F449991

General Info

Members Datasets Scaffolds Average Seq Length
468 240 936 180

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100622698|Ga0070707_1006226982
Length 188
Sequence VRLHCIVEDADTARIAAEGGATVIQLRLKGVPTLELVERGRPIAEIASERGITFVVNDDVEAALALNADGVHLGRRDRGKELAQAAGLLLGISATSPYEAMAAVEQGAEYVGAGPVWLTPTKTDAGSAIGIDGLAEICEVVSVPVVAIGGIDASNAGDCIRAGAKGVAVVRASADAQRVRAALDAAAF

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
179 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 4.7
Rhizosphere 93.59
Stem 0
Stem Tuber 0
Unclassified 14.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100622698 3300005468 Bacteria 1042
2 JGI24747J21853_1021113 3300001978 Bacteria 709
3 JGI24744J21845_10003251 3300002077 Bacteria 3335
4 Ga0070658_10150170 3300005327 Bacteria 1950
5 Ga0070683_100004848 3300005329 Bacteria 11140
6 Ga0070683_100010545 3300005329 Bacteria 7944
7 Ga0070683_100084138 3300005329 Bacteria 2980
8 Ga0070683_100350635 3300005329 Bacteria 1405
9 Ga0070690_100083438 3300005330 Bacteria 2093
10 Ga0070680_100012948 3300005336 Bacteria 6488
11 Ga0070680_100089864 3300005336 Bacteria 2542
12 Ga0070680_100123360 3300005336 Bacteria 2163
13 Ga0070680_100132177 3300005336 Bacteria 2089
14 Ga0070680_100242082 3300005336 Bacteria 1525
15 Ga0070680_100736253 3300005336 Bacteria 849
16 Ga0070682_100128340 3300005337 Bacteria 1713
17 Ga0068868_100019562 3300005338 Bacteria 5074
18 Ga0068868_100656212 3300005338 Unclassified 935
19 Ga0070660_100008069 3300005339 Bacteria 7358
20 Ga0070660_100140460 3300005339 Bacteria 1937
21 Ga0070660_100178797 3300005339 Bacteria 1716
22 Ga0070660_100224921 3300005339 Bacteria 1526
23 Ga0070689_100022832 3300005340 Bacteria 4676
24 Ga0070687_100122381 3300005343 Bacteria 1490
25 Ga0070661_100051707 3300005344 Bacteria 3007
26 Ga0070661_100077899 3300005344 Bacteria 2445
27 Ga0070661_100163915 3300005344 Unclassified 1684
28 Ga0070661_100225038 3300005344 Bacteria 1440
29 Ga0070692_10000930 3300005345 Bacteria 9925
30 Ga0070668_100017495 3300005347 Bacteria 5374
31 Ga0070669_100325709 3300005353 Bacteria 1242
32 Ga0070669_100690597 3300005353 Unclassified 861
33 Ga0070675_100039634 3300005354 Bacteria 3845
34 Ga0070671_100011250 3300005355 Bacteria 7189
35 Ga0070674_100009384 3300005356 Bacteria 5857
36 Ga0070674_100313543 3300005356 Bacteria 1255
37 Ga0070688_100008083 3300005365 Bacteria 5696
38 Ga0070688_100160355 3300005365 Unclassified 1545
39 Ga0070659_100031878 3300005366 Bacteria 4085
40 Ga0070659_100049947 3300005366 Bacteria 3289
41 Ga0070659_100058103 3300005366 Bacteria 3052
42 Ga0070659_100267844 3300005366 Bacteria 1418
43 Ga0070659_100531656 3300005366 Unclassified 1005
44 Ga0070709_10090464 3300005434 Unclassified 2017
45 Ga0070714_100122074 3300005435 Bacteria 2318
46 Ga0070710_10021256 3300005437 Bacteria 3378
47 Ga0070701_10151347 3300005438 Unclassified 1336
48 Ga0070711_100003496 3300005439 Bacteria 9163
49 Ga0070705_100193470 3300005440 Bacteria 1388
50 Ga0070705_100487283 3300005440 Unclassified 933
51 Ga0070700_100012749 3300005441 Bacteria 4704
52 Ga0070694_100028360 3300005444 Bacteria 3643
53 Ga0070694_101028362 3300005444 Bacteria 685
54 Ga0070663_100121836 3300005455 Bacteria 1971
55 Ga0070663_100498649 3300005455 Unclassified 1011
56 Ga0070678_100000348 3300005456 Bacteria 21658
57 Ga0070681_10009067 3300005458 Bacteria 9779
58 Ga0070681_10037094 3300005458 Bacteria 4892
59 Ga0070681_10142897 3300005458 Bacteria 2322
60 Ga0068867_100000550 3300005459 Bacteria 24730
61 Ga0070685_10070558 3300005466 Unclassified 2069
62 Ga0070685_10105745 3300005466 Unclassified 1725
63 Ga0070706_100139998 3300005467 Unclassified 2259
64 Ga0070707_100136641 3300005468 Bacteria 2385
65 Ga0070679_100005474 3300005530 Bacteria 11768
66 Ga0070679_100088585 3300005530 Bacteria 3082
67 Ga0070679_100088735 3300005530 Bacteria 3079
68 Ga0070684_100002645 3300005535 Bacteria 13223
69 Ga0070684_100029427 3300005535 Bacteria 4654
70 Ga0070684_100051038 3300005535 Bacteria 3593
71 Ga0070684_100080438 3300005535 Bacteria 2882
72 Ga0070684_100209253 3300005535 Unclassified 1777
73 Ga0070684_100249132 3300005535 Unclassified 1623
74 Ga0068853_100013271 3300005539 Bacteria 6727
75 Ga0068853_100025861 3300005539 Bacteria 4927
76 Ga0068853_100250028 3300005539 Bacteria 1626
77 Ga0068853_100254416 3300005539 Bacteria 1613
78 Ga0070672_100127232 3300005543 Bacteria 2091
79 Ga0070686_100001971 3300005544 Bacteria 11400
80 Ga0070695_100020931 3300005545 Bacteria 3997
