga0495625_0108728_1004_1585 172
173 3300046694 Ga0495649_0025560 Ga0495649_0025560_555_1136 172
174 3300046794 Ga0495589_0002218 Ga0495589_0002218_3526_4086 172
175 3300048914 Ga0496111_0307022 Ga0496111_0307022_142_705 172
176 3300003575 Ga0007409J51694_1055849 Ga0007409J51694_10558493 173
177 3300037418 Ga0395900_0436221 Ga0395900_0436221_334_918 173
178 3300037471 Ga0395905_0310876 Ga0395905_0310876_368_952 173
179 3300046474 Ga0495605_0035618 Ga0495605_0035618_1305_1883 173
180 3300046513 Ga0495616_0207081 Ga0495616_0207081_89_667 173
181 3300046518 Ga0495631_0010049 Ga0495631_0010049_2794_3372 173
182 3300046522 Ga0495643_0075349 Ga0495643_0075349_789_1367 173
183 3300046524 Ga0495648_0005858 Ga0495648_0005858_7078_7674 173
184 3300046530 Ga0495654_0022962 Ga0495654_0022962_1257_1835 173
185 3300046538 Ga0495609_0023991 Ga0495609_0023991_966_1562 173
186 3300046616 Ga0495668_0000962 Ga0495668_0000962_13395_13973 173
187 3300046660 Ga0495625_0023402 Ga0495625_0023402_1884_2462 173
188 3300046692 Ga0495671_0027831 Ga0495671_0027831_1086_1664 173
189 3300047446 Ga0495679_018010 Ga0495679_018010_896_1474 173
190 3300047470 Ga0495681_0040480 Ga0495681_0040480_994_1572 173
191 3300005539 Ga0068853_101168502 Ga0068853_1011685021 174
192 3300044683 Ga0466965_0021005 Ga0466965_0021005_752_1336 174
193 3300044706 Ga0466964_0001019 Ga0466964_0001019_3922_4506 174
194 3300044735 Ga0466968_0001262 Ga0466968_0001262_6908_7492 174
195 3300044765 Ga0466970_0057046 Ga0466970_0057046_1161_1745 174
196 3300044842 Ga0466957_0161027 Ga0466957_0161027_45_629 174
197 3300044901 Ga0466960_0054080 Ga0466960_0054080_582_1166 174
198 3300046507 Ga0495606_0000120 Ga0495606_0000120_29895_30482 174
199 3300046522 Ga0495643_0000759 Ga0495643_0000759_18231_18809 174
200 3300046616 Ga0495668_0000162 Ga0495668_0000162_90631_91218 174
201 3300046689 Ga0495613_0043544 Ga0495613_0043544_2304_2888 174
202 3300047320 Ga0495672_0000847 Ga0495672_0000847_17996_18574 174
203 3300049459 Ga0495678_001091 Ga0495678_001091_4869_5447 174
204 3300046507 Ga0495606_0003134 Ga0495606_0003134_7287_7901 175
205 3300005339 Ga0070660_100292380 Ga0070660_1002923802 176
206 3300005366 Ga0070659_100619342 Ga0070659_1006193422 176
207 3300010375 Ga0105239_10695243 Ga0105239_106952432 176
208 3300025919 Ga0207657_10319019 Ga0207657_103190192 176
209 3300025932 Ga0207690_10345890 Ga0207690_103458902 176
210 3300026116 Ga0207674_10047425 Ga0207674_100474255 176
211 3300031911 Ga0307412_10960080 Ga0307412_109600802 176
212 3300032126 Ga0307415_101027394 Ga0307415_1010273942 176
213 3300044684 Ga0466966_0118286 Ga0466966_0118286_1016_1597 176
214 3300046660 Ga0495625_0001374 Ga0495625_0001374_824_1411 176
215 3300047318 Ga0495636_0035219 Ga0495636_0035219_1020_1607 176
216 3300047323 Ga0495683_0036383 Ga0495683_0036383_188_802 176
217 3300047469 Ga0495673_0000391 Ga0495673_0000391_31159_31749 176