81 Ga0070696_100174181 3300005546 Unclassified 1592
82 Ga0070696_100432243 3300005546 Unclassified 1036
83 Ga0070693_100109189 3300005547 Unclassified 1699
84 Ga0070693_100132146 3300005547 Bacteria 1562
85 Ga0070704_100001647 3300005549 Bacteria 12110
86 Ga0068855_100157957 3300005563 Bacteria 2575
87 Ga0068855_100185139 3300005563 Bacteria 2352
88 Ga0068855_100219171 3300005563 Bacteria 2134
89 Ga0068855_100260292 3300005563 Bacteria 1933
90 Ga0068855_100310298 3300005563 Bacteria 1745
91 Ga0070664_100212383 3300005564 Archaea 1729
92 Ga0068857_100001566 3300005577 Bacteria 18312
93 Ga0068857_100044765 3300005577 Bacteria 3926
94 Ga0068857_100118885 3300005577 Bacteria 2378
95 Ga0068857_100201467 3300005577 Unclassified 1814
96 Ga0068856_100032443 3300005614 Bacteria 5113
97 Ga0068856_100090019 3300005614 Bacteria 3052
98 Ga0068856_100151653 3300005614 Bacteria 2327
99 Ga0068856_100231593 3300005614 Bacteria 1863
100 Ga0068856_100284575 3300005614 Bacteria 1670
101 Ga0070702_100009050 3300005615 Bacteria 4855
102 Ga0068852_100003964 3300005616 Bacteria 10400
103 Ga0068852_100019274 3300005616 Bacteria 5395
104 Ga0068852_100187339 3300005616 Bacteria 1950
105 Ga0068852_100328766 3300005616 Bacteria 1487
106 Ga0068859_100277071 3300005617 Unclassified 1770
107 Ga0068864_100884970 3300005618 Bacteria 881
108 Ga0068866_10004786 3300005718 Bacteria 5554
109 Ga0068858_100184024 3300005842 Bacteria 1973
110 Ga0081455_10004052 3300005937 Bacteria 16607
111 Ga0081455_10012594 3300005937 Bacteria 8430
112 Ga0081455_10060637 3300005937 Bacteria 3188
113 Ga0081538_10000820 3300005981 Bacteria 33705
114 Ga0081538_10134478 3300005981 Bacteria 1155
115 Ga0081540_1009278 3300005983 Bacteria 6785
116 Ga0081539_10005141 3300005985 Bacteria 13634
117 Ga0075365_10042028 3300006038 Bacteria 2987
118 Ga0075364_10046850 3300006051 Bacteria 2815
119 Ga0070715_10078369 3300006163 Bacteria 1493
120 Ga0070712_100025467 3300006175 Bacteria 3932
121 Ga0070712_100854694 3300006175 Bacteria 783
122 Ga0075362_10028239 3300006177 Bacteria 2408
123 Ga0075366_10240443 3300006195 Bacteria 1104
124 Ga0097621_100011037 3300006237 Bacteria 6639
125 Ga0068871_100037920 3300006358 Bacteria 3845
126 Ga0075428_100288929 3300006844 Unclassified 1764
127 Ga0075428_100774355 3300006844 Bacteria 1020
128 Ga0075428_101473108 3300006844 Bacteria 713
129 Ga0075430_100106035 3300006846 Bacteria 2345
130 Ga0075433_11065752 3300006852 Bacteria 703
131 Ga0075434_100491475 3300006871 Bacteria 1248
132 Ga0075429_100146313 3300006880 Unclassified 2068
133 Ga0075429_100166127 3300006880 Bacteria 1933
134 Ga0075429_100371375 3300006880 Bacteria 1252
135 Ga0068865_100000227 3300006881 Bacteria 31272
136 Ga0097620_100277076 3300006931 Unclassified 1770
137 Ga0075435_100578968 3300007076 Bacteria 973
138 Ga0105240_10092883 3300009093 Bacteria 3684
139 Ga0105240_10126827 3300009093 Bacteria 3065
140 Ga0105240_10166489 3300009093 Bacteria 2614
141 Ga0105240_10371347 3300009093 Bacteria 1617
142 Ga0111539_10072722 3300009094 Bacteria 4055
143 Ga0111539_10281728 3300009094 Bacteria 1934
144 Ga0111539_10298764 3300009094 Bacteria 1874
145 Ga0111539_11590652 3300009094 Bacteria 758
146 Ga0105245_10023233 3300009098 Bacteria 5443
147 Ga0105247_10013699 3300009101 Bacteria 4862
148 Ga0114129_10173174 3300009147 Bacteria 2941
149 Ga0114129_10401449 3300009147 Bacteria 1806
150 Ga0114129_11285316 3300009147 Bacteria 907
151 Ga0114129_11929900 3300009147 Bacteria 715
152 Ga0105243_10010370 3300009148 Bacteria 7075
153 Ga0105243_10038925 3300009148 Bacteria 3705
154 Ga0105241_10366779 3300009174 Bacteria 1254
155 Ga0105241_10526031 3300009174 Bacteria 1058
156 Ga0105242_10001454 3300009176 Bacteria 18636
157 Ga0105248_10058439 3300009177 Bacteria 4331
158 Ga0105237_10010036 3300009545 Bacteria 10102
159 Ga0105237_10640631 3300009545 Bacteria 1070
160 Ga0105238_10052274 3300009551 Bacteria 4107
161 Ga0105238_10386169 3300009551 Unclassified 1392
162 Ga0105238_10967355 3300009551 Unclassified 871
163 Ga0105249_10019177 3300009553 Bacteria 6099
164 Ga0105239_10001933 3300010375 Bacteria 27042
165 Ga0105239_10294090 3300010375 Bacteria 1829
166 Ga0105239_10945530 3300010375 Unclassified 990
167 Ga0105246_10749658 3300011119 Unclassified 861
168 Ga0157373_10027781 3300013100 Bacteria 4082
169 Ga0157370_10012659 3300013104 Bacteria 8737
170 Ga0157370_10041612 3300013104 Bacteria 4430
171 Ga0157370_10087625 3300013104 Bacteria 2924
172 Ga0157369_10063986 3300013105 Bacteria 3962
173 Ga0157369_10110074 3300013105 Bacteria 2928
174 Ga0157369_10189203 3300013105 Bacteria 2163
175 Ga0157374_10009866 3300013296 Bacteria 8196
176 Ga0157374_10069471 3300013296 Bacteria 3317
177 Ga0157378_10002034 3300013297 Bacteria 18114
178 Ga0163162_10002291 3300013306 Bacteria 17972
179 Ga0157372_10021925 3300013307 Bacteria 6904
180 Ga0157372_10037346 3300013307 Bacteria 5357
181 Ga0157372_10481752 3300013307 Bacteria 1446
182 Ga0157372_10679277 3300013307 Unclassified 1199
183 Ga0157375_10122700 3300013308 Bacteria 2710
184 Ga0157380_10012923 3300014326 Bacteria 6070
185 Ga0157377_10015403 3300014745 Bacteria 3911
186 Ga0157377_10212492 3300014745 Unclassified 1234
187 Ga0157376_10155122 3300014969 Bacteria 2069
188 Ga0157376_11108434 3300014969 Bacteria 817
189 Ga0163161_10273581 3300017792 Bacteria 1322
190 Ga0197907_11375510 3300020069 Bacteria 3928
191 Ga0206356_10931012 3300020070 Bacteria 1623
192 Ga0206356_11813809 3300020070 Bacteria 3389
193 Ga0206354_10221291 3300020081 Unclassified 966
194 Ga0206353_10206358 3300020082 Bacteria 1128
195 Ga0206353_11776641 3300020082 Bacteria 752
196 Ga0207692_10056336 3300025898 Bacteria 2016
197 Ga0207642_10002393 3300025899 Bacteria 5841
198 Ga0207710_10358661 3300025900 Bacteria 743
199 Ga0207688_10019580 3300025901 Bacteria 3689
200 Ga0207688_10172842 3300025901 Unclassified 1285
201 Ga0207685_10125749 3300025905 Unclassified 1132
202 Ga0207699_10017845 3300025906 Bacteria 3748
203 Ga0207705_10039283 3300025909 Bacteria 3391
204 Ga0207705_10080931 3300025909 Bacteria 2367
205 Ga0207654_10264326 3300025911 Bacteria 1158
206 Ga0207707_10016226 3300025912 Bacteria 6498
207 Ga0207707_10063650 3300025912 Bacteria 3210
208 Ga0207707_10266053 3300025912 Bacteria 1487
209 Ga0207695_10269358 3300025913 Bacteria 1599
210 Ga0207695_10331294 3300025913 Bacteria 1411
211 Ga0207695_10692479 3300025913 Unclassified 900
212 Ga0207671_10030030 3300025914 Bacteria 4055
213 Ga0207671_10060186 3300025914 Bacteria 2817
214 Ga0207693_10003681 3300025915 Bacteria 13082
215 Ga0207663_10017905 3300025916 Bacteria 3957
216 Ga0207663_10971146 3300025916 Bacteria 681
217 Ga0207660_10066049 3300025917 Bacteria 2616
218 Ga0207660_10128854 3300025917 Bacteria 1924
219 Ga0207660_10148373 3300025917 Bacteria 1800
220 Ga0207660_11116795 3300025917 Unclassified 642
221 Ga0207662_10108225 3300025918 Bacteria 1730
222 Ga0207657_10012651 3300025919 Bacteria 8318
223 Ga0207657_10024376 3300025919 Bacteria 5604
224 Ga0207657_10036084 3300025919 Bacteria 4427
225 Ga0207649_10116714 3300025920 Bacteria 1793
226 Ga0207652_10018379 3300025921 Bacteria 5732
227 Ga0207652_10028339 3300025921 Bacteria 4673
228 Ga0207652_10028689 3300025921 Bacteria 4646
229 Ga0207652_10061304 3300025921 Bacteria 3248
230 Ga0207652_10140930 3300025921 Bacteria 2156
231 Ga0207652_10954699 3300025921 Unclassified 755
232 Ga0207646_10087583 3300025922 Bacteria 2786
233 Ga0207681_10221570 3300025923 Bacteria 1464
234 Ga0207694_10037276 3300025924 Bacteria 3733
235 Ga0207694_10117288 3300025924 Bacteria 2122
236 Ga0207694_10866446 3300025924 Unclassified 763
237 Ga0207659_10139463 3300025926 Unclassified 1881
238 Ga0207659_10370309 3300025926 Unclassified 1193
239 Ga0207687_10197195 3300025927 Bacteria 1571
240 Ga0207687_10368656 3300025927 Bacteria 1174
241 Ga0207644_10030893 3300025931 Bacteria 3729
242 Ga0207690_10054060 3300025932 Bacteria 2698
243 Ga0207690_10219144 3300025932 Bacteria 1455
244 Ga0207690_10507831 3300025932 Bacteria 976
245 Ga0207690_10631038 3300025932 Bacteria 877
246 Ga0207690_10761463 3300025932 Unclassified 799
247 Ga0207706_10045694 3300025933 Bacteria 3879
248 Ga0207686_10002081 3300025934 Bacteria 11023
249 Ga0207709_10000390 3300025935 Bacteria 43485
250 Ga0207670_10112563 3300025936 Bacteria 1964
251 Ga0207669_10001870 3300025937 Bacteria 8925
252 Ga0207669_10457386 3300025937 Unclassified 1013
253 Ga0207704_10001726 3300025938 Bacteria 9786
254 Ga0207665_10047882 3300025939 Bacteria 2868
255 Ga0207691_10005205 3300025940 Bacteria 12557
256 Ga0207711_10023885 3300025941 Bacteria 5117
257 Ga0207689_10538623 3300025942 Bacteria 980
258 Ga0207661_10046621 3300025944 Bacteria 3437
259 Ga0207661_10105323 3300025944 Bacteria 2376
260 Ga0207661_10144018 3300025944 Bacteria 2054
261 Ga0207661_10442018 3300025944 Unclassified 1184
262 Ga0207679_10144669 3300025945 Unclassified 1926
263 Ga0207679_10671515 3300025945 Bacteria 938