218 3300048091 Ga0495626_0044201 Ga0495626_0044201_1062_1637 176
219 3300048913 Ga0496110_0783836 Ga0496110_0783836_89_700 176
220 3300021361 Ga0213872_10000005 Ga0213872_1000000586 177
221 3300039447 Ga0436361_0126888 Ga0436361_0126888_13764_14372 177
222 3300046506 Ga0495583_0002934 Ga0495583_0002934_3817_4407 177
223 3300046615 Ga0495656_0239455 Ga0495656_0239455_280_870 177
224 3300046616 Ga0495668_0000343 Ga0495668_0000343_23240_23812 177
225 3300046660 Ga0495625_0010651 Ga0495625_0010651_4890_5471 177
226 3300047472 Ga0495686_0002181 Ga0495686_0002181_10829_11401 177
227 3300042157 Ga0439458_0005599 Ga0439458_0005599_1201_1773 178
228 3300046507 Ga0495606_0028793 Ga0495606_0028793_236_832 178
229 3300046538 Ga0495609_0007604 Ga0495609_0007604_561_1157 178
230 3300046615 Ga0495656_0226824 Ga0495656_0226824_113_703 178
231 3300046660 Ga0495625_0029959 Ga0495625_0029959_3039_3632 178
232 3300046810 Ga0495660_0001122 Ga0495660_0001122_10819_11415 178
233 3300047472 Ga0495686_0021171 Ga0495686_0021171_947_1543 178
234 3300048918 Ga0496115_0393733 Ga0496115_0393733_21_575 178
235 3300049459 Ga0495678_071675 Ga0495678_071675_359_934 178
236 3300013104 Ga0157370_11045353 Ga0157370_110453531 179
237 3300013306 Ga0163162_11235728 Ga0163162_112357282 179
238 3300017792 Ga0163161_10115624 Ga0163161_101156242 179
239 3300031911 Ga0307412_11335727 Ga0307412_113357271 179
240 3300032005 Ga0307411_10346231 Ga0307411_103462312 179
241 3300037418 Ga0395900_0159315 Ga0395900_0159315_1231_1782 179
242 3300037466 Ga0395898_0629455 Ga0395898_0629455_448_999 179
243 3300037471 Ga0395905_0017406 Ga0395905_0017406_458_1087 179
244 3300037471 Ga0395905_0163335 Ga0395905_0163335_33_581 179
245 3300037471 Ga0395905_0672411 Ga0395905_0672411_271_897 179
246 3300046491 Ga0495584_0061582 Ga0495584_0061582_130_720 179
247 3300046491 Ga0495584_0136331 Ga0495584_0136331_530_1171 179
248 3300046501 Ga0495607_0155840 Ga0495607_0155840_141_800 179
249 3300046513 Ga0495616_0000570 Ga0495616_0000570_16700_17356 179
250 3300046520 Ga0495637_0120095 Ga0495637_0120095_79_720 179
251 3300046528 Ga0495642_0002790 Ga0495642_0002790_3183_3731 179
252 3300046530 Ga0495654_0063796 Ga0495654_0063796_1029_1670 179
253 3300046539 Ga0495621_0003674 Ga0495621_0003674_2798_3352 179
254 3300046542 Ga0495597_0023145 Ga0495597_0023145_1029_1577 179
255 3300046616 Ga0495668_0118307 Ga0495668_0118307_71_619 179
256 3300046665 Ga0495661_0008659 Ga0495661_0008659_3396_3944 179
257 3300046674 Ga0495588_0213768 Ga0495588_0213768_109_663 179
258 3300047443 Ga0495687_005336 Ga0495687_005336_3431_3979 179
259 3300047443 Ga0495687_008018 Ga0495687_008018_524_1078 179
260 3300048091 Ga0495626_0022201 Ga0495626_0022201_2121_2780 179
261 3300048903 Ga0496100_0338383 Ga0496100_0338383_120_674 179
262 3300048904 Ga0496101_0248987 Ga0496101_0248987_652_1206 179