264 Ga0207667_10101999 3300025949 Bacteria 2960
265 Ga0207667_10125721 3300025949 Bacteria 2641
266 Ga0207667_10616103 3300025949 Unclassified 1093
267 Ga0207712_10017518 3300025961 Bacteria 4653
268 Ga0207668_10433379 3300025972 Bacteria 1118
269 Ga0207640_10129940 3300025981 Bacteria 1819
270 Ga0207677_10229695 3300026023 Unclassified 1494
271 Ga0207703_10210804 3300026035 Bacteria 1732
272 Ga0207639_10014663 3300026041 Bacteria 5520
273 Ga0207639_10024567 3300026041 Bacteria 4363
274 Ga0207639_10720549 3300026041 Archaea 926
275 Ga0207678_10007853 3300026067 Bacteria 9414
276 Ga0207678_10046171 3300026067 Bacteria 3767
277 Ga0207678_10085355 3300026067 Bacteria 2699
278 Ga0207708_10000175 3300026075 Bacteria 51009
279 Ga0207702_10023361 3300026078 Bacteria 5127
280 Ga0207702_10235991 3300026078 Bacteria 1711
281 Ga0207702_10246198 3300026078 Bacteria 1677
282 Ga0207702_10350269 3300026078 Bacteria 1413
283 Ga0207702_10515850 3300026078 Bacteria 1166
284 Ga0207648_10000082 3300026089 Bacteria 89474
285 Ga0207674_10004721 3300026116 Bacteria 16335
286 Ga0207674_10015768 3300026116 Bacteria 8290
287 Ga0207674_10036583 3300026116 Bacteria 5112
288 Ga0207674_10177219 3300026116 Bacteria 2084
289 Ga0207674_10572002 3300026116 Unclassified 1092
290 Ga0207675_100035510 3300026118 Bacteria 4649
291 Ga0207683_10001734 3300026121 Bacteria 19413
292 Ga0207698_10002832 3300026142 Bacteria 10375
293 Ga0207698_10118946 3300026142 Bacteria 2232
294 Ga0207428_10079332 3300027907 Bacteria 2567
295 Ga0207428_10243164 3300027907 Bacteria 1344
296 Ga0268266_10896593 3300028379 Unclassified 857
297 Ga0268265_10242334 3300028380 Bacteria 1592
298 Ga0307416_100742644 3300032002 Bacteria 1073
299 Ga0307415_100054338 3300032126 Bacteria 2733
300 Ga0307415_100859944 3300032126 Unclassified 833
301 Ga0307415_101442103 3300032126 Bacteria 657
302 Ga0373945_0006436 3300035116 Bacteria 3788
303 Ga0373945_0287596 3300035116 Bacteria 702
304 Ga0373943_0032013 3300035170 Bacteria 2497
305 Ga0373943_0141930 3300035170 Bacteria 1295
306 Ga0373946_0010077 3300035171 Bacteria 3494
307 Ga0373935_0090381 3300035692 Bacteria 2004
308 Ga0373935_0505929 3300035692 Bacteria 877
309 Ga0373927_0275177 3300035695 Bacteria 1107
310 Ga0373947_0005896 3300035725 Bacteria 7141
311 Ga0373925_0098365 3300037068 Bacteria 2245
312 Ga0373925_0230450 3300037068 Unclassified 1481
313 Ga0395899_0021817 3300037312 Bacteria 4857
314 Ga0395899_0033910 3300037312 Bacteria 3833
315 Ga0395899_0036391 3300037312 Bacteria 3692
316 Ga0395899_0039103 3300037312 Bacteria 3552
317 Ga0395899_0065223 3300037312 Bacteria 2676
318 Ga0395899_0072174 3300037312 Bacteria 2526
319 Ga0395899_0106778 3300037312 Bacteria 2016
320 Ga0395899_0160222 3300037312 Bacteria 1590
321 Ga0395899_0207582 3300037312 Unclassified 1363
322 Ga0395899_0260701 3300037312 Bacteria 1186
323 Ga0395899_0274082 3300037312 Unclassified 1150
324 Ga0395899_0463246 3300037312 Bacteria 828
325 Ga0395900_0010463 3300037418 Bacteria 9487
326 Ga0395900_0025357 3300037418 Bacteria 6070
327 Ga0395900_0062446 3300037418 Bacteria 3829
328 Ga0395900_0067492 3300037418 Bacteria 3674
329 Ga0395900_0103993 3300037418 Bacteria 2917
330 Ga0395900_0106914 3300037418 Bacteria 2874
331 Ga0395900_0118965 3300037418 Bacteria 2711
332 Ga0395900_0134744 3300037418 Bacteria 2530
333 Ga0395900_0167781 3300037418 Bacteria 2236
334 Ga0395900_0228933 3300037418 Bacteria 1870
335 Ga0395900_0295539 3300037418 Bacteria 1607
336 Ga0395900_0969032 3300037418 Bacteria 771
337 Ga0395898_0004891 3300037466 Bacteria 14546
338 Ga0395898_0013441 3300037466 Bacteria 8431
339 Ga0395898_0021812 3300037466 Bacteria 6488
340 Ga0395898_0064016 3300037466 Bacteria 3567
341 Ga0395898_0090562 3300037466 Bacteria 2943
342 Ga0395898_0133021 3300037466 Bacteria 2381
343 Ga0395898_0141404 3300037466 Bacteria 2304
344 Ga0395898_0298721 3300037466 Bacteria 1536
345 Ga0395898_0315063 3300037466 Bacteria 1493
346 Ga0395898_0499219 3300037466 Bacteria 1157
347 Ga0395905_0002227 3300037471 Bacteria 21873
348 Ga0395905_0017117 3300037471 Bacteria 6884
349 Ga0395905_0042772 3300037471 Bacteria 4250
350 Ga0395905_0047513 3300037471 Bacteria 4022
351 Ga0395905_0060884 3300037471 Bacteria 3530
352 Ga0395905_0136059 3300037471 Bacteria 2311
353 Ga0395905_0159821 3300037471 Bacteria 2118
354 Ga0395905_0266010 3300037471 Bacteria 1600
355 Ga0395905_0350436 3300037471 Bacteria 1368
356 Ga0395905_0595623 3300037471 Bacteria 1007
357 Ga0395905_1148384 3300037471 Unclassified 680
358 Ga0395901_0010036 3300038443 Bacteria 9601
359 Ga0395901_0016760 3300038443 Bacteria 7466
360 Ga0395901_0027283 3300038443 Bacteria 5866
361 Ga0395901_0035743 3300038443 Bacteria 5133
362 Ga0395901_0048211 3300038443 Bacteria 4423
363 Ga0395901_0052723 3300038443 Bacteria 4227
364 Ga0395901_0053465 3300038443 Bacteria 4195
365 Ga0395901_0092851 3300038443 Bacteria 3159
366 Ga0395901_0100489 3300038443 Bacteria 3034
367 Ga0395901_0402339 3300038443 Bacteria 1406
368 Ga0395901_0416369 3300038443 Bacteria 1378
369 Ga0395901_0576258 3300038443 Bacteria 1138
370 Ga0395901_0873072 3300038443 Bacteria 883
371 Ga0451839_0274870 3300041496 Bacteria 1997
372 Ga0451853_0107761 3300041512 Bacteria 2530
373 Ga0451853_4096957 3300041512 Bacteria 1511
374 Ga0439450_062243 3300042008 Bacteria 904
375 Ga0439463_192582 3300042016 Bacteria 529
376 Ga0450915_003063 3300042119 Bacteria 919
377 Ga0439440_0045710 3300042993 Bacteria 1080
378 Ga0466965_0135997 3300044683 Bacteria 1277
379 Ga0466963_0035996 3300044694 Bacteria 3226
380 Ga0466964_0000742 3300044706 Bacteria 10605
381 Ga0466971_0010596 3300044719 Bacteria 4030
382 Ga0466968_0019921 3300044735 Bacteria 2704
383 Ga0466968_0100653 3300044735 Unclassified 1290
384 Ga0466957_0267326 3300044842 Bacteria 1141
385 Ga0466957_0498797 3300044842 Bacteria 844
386 Ga0466960_0048928 3300044901 Bacteria 2033
387 Ga0466958_0105211 3300045836 Bacteria 1758
388 Ga0466967_0019255 3300045976 Bacteria 5484
389 Ga0466967_0165571 3300045976 Bacteria 2077
390 Ga0466967_0544099 3300045976 Bacteria 1143
391 Ga0495603_0241879 3300046455 Bacteria 1039
392 Ga0495629_0108905 3300046459 Bacteria 1932
393 Ga0495641_0011229 3300046461 Bacteria 5122
394 Ga0495641_0037349 3300046461 Bacteria 2277
395 Ga0495641_0143503 3300046461 Bacteria 1067
396 Ga0495580_0413076 3300046472 Bacteria 909
397 Ga0495582_0012951 3300046473 Bacteria 4595
398 Ga0495582_0075126 3300046473 Unclassified 1871
399 Ga0495582_0310990 3300046473 Bacteria 906
400 Ga0495639_0011991 3300046475 Bacteria 3737
401 Ga0495662_0092520 3300046476 Bacteria 1475
402 Ga0495584_0135356 3300046491 Bacteria 1251
403 Ga0495584_0344446 3300046491 Bacteria 757
404 Ga0495620_0137442 3300046515 Bacteria 957
405 Ga0495630_0004364 3300046517 Bacteria 9934
406 Ga0495630_0349836 3300046517 Bacteria 1131
407 Ga0495644_0231416 3300046523 Bacteria 716
408 Ga0495642_0198710 3300046528 Unclassified 874
409 Ga0495665_0143153 3300046531 Unclassified 1249
410 Ga0495656_0042576 3300046615 Bacteria 1902
411 Ga0495659_0333204 3300046664 Bacteria 646
412 Ga0495661_0208281 3300046665 Bacteria 1020
413 Ga0495647_0016475 3300046681 Bacteria 2602
414 Ga0495647_0042339 3300046681 Unclassified 1738
415 Ga0495658_0018244 3300046683 Bacteria 3644
416 Ga0495613_0020750 3300046689 Bacteria 4898
417 Ga0495613_0148805 3300046689 Unclassified 1671
418 Ga0495624_0044382 3300046690 Unclassified 2833
419 Ga0495670_0371737 3300046691 Bacteria 771
420 Ga0495589_0455083 3300046794 Bacteria 586
421 Ga0495581_0000299 3300047315 Bacteria 24150
422 Ga0495581_0002252 3300047315 Bacteria 10855
423 Ga0495676_0025175 3300047321 Bacteria 5141
424 Ga0495676_0025503 3300047321 Bacteria 5103
425 Ga0496100_0015358 3300048903 Bacteria 4470
426 Ga0496101_0004296 3300048904 Bacteria 8942
427 Ga0496102_0008554 3300048905 Bacteria 8776
428 Ga0496102_0249980 3300048905 Unclassified 1672
429 Ga0496103_0001580 3300048906 Bacteria 15016
430 Ga0496104_0270332 3300048907 Unclassified 1612
431 Ga0496105_0110332 3300048908 Bacteria 2271
432 Ga0496105_0213567 3300048908 Bacteria 1572
433 Ga0496106_0010072 3300048909 Bacteria 6980
434 Ga0496107_0002448 3300048910 Bacteria 12036
435 Ga0496108_1151787 3300048911 Bacteria 657
436 Ga0496109_0029299 3300048912 Bacteria 4930
437 Ga0496109_0358678 3300048912 Unclassified 1377
438 Ga0496110_0148549 3300048913 Bacteria 2121
439 Ga0496111_0055158 3300048914 Bacteria 2874
440 Ga0496111_0123276 3300048914 Bacteria 1915
441 Ga0496112_0270198 3300048915 Unclassified 1649
442 Ga0496112_0343784 3300048915 Bacteria 1435
443 Ga0496112_0765065 3300048915 Bacteria 891
444 Ga0496113_0206674 3300048916 Bacteria 1562
445 Ga0496114_0020804 3300048917 Bacteria 5326
446 Ga0496115_0002150 3300048918 Bacteria 14090
447 Ga0501042_0825757 3300049578 Unclassified 675
448 Ga0501042_1000421 3300049578 Bacteria 609
449 Ga0501071_0202580 3300049587 Unclassified 1491
450 Ga0501072_0865650 3300049588 Bacteria 706