263 3300048905 Ga0496102_0043475 Ga0496102_0043475_1437_1991 179
264 3300048906 Ga0496103_0018515 Ga0496103_0018515_539_1093 179
265 3300048910 Ga0496107_0802108 Ga0496107_0802108_106_660 179
266 3300048913 Ga0496110_0052780 Ga0496110_0052780_2131_2685 179
267 3300048917 Ga0496114_0299840 Ga0496114_0299840_360_914 179
268 iso_pu_bacteria 2842711865 2842712275 179
269 iso_pu_bacteria 2857558681 2857560866 179
270 3300046507 Ga0495606_0006009 Ga0495606_0006009_10038_10640 180
271 3300046665 Ga0495661_0025119 Ga0495661_0025119_481_1119 180
272 3300053125 Ga0500618_026403 Ga0500618_026403_619_1248 180
273 iso_pu_bacteria 2857564685 2857568064 180
274 3300002987 JGI25159J45721_1004172 JGI25159J45721_10041722 181
275 3300005262 Ga0065165_1000936 Ga0065165_100093611 181
276 3300025284 Ga0209130_1000589 Ga0209130_100058911 181
277 3300025299 Ga0209256_1000054 Ga0209256_1000054186 181
278 3300025302 Ga0207426_1087340 Ga0207426_10873402 181
279 3300031838 Ga0307518_10133778 Ga0307518_101337782 181
280 3300042139 Ga0450904_000164 Ga0450904_000164_9300_9863 181
281 3300046471 Ga0495650_0009179 Ga0495650_0009179_4306_4896 181
282 3300046507 Ga0495606_0022485 Ga0495606_0022485_2992_3585 181
283 3300046512 Ga0495610_0019707 Ga0495610_0019707_79_687 181
284 3300046522 Ga0495643_0019848 Ga0495643_0019848_499_1107 181
285 3300046538 Ga0495609_0001024 Ga0495609_0001024_6348_6968 181
286 3300046691 Ga0495670_0069138 Ga0495670_0069138_865_1491 181
287 3300046694 Ga0495649_0023317 Ga0495649_0023317_1653_2204 181
288 3300046810 Ga0495660_0003018 Ga0495660_0003018_9399_10019 181
289 iso_pu_bacteria 2643221645 2644254742 181
290 iso_pu_bacteria 2643221664 2644360296 181
291 iso_pu_bacteria 2738541280 2738738051 181
292 iso_pu_bacteria 2738541300 2738843159 181
293 iso_pu_bacteria 2738543018 2739273910 181
294 iso_pu_bacteria 2738543030 2739342954 181
295 3300006948 Ga0099826_10000010 Ga0099826_10000010195 182
296 3300027666 Ga0209282_1000009 Ga0209282_1000009193 182
297 3300037471 Ga0395905_0198691 Ga0395905_0198691_642_1277 182
298 3300046524 Ga0495648_0093913 Ga0495648_0093913_513_1097 182
299 3300046558 Ga0495633_0000537 Ga0495633_0000537_19925_20509 182
300 3300049671 Ga0501238_007967 Ga0501238_007967_474_1028 182
301 3300049775 Ga0501279_002690 Ga0501279_002690_414_1010 182
302 3300053118 Ga0500594_0001066 Ga0500594_0001066_2169_2753 182
303 iso_pu_bacteria 2857553236 2857556212 182
304 iso_pu_bacteria 2904424332 2904428795 182
305 3300003323 rootH1_10212637 rootH1_102126374 183
306 3300003771 Ga0055526_1013585 Ga0055526_10135852 183
307 3300003775 Ga0055524_1010733 Ga0055524_10107332 183
308 3300003784 Ga0055534_1007654 Ga0055534_10076544 183
309 3300003791 Ga0055530_10010403 Ga0055530_100104032 183
310 3300003791 Ga0055530_10010491 Ga0055530_100104912 183
311 3300003794 Ga0055531_10009994 Ga0055531_100099943 183