451 Ga0501080_0491061 3300049742 Unclassified 1098
452 Ga0501083_0374759 3300049744 Bacteria 926
453 nmdc:mga03683_45746_c1 3300050489 Unclassified 1812
454 nmdc:mga05p37_155622_c1 3300050507 Bacteria 2794
455 nmdc:mga05p37_261953_c1 3300050507 Bacteria 2069
456 nmdc:mga05p37_638547_c1 3300050507 Bacteria 1195
457 nmdc:mga05p37_76387_c1 3300050507 Bacteria 4124
458 nmdc:mga09592_102241_c1 3300050508 Unclassified 2455
459 nmdc:mga09592_325081_c1 3300050508 Bacteria 1332
460 nmdc:mga09592_47070_c1 3300050508 Bacteria 3634
461 nmdc:mga06r32_29721_c1 3300050510 Bacteria 5125
462 nmdc:mga06r32_636112_c1 3300050510 Bacteria 1036
463 nmdc:mga08y16_675635_c1 3300050511 Unclassified 1035
464 nmdc:mga08y16_70493_c1 3300050511 Bacteria 3644
465 nmdc:mga08y16_82464_c1 3300050511 Bacteria 3352
466 nmdc:mga08y16_89782_c1 3300050511 Bacteria 3202
467 nmdc:mga0a205_343288_c1 3300050515 Bacteria 1361
468 Ga0530510_0654955 3300061734 Bacteria 800
469 Ga0070707_100622698
470 JGI24747J21853_1021113
471 JGI24744J21845_10003251
472 Ga0070658_10150170
473 Ga0070683_100004848
474 Ga0070683_100010545
475 Ga0070683_100084138
476 Ga0070683_100350635
477 Ga0070690_100083438
478 Ga0070680_100012948
479 Ga0070680_100089864
480 Ga0070680_100123360
481 Ga0070680_100132177
482 Ga0070680_100242082
483 Ga0070680_100736253
484 Ga0070682_100128340
485 Ga0068868_100019562
486 Ga0068868_100656212
487 Ga0070660_100008069
488 Ga0070660_100140460
489 Ga0070660_100178797
490 Ga0070660_100224921
491 Ga0070689_100022832
492 Ga0070687_100122381
493 Ga0070661_100051707
494 Ga0070661_100077899
495 Ga0070661_100163915
496 Ga0070661_100225038
497 Ga0070692_10000930
498 Ga0070668_100017495
499 Ga0070669_100325709
500 Ga0070669_100690597
501 Ga0070675_100039634
502 Ga0070671_100011250
503 Ga0070674_100009384
504 Ga0070674_100313543
505 Ga0070688_100008083
506 Ga0070688_100160355
507 Ga0070659_100031878
508 Ga0070659_100049947
509 Ga0070659_100058103
510 Ga0070659_100267844
511 Ga0070659_100531656
512 Ga0070709_10090464
513 Ga0070714_100122074
514 Ga0070710_10021256
515 Ga0070701_10151347
516 Ga0070711_100003496
517 Ga0070705_100193470
518 Ga0070705_100487283
519 Ga0070700_100012749
520 Ga0070694_100028360
521 Ga0070694_101028362
522 Ga0070663_100121836
523 Ga0070663_100498649
524 Ga0070678_100000348
525 Ga0070681_10009067
526 Ga0070681_10037094
527 Ga0070681_10142897
528 Ga0068867_100000550
529 Ga0070685_10070558
530 Ga0070685_10105745
531 Ga0070706_100139998
532 Ga0070707_100136641
533 Ga0070679_100005474
534 Ga0070679_100088585
535 Ga0070679_100088735
536 Ga0070684_100002645
537 Ga0070684_100029427
538 Ga0070684_100051038
539 Ga0070684_100080438
540 Ga0070684_100209253
541 Ga0070684_100249132
542 Ga0068853_100013271
543 Ga0068853_100025861
544 Ga0068853_100250028
545 Ga0068853_100254416
546 Ga0070672_100127232
547 Ga0070686_100001971
548 Ga0070695_100020931
549 Ga0070696_100174181
550 Ga0070696_100432243
551 Ga0070693_100109189
552 Ga0070693_100132146
553 Ga0070704_100001647
554 Ga0068855_100157957
555 Ga0068855_100185139
556 Ga0068855_100219171
557 Ga0068855_100260292
558 Ga0068855_100310298
559 Ga0070664_100212383
560 Ga0068857_100001566
561 Ga0068857_100044765
562 Ga0068857_100118885
563 Ga0068857_100201467
564 Ga0068856_100032443
565 Ga0068856_100090019
566 Ga0068856_100151653
567 Ga0068856_100231593
568 Ga0068856_100284575
569 Ga0070702_100009050
570 Ga0068852_100003964
571 Ga0068852_100019274
572 Ga0068852_100187339
573 Ga0068852_100328766
574 Ga0068859_100277071
575 Ga0068864_100884970
576 Ga0068866_10004786
577 Ga0068858_100184024
578 Ga0081455_10004052
579 Ga0081455_10012594
580 Ga0081455_10060637
581 Ga0081538_10000820
582 Ga0081538_10134478
583 Ga0081540_1009278
584 Ga0081539_10005141
585 Ga0075365_10042028
586 Ga0075364_10046850
587 Ga0070715_10078369
588 Ga0070712_100025467
589 Ga0070712_100854694
590 Ga0075362_10028239
591 Ga0075366_10240443
592 Ga0097621_100011037
593 Ga0068871_100037920
594 Ga0075428_100288929
595 Ga0075428_100774355
596 Ga0075428_101473108
597 Ga0075430_100106035
598 Ga0075433_11065752
599 Ga0075434_100491475
600 Ga0075429_100146313
601 Ga0075429_100166127
602 Ga0075429_100371375
603 Ga0068865_100000227
604 Ga0097620_100277076
605 Ga0075435_100578968
606 Ga0105240_10092883
607 Ga0105240_10126827
608 Ga0105240_10166489
609 Ga0105240_10371347
610 Ga0111539_10072722
611 Ga0111539_10281728
612 Ga0111539_10298764
613 Ga0111539_11590652
614 Ga0105245_10023233
615 Ga0105247_10013699