312 3300025263 Ga0209565_1004481 Ga0209565_10044812 183
313 3300025291 Ga0209675_1010989 Ga0209675_10109892 183
314 3300025295 Ga0209564_1000063 Ga0209564_1000063278 183
315 3300025295 Ga0209564_1026845 Ga0209564_10268452 183
316 3300025298 Ga0209050_1001394 Ga0209050_100139427 183
317 3300025299 Ga0209256_1006664 Ga0209256_10066645 183
318 3300031548 Ga0307408_100001150 Ga0307408_10000115021 183
319 3300031548 Ga0307408_100048577 Ga0307408_1000485772 183
320 3300031548 Ga0307408_101186331 Ga0307408_1011863312 183
321 3300031711 Ga0265314_10037192 Ga0265314_100371923 183
322 3300046457 Ga0495590_0011366 Ga0495590_0011366_2066_2650 183
323 3300046460 Ga0495638_0061088 Ga0495638_0061088_479_1051 183
324 3300046460 Ga0495638_0423969 Ga0495638_0423969_21_605 183
325 3300046471 Ga0495650_0000431 Ga0495650_0000431_25851_26420 183
326 3300046492 Ga0495585_0066993 Ga0495585_0066993_110_676 183
327 3300046501 Ga0495607_0004458 Ga0495607_0004458_3276_3848 183
328 3300046501 Ga0495607_0112948 Ga0495607_0112948_382_966 183
329 3300046506 Ga0495583_0004595 Ga0495583_0004595_1093_1677 183
330 3300046507 Ga0495606_0006559 Ga0495606_0006559_3177_3746 183
331 3300046513 Ga0495616_0003871 Ga0495616_0003871_4287_4871 183
332 3300046513 Ga0495616_0015793 Ga0495616_0015793_329_901 183
333 3300046518 Ga0495631_0128436 Ga0495631_0128436_200_772 183
334 3300046519 Ga0495632_0001178 Ga0495632_0001178_12977_13549 183
335 3300046520 Ga0495637_0001342 Ga0495637_0001342_4327_4911 183
336 3300046522 Ga0495643_0000455 Ga0495643_0000455_22144_22788 183
337 3300046522 Ga0495643_0005232 Ga0495643_0005232_7859_8431 183
338 3300046524 Ga0495648_0167398 Ga0495648_0167398_235_813 183
339 3300046525 Ga0495663_0150027 Ga0495663_0150027_105_689 183
340 3300046528 Ga0495642_0007892 Ga0495642_0007892_3167_3751 183
341 3300046528 Ga0495642_0036440 Ga0495642_0036440_142_711 183
342 3300046530 Ga0495654_0000060 Ga0495654_0000060_29736_30320 183
343 3300046535 Ga0495586_0030539 Ga0495586_0030539_2033_2602 183
344 3300046538 Ga0495609_0000314 Ga0495609_0000314_11992_12576 183
345 3300046557 Ga0495622_0001345 Ga0495622_0001345_1800_2381 183
346 3300046616 Ga0495668_0041299 Ga0495668_0041299_374_958 183
347 3300046660 Ga0495625_0005443 Ga0495625_0005443_6385_6969 183
348 3300046665 Ga0495661_0017352 Ga0495661_0017352_3358_3930 183
349 3300046684 Ga0495669_0000791 Ga0495669_0000791_7720_8304 183
350 3300046694 Ga0495649_0009645 Ga0495649_0009645_1664_2248 183
351 3300046694 Ga0495649_0016333 Ga0495649_0016333_1803_2390 183
352 3300046810 Ga0495660_0001641 Ga0495660_0001641_2666_3277 183
353 3300046810 Ga0495660_0075701 Ga0495660_0075701_593_1177 183
354 3300047323 Ga0495683_0032704 Ga0495683_0032704_1770_2336 183
355 3300047445 Ga0495677_0003277 Ga0495677_0003277_3347_3919 183
356 3300047446 Ga0495679_005794 Ga0495679_005794_600_1184 183
357 3300047470 Ga0495681_0001259 Ga0495681_0001259_14401_14985 183