616 Ga0114129_10173174
617 Ga0114129_10401449
618 Ga0114129_11285316
619 Ga0114129_11929900
620 Ga0105243_10010370
621 Ga0105243_10038925
622 Ga0105241_10366779
623 Ga0105241_10526031
624 Ga0105242_10001454
625 Ga0105248_10058439
626 Ga0105237_10010036
627 Ga0105237_10640631
628 Ga0105238_10052274
629 Ga0105238_10386169
630 Ga0105238_10967355
631 Ga0105249_10019177
632 Ga0105239_10001933
633 Ga0105239_10294090
634 Ga0105239_10945530
635 Ga0105246_10749658
636 Ga0157373_10027781
637 Ga0157370_10012659
638 Ga0157370_10041612
639 Ga0157370_10087625
640 Ga0157369_10063986
641 Ga0157369_10110074
642 Ga0157369_10189203
643 Ga0157374_10009866
644 Ga0157374_10069471
645 Ga0157378_10002034
646 Ga0163162_10002291
647 Ga0157372_10021925
648 Ga0157372_10037346
649 Ga0157372_10481752
650 Ga0157372_10679277
651 Ga0157375_10122700
652 Ga0157380_10012923
653 Ga0157377_10015403
654 Ga0157377_10212492
655 Ga0157376_10155122
656 Ga0157376_11108434
657 Ga0163161_10273581
658 Ga0197907_11375510
659 Ga0206356_10931012
660 Ga0206356_11813809
661 Ga0206354_10221291
662 Ga0206353_10206358
663 Ga0206353_11776641
664 Ga0207692_10056336
665 Ga0207642_10002393
666 Ga0207710_10358661
667 Ga0207688_10019580
668 Ga0207688_10172842
669 Ga0207685_10125749
670 Ga0207699_10017845
671 Ga0207705_10039283
672 Ga0207705_10080931
673 Ga0207654_10264326
674 Ga0207707_10016226
675 Ga0207707_10063650
676 Ga0207707_10266053
677 Ga0207695_10269358
678 Ga0207695_10331294
679 Ga0207695_10692479
680 Ga0207671_10030030
681 Ga0207671_10060186
682 Ga0207693_10003681
683 Ga0207663_10017905
684 Ga0207663_10971146
685 Ga0207660_10066049
686 Ga0207660_10128854
687 Ga0207660_10148373
688 Ga0207660_11116795
689 Ga0207662_10108225
690 Ga0207657_10012651
691 Ga0207657_10024376
692 Ga0207657_10036084
693 Ga0207649_10116714
694 Ga0207652_10018379
695 Ga0207652_10028339
696 Ga0207652_10028689
697 Ga0207652_10061304
698 Ga0207652_10140930
699 Ga0207652_10954699
700 Ga0207646_10087583
701 Ga0207681_10221570
702 Ga0207694_10037276
703 Ga0207694_10117288
704 Ga0207694_10866446
705 Ga0207659_10139463
706 Ga0207659_10370309
707 Ga0207687_10197195
708 Ga0207687_10368656
709 Ga0207644_10030893
710 Ga0207690_10054060
711 Ga0207690_10219144
712 Ga0207690_10507831
713 Ga0207690_10631038
714 Ga0207690_10761463
715 Ga0207706_10045694
716 Ga0207686_10002081
717 Ga0207709_10000390
718 Ga0207670_10112563
719 Ga0207669_10001870
720 Ga0207669_10457386
721 Ga0207704_10001726
722 Ga0207665_10047882
723 Ga0207691_10005205
724 Ga0207711_10023885
725 Ga0207689_10538623
726 Ga0207661_10046621
727 Ga0207661_10105323
728 Ga0207661_10144018
729 Ga0207661_10442018
730 Ga0207679_10144669
731 Ga0207679_10671515
732 Ga0207667_10101999
733 Ga0207667_10125721
734 Ga0207667_10616103
735 Ga0207712_10017518
736 Ga0207668_10433379
737 Ga0207640_10129940
738 Ga0207677_10229695
739 Ga0207703_10210804
740 Ga0207639_10014663
741 Ga0207639_10024567
742 Ga0207639_10720549
743 Ga0207678_10007853
744 Ga0207678_10046171
745 Ga0207678_10085355
746 Ga0207708_10000175
747 Ga0207702_10023361
748 Ga0207702_10235991
749 Ga0207702_10246198
750 Ga0207702_10350269
751 Ga0207702_10515850
752 Ga0207648_10000082
753 Ga0207674_10004721
754 Ga0207674_10015768
755 Ga0207674_10036583
756 Ga0207674_10177219
757 Ga0207674_10572002
758 Ga0207675_100035510
759 Ga0207683_10001734
760 Ga0207698_10002832
761 Ga0207698_10118946
762 Ga0207428_10079332
763 Ga0207428_10243164
764 Ga0268266_10896593
765 Ga0268265_10242334
766 Ga0307416_100742644
767 Ga0307415_100054338
768 Ga0307415_100859944
769 Ga0307415_101442103
770 Ga0373945_0006436
771 Ga0373945_0287596
772 Ga0373943_0032013
773 Ga0373943_0141930
774 Ga0373946_0010077
775 Ga0373935_0090381
776 Ga0373935_0505929
777 Ga0373927_0275177
778 Ga0373947_0005896
779 Ga0373925_0098365
780 Ga0373925_0230450
781 Ga0395899_0021817
782 Ga0395899_0033910
783 Ga0395899_0036391
784 Ga0395899_0039103
785 Ga0395899_0065223
786 Ga0395899_0072174
787 Ga0395899_0106778
788 Ga0395899_0160222
789 Ga0395899_0207582
790 Ga0395899_0260701
791 Ga0395899_0274082
792 Ga0395899_0463246
793 Ga0395900_0010463
794 Ga0395900_0025357
795 Ga0395900_0062446
796 Ga0395900_0067492
797 Ga0395900_0103993
798 Ga0395900_0106914
799 Ga0395900_0118965
800 Ga0395900_0134744
801 Ga0395900_0167781
802 Ga0395900_0228933
803 Ga0395900_0295539
804 Ga0395900_0969032
805 Ga0395898_0004891
806 Ga0395898_0013441
807 Ga0395898_0021812
808 Ga0395898_0064016
809 Ga0395898_0090562
810 Ga0395898_0133021