358 3300047470 Ga0495681_0005040 Ga0495681_0005040_7582_8181 183
359 3300048091 Ga0495626_0009393 Ga0495626_0009393_748_1320 183
360 3300049659 Ga0501214_039372 Ga0501214_039372_12_608 183
361 iso_pu_bacteria 2643221554 2643792005 183
362 3300025298 Ga0209050_1014177 Ga0209050_10141774 184
363 3300025304 Ga0209257_1015089 Ga0209257_10150894 184
364 3300031548 Ga0307408_100002743 Ga0307408_10000274310 184
365 3300031548 Ga0307408_100049031 Ga0307408_1000490313 184
366 3300044683 Ga0466965_0054518 Ga0466965_0054518_1210_1791 184
367 3300046474 Ga0495605_0000061 Ga0495605_0000061_36005_36586 184
368 3300053125 Ga0500618_000364 Ga0500618_000364_26618_27196 184
369 3300002774 JGI25150J39212_1003851 JGI25150J39212_10038514 185
370 3300003187 JGI25151J46595_10073400 JGI25151J46595_100734002 185
371 3300003215 JGI25153J46596_10051978 JGI25153J46596_100519781 185
372 3300003323 rootH1_10272748 rootH1_102727481 185
373 3300009036 Ga0105244_10000402 Ga0105244_100004023 185
374 3300025245 Ga0207425_1000537 Ga0207425_100053715 185
375 3300025294 Ga0209025_1004179 Ga0209025_10041795 185
376 3300025297 Ga0209758_1000322 Ga0209758_100032287 185
377 3300025728 Ga0207655_1008552 Ga0207655_10085525 185
378 3300028794 Ga0307515_10186357 Ga0307515_101863572 185
379 3300046452 Ga0495617_003529 Ga0495617_003529_2903_3496 185
380 3300046452 Ga0495617_058564 Ga0495617_058564_490_1080 185
381 3300046457 Ga0495590_0035383 Ga0495590_0035383_723_1313 185
382 3300046460 Ga0495638_0001941 Ga0495638_0001941_8162_8752 185
383 3300046474 Ga0495605_0000641 Ga0495605_0000641_14434_15024 185
384 3300046491 Ga0495584_0001470 Ga0495584_0001470_2069_2659 185
385 3300046492 Ga0495585_0089000 Ga0495585_0089000_414_1004 185
386 3300046492 Ga0495585_0116368 Ga0495585_0116368_116_706 185
387 3300046501 Ga0495607_0013095 Ga0495607_0013095_834_1421 185
388 3300046506 Ga0495583_0000947 Ga0495583_0000947_23872_24462 185
389 3300046507 Ga0495606_0061007 Ga0495606_0061007_587_1162 185
390 3300046512 Ga0495610_0001967 Ga0495610_0001967_15260_15847 185
391 3300046512 Ga0495610_0035711 Ga0495610_0035711_230_832 185
392 3300046513 Ga0495616_0002996 Ga0495616_0002996_7367_7957 185
393 3300046513 Ga0495616_0004627 Ga0495616_0004627_4842_5432 185
394 3300046520 Ga0495637_0018645 Ga0495637_0018645_440_1033 185
395 3300046530 Ga0495654_0013481 Ga0495654_0013481_470_1045 185
396 3300046538 Ga0495609_0003230 Ga0495609_0003230_1212_1802 185
397 3300046542 Ga0495597_0018903 Ga0495597_0018903_1997_2572 185
398 3300046542 Ga0495597_0101632 Ga0495597_0101632_503_1090 185
399 3300046557 Ga0495622_0131427 Ga0495622_0131427_463_1053 185
400 3300046558 Ga0495633_0001086 Ga0495633_0001086_20780_21382 185
401 3300046558 Ga0495633_0011756 Ga0495633_0011756_1412_1999 185
402 3300046558 Ga0495633_0021099 Ga0495633_0021099_603_1193 185
403 3300046615 Ga0495656_0018221 Ga0495656_0018221_1207_1797 185
404 3300046615 Ga0495656_0183696 Ga0495656_0183696_313_903 185
405 3300046660 Ga0495625_0002210 Ga0495625_0002210_19345_19920 185
406 3300046660 Ga0495625_0405642 Ga0495625_0405642_176_766 185
407 3300046664 Ga0495659_0000127 Ga0495659_0000127_2135_2710 185
408 3300046664 Ga0495659_0003238 Ga0495659_0003238_2591_3181 185
409 3300046665 Ga0495661_0043918 Ga0495661_0043918_1607_2197 185
410 3300046665 Ga0495661_0061188 Ga0495661_0061188_142_732 185
411 3300046691 Ga0495670_0016970 Ga0495670_0016970_1986_2576 185
412 3300046692 Ga0495671_0000266 Ga0495671_0000266_30931_31506 185
413 3300046692 Ga0495671_0039703 Ga0495671_0039703_1042_1632 185
414 3300046694 Ga0495649_0261804 Ga0495649_0261804_220_807 185
415 3300046810 Ga0495660_0175400 Ga0495660_0175400_310_900 185
416 3300046810 Ga0495660_0223158 Ga0495660_0223158_25_600 185
417 3300047318 Ga0495636_0005873 Ga0495636_0005873_2315_2905 185
418 3300047320 Ga0495672_0000297 Ga0495672_0000297_63364_63939 185
419 3300047323 Ga0495683_0001476 Ga0495683_0001476_9545_10135 185
420 3300047443 Ga0495687_000814 Ga0495687_000814_23586_24176 185
421 3300047445 Ga0495677_0010359 Ga0495677_0010359_1281_1871 185
422 3300047447 Ga0495685_000125 Ga0495685_000125_9291_9881 185
423 3300047469 Ga0495673_0020688 Ga0495673_0020688_248_838 185
424 3300047472 Ga0495686_0040167 Ga0495686_0040167_1448_2035 185
425 3300048919 Ga0496116_0128644 Ga0496116_0128644_172_765 185
426 3300048927 Ga0496124_0106458 Ga0496124_0106458_1332_1928 185
427 3300049459 Ga0495678_000010 Ga0495678_000010_266376_266987 185
428 3300049459 Ga0495678_009080 Ga0495678_009080_1868_2458 185
429 3300049460 Ga0495682_0000380 Ga0495682_0000380_30385_30975 185
430 3300053145 Ga0500586_104606 Ga0500586_104606_178_780 185
431 iso_pu_bacteria 2738541297 2738826853 185
432 iso_pu_bacteria 2738541357 2739150650 185
433 iso_pu_bacteria 2738543003 2739192569 185
434 iso_pu_bacteria 2738543026 2739319046 185
435 iso_pu_bacteria 2738543029 2739337287 185
436 iso_pu_bacteria 2821131069 2821135813 185
437 3300006946 Ga0079104_1002533 Ga0079104_10025336 186
438 3300015261 Ga0182006_1000141 Ga0182006_100014142 186
439 3300015265 Ga0182005_1000016 Ga0182005_1000016215 186
440 3300032002 Ga0307416_100012949 Ga0307416_1000129495 186
441 3300046453 Ga0495627_000011 Ga0495627_000011_257392_258003 186
442 3300046523 Ga0495644_0016264 Ga0495644_0016264_377_988 186
443 iso_pu_bacteria 2919476304 2919477032 186
444 3300002739 JGI25158J39367_1001466 JGI25158J39367_10014664 187
445 3300002774 JGI25150J39212_1001314 JGI25150J39212_10013142 187
446 3300003354 JGI25160J50197_1002425 JGI25160J50197_10024257 187
447 3300003374 JGI25161J50226_1001720 JGI25161J50226_10017205 187
448 3300003771 Ga0055526_1004432 Ga0055526_10044324 187
449 3300003775 Ga0055524_1002758 Ga0055524_10027588 187
450 3300003784 Ga0055534_1000893 Ga0055534_10008939 187