811 Ga0395898_0141404
812 Ga0395898_0298721
813 Ga0395898_0315063
814 Ga0395898_0499219
815 Ga0395905_0002227
816 Ga0395905_0017117
817 Ga0395905_0042772
818 Ga0395905_0047513
819 Ga0395905_0060884
820 Ga0395905_0136059
821 Ga0395905_0159821
822 Ga0395905_0266010
823 Ga0395905_0350436
824 Ga0395905_0595623
825 Ga0395905_1148384
826 Ga0395901_0010036
827 Ga0395901_0016760
828 Ga0395901_0027283
829 Ga0395901_0035743
830 Ga0395901_0048211
831 Ga0395901_0052723
832 Ga0395901_0053465
833 Ga0395901_0092851
834 Ga0395901_0100489
835 Ga0395901_0402339
836 Ga0395901_0416369
837 Ga0395901_0576258
838 Ga0395901_0873072
839 Ga0451839_0274870
840 Ga0451853_0107761
841 Ga0451853_4096957
842 Ga0439450_062243
843 Ga0439463_192582
844 Ga0450915_003063
845 Ga0439440_0045710
846 Ga0466965_0135997
847 Ga0466963_0035996
848 Ga0466964_0000742
849 Ga0466971_0010596
850 Ga0466968_0019921
851 Ga0466968_0100653
852 Ga0466957_0267326
853 Ga0466957_0498797
854 Ga0466960_0048928
855 Ga0466958_0105211
856 Ga0466967_0019255
857 Ga0466967_0165571
858 Ga0466967_0544099
859 Ga0495603_0241879
860 Ga0495629_0108905
861 Ga0495641_0011229
862 Ga0495641_0037349
863 Ga0495641_0143503
864 Ga0495580_0413076
865 Ga0495582_0012951
866 Ga0495582_0075126
867 Ga0495582_0310990
868 Ga0495639_0011991
869 Ga0495662_0092520
870 Ga0495584_0135356
871 Ga0495584_0344446
872 Ga0495620_0137442
873 Ga0495630_0004364
874 Ga0495630_0349836
875 Ga0495644_0231416
876 Ga0495642_0198710
877 Ga0495665_0143153
878 Ga0495656_0042576
879 Ga0495659_0333204
880 Ga0495661_0208281
881 Ga0495647_0016475
882 Ga0495647_0042339
883 Ga0495658_0018244
884 Ga0495613_0020750
885 Ga0495613_0148805
886 Ga0495624_0044382
887 Ga0495670_0371737
888 Ga0495589_0455083
889 Ga0495581_0000299
890 Ga0495581_0002252
891 Ga0495676_0025175
892 Ga0495676_0025503
893 Ga0496100_0015358
894 Ga0496101_0004296
895 Ga0496102_0008554
896 Ga0496102_0249980
897 Ga0496103_0001580
898 Ga0496104_0270332
899 Ga0496105_0110332
900 Ga0496105_0213567
901 Ga0496106_0010072
902 Ga0496107_0002448
903 Ga0496108_1151787
904 Ga0496109_0029299
905 Ga0496109_0358678
906 Ga0496110_0148549
907 Ga0496111_0055158
908 Ga0496111_0123276
909 Ga0496112_0270198
910 Ga0496112_0343784
911 Ga0496112_0765065
912 Ga0496113_0206674
913 Ga0496114_0020804
914 Ga0496115_0002150
915 Ga0501042_0825757
916 Ga0501042_1000421
917 Ga0501071_0202580
918 Ga0501072_0865650
919 Ga0501080_0491061
920 Ga0501083_0374759
921 nmdc:mga03683_45746_c1
922 nmdc:mga05p37_155622_c1
923 nmdc:mga05p37_261953_c1
924 nmdc:mga05p37_638547_c1
925 nmdc:mga05p37_76387_c1
926 nmdc:mga09592_102241_c1
927 nmdc:mga09592_325081_c1
928 nmdc:mga09592_47070_c1
929 nmdc:mga06r32_29721_c1
930 nmdc:mga06r32_636112_c1
931 nmdc:mga08y16_675635_c1
932 nmdc:mga08y16_70493_c1
933 nmdc:mga08y16_82464_c1
934 nmdc:mga08y16_89782_c1
935 nmdc:mga0a205_343288_c1
936 Ga0530510_0654955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

4

173

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.9221 2 186
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.9125 2 186
3nm1-assembly1.cif.gz_F the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.9082 2 183
1g4t-assembly1.cif.gz_A thiamin phosphate synthase 0.9044 2 185
3nm3-assembly1.cif.gz_D the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.9017 2 182
ID Description Score Start End Superfamily
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9221 2 186 3.20.20.70
af_A0A1D6MYJ2_339_548_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9207 2 183 3.20.20.70
af_P40386_1_220_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9158 2 182 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9125 2 186 3.20.20.70
af_Q5AEJ1_1_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9055 2 182 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q7UGY4-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9887 1 186 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A538F3U0-F1-model_v4 Thiamine phosphate synthase 0.9735 57 186 GO:0004789
GO:0005737
GO:0009228
GO:0046872
AF-A0A7Y5X1G4-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9731 1 185 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A5Q0USB9-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9593 2 185 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A662NPE4-F1-model_v4 Thiamine-phosphate synthase (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) 0.9545 2 163 GO:0004789
GO:0005737
GO:0009228
GO:0009229
GO:0046872

Map