451 3300003790 Ga0055528_1002464 Ga0055528_10024649 187
452 3300003791 Ga0055530_10006433 Ga0055530_100064334 187
453 3300003794 Ga0055531_10014997 Ga0055531_100149974 187
454 3300025208 Ga0209436_102087 Ga0209436_1020873 187
455 3300025245 Ga0207425_1001616 Ga0207425_10016168 187
456 3300025258 Ga0209129_1012066 Ga0209129_10120662 187
457 3300025263 Ga0209565_1002327 Ga0209565_10023274 187
458 3300025273 Ga0209673_1004967 Ga0209673_10049677 187
459 3300025284 Ga0209130_1002435 Ga0209130_10024356 187
460 3300025284 Ga0209130_1003248 Ga0209130_10032484 187
461 3300025291 Ga0209675_1002849 Ga0209675_10028495 187
462 3300025295 Ga0209564_1005608 Ga0209564_10056083 187
463 3300025298 Ga0209050_1000050 Ga0209050_1000050101 187
464 3300025299 Ga0209256_1001035 Ga0209256_100103532 187
465 3300025299 Ga0209256_1001215 Ga0209256_100121528 187
466 3300025302 Ga0207426_1003614 Ga0207426_10036145 187
467 3300025304 Ga0209257_1000075 Ga0209257_1000075101 187
468 3300031548 Ga0307408_100031490 Ga0307408_1000314903 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03968

LptD_N

LptA/(LptD N-terminal domain) LPS transport protein

30

149

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r1a-assembly2.cif.gz_E crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.9104 24 155
2r1a-assembly2.cif.gz_G crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8875 24 159
2r1a-assembly1.cif.gz_A crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8839 23 159
2r1a-assembly2.cif.gz_H crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8691 23 159
2r1a-assembly1.cif.gz_B crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8637 24 159
ID Description Score Start End Superfamily
2r1aH00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.8691 23 159 2.60.450.10
2r1aH00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.8198 23 159 2.60.450.10
4uu4A00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.8108 24 173 2.60.450.10
3my2A00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.7954 28 153 2.60.450.10
4uu4A00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.7948 24 173 2.60.450.10
ID Description Score Start End GO Terms
AF-A0A2D9EQG1-F1-model_v4 deleted 0.9037 27 152
AF-A0A2C8CXN7-F1-model_v4 Lipopolysaccharide export system protein LptA 0.8994 16 159 GO:0001530
GO:0009279
GO:0015920
GO:0017089
GO:0030288
GO:0043165
AF-A0A257QKA6-F1-model_v4 Lipopolysaccharide transport periplasmic protein LptA 0.899 30 152 GO:0001530
GO:0009279
GO:0015920
GO:0017089
GO:0030288
AF-A0A838F103-F1-model_v4 Organic solvent tolerance-like N-terminal domain-containing protein 0.8856 27 153
AF-A0A3D2PWV4-F1-model_v4 Lipopolysaccharide transport periplasmic protein LptA 0.8761 23 158 GO:0001530
GO:0009279
GO:0015920
GO:0017089
GO:0030288

Feature Viewer

pLDDT pTM Quality
83.42 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map