F449887

General Info

Members Datasets Scaffolds Average Seq Length
467 415 178 462

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0009089|Ga0439465_0009089_200_1591
Length 463
Sequence MNEISCKLLIIGAGPGGYACAIRAGQLGIDTVIVEARAPGGTCLNVGCIPSKALIHAADEFETVARAAIGQSPLGISASKPVLDFSRTIAWKDGIVRRLNNGVSGLLKKAGAKVIAGWARFRDGKTVEIESEAVRTLVRAEAIVIATGSEAVALPSLPYGGPVISSTEALALTEVPRRLIVVGAGYIGLELGTAFAKLGAELTVVEAAPRILPQYDAALSEPVARRLGELGAKVLTGAKVKGAVGAALVIEAADGQSMTLPADRILVTVGRKPAVEGFGLDALDLDMDGAFIRIDDQCRTSMRGVYAIGDVSGEPMLAHRAIAQGEMVAEIVAGHRRGWDKVCIPSICFTDPEIVTAGLSPTAAAAQGLDVRTDQFPFRANGRALTLDREEGFIRVVARADNHLLLGVQGVGAGIAELSASFSLAIEMGARLEDIAAVIHAHPTQSEAFHEAALKSLGHPIHI

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
15 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
16 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
17 2534681786 Brucella suis 92/29 Isolate Unclassified
18 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
19 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
20 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
21 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
22 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
25 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
26 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
27 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
28 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
29 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
30 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
31 2643221736 Bosea sp. Root483D1 Isolate Unclassified
32 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
33 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
34 2738543024 Aminobacter sp. AP02 Isolate Unclassified
35 2751185800 Brucella pituitosa AA2 Isolate Unclassified
36 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
37 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
38 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
39 2773857925 Microvirga vignae BR3299 Isolate Unclassified
40 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
41 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
42 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
43 2791355199
44 2818991467 Bosea vestrisii 3192 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
55 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
56 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
57 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
58 2841760612 Bosea sp. Tri-49 Isolate Nodule
59 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
60 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
65 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
66 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
67 2844104063 Bosea sp. Tri-39 Isolate Nodule
68 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
69 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
70 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
71 2851246043 Bosea sp. Tri-54 Isolate Nodule
72 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
73 2854911287 Brucella lupini LUP21 Isolate Unclassified
74 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
75 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
76 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
77 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
78 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
79 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
80 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
81 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
82 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
83 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
84 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
85 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
86 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
87 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
88 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
89 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
90 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
91 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
92 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
93 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
94 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
95 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
96 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
97 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
98 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
99 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
100 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
101 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
102 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
103 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
104 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
105 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
106 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
107 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
108 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
109 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
110 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
111 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
112 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
113 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
114 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
115 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
116 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
117 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
118 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
119 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
120 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
121 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
122 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
123 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
124 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
125 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
126 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
127 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
128 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
129 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
130 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
131 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
132 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
133 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
134 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
135 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
136 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
137 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
138 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
139 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
140 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
141 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
142 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
143 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
144 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
145 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
146 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
147 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
148 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
149 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
150 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
151 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
152 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
153 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
154 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
155 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
156 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
157 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
158 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
159 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
160 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
161 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
162 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
163 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
164 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
165 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
166 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
167 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
168 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
169 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
170 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
171 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
172 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
173 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
174 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
175 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
176 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
177 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
178 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
179 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
180 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
181 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
182 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
183 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
184 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
185 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
186 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
187 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
188 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
189 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
190 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
191 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
192 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
193 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
194 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
195 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
196 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
197 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
198 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
199 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
200 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
201 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
202 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
203 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
204 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
205 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
206 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
207 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
208 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
209 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
210 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
211 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
212 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
213 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
214 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
215 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
216 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
217 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
218 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
219 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
220 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
221 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
222 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
223 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
224 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
225 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
226 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
227 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
228 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
229 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
230 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
231 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
232 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
233 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
234 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
235 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
236 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
237 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
238 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
239 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
240 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
241 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
242 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
243 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
244 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
245 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
246 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
247 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
248 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
249 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
250 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
251 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
252 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
253 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
254 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
255 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
256 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
257 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
258 3004167301 Mesorhizobium loti 582 Isolate Unclassified
259 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
260 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
261 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
262 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
263 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
264 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
265 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
266 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
267 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
268 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
269 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
270 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
271 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
272 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
273 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
274 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
275 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
276 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
277 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
278 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
279 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
280 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
281 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
282 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
283 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
284 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
285 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
286 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
287 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
288 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
289 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
290 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
291 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
292 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
293 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
294 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
295 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
296 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
297 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
298 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
299 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
300 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
301 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
302 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
303 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
304 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
305 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
306 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
307 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
308 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
309 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
310 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
311 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
313 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
314 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
315 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
317 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
319 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
320 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
321 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
324 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
333 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
334 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
335 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
336 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
337 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
339 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
340 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
341 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
342 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
343 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
344 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
345 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
346 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
347 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
348 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
349 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
350 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
353 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
354 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
365 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
366 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
398 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
399 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
400 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
401 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
402 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
403 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
404 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
405 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
406 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
407 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
408 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
409 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
410 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
411 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
412 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
413 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
414 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
415 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.2
Metatranscriptomes 0
Isolates 61.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.71
Nodule 47.75
Rhizoplane 1.28
Rhizosphere 24.63
Stem 0
Stem Tuber 0
Unclassified 15.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001344 3300002773 Bacteria 10804
2 JGI25159J45721_1000565 3300002987 Bacteria 16646
3 JGI25151J46595_10000303 3300003187 Bacteria 53941
4 JGI25165J46597_1000052 3300003214 Bacteria 236064
5 JGI25160J50197_1022669 3300003354 Bacteria 1834
6 JGI25161J50226_1000227 3300003374 Bacteria 34620
7 Ga0055542_1000284 3300003762 Bacteria 56677
8 Ga0055529_1006165 3300003763 Bacteria 1690
9 Ga0055526_1000652 3300003771 Bacteria 26801
10 Ga0055526_1001080 3300003771 Bacteria 19882
11 Ga0055524_1000301 3300003775 Bacteria 47463
12 Ga0055524_1004586 3300003775 Bacteria 6350
13 Ga0055536_1003770 3300003781 Bacteria 8001
14 Ga0055531_10005530 3300003794 Bacteria 7375
15 Ga0055543_1000093 3300004625 Bacteria 78294
16 Ga0065165_1000014 3300005262 Bacteria 292366
17 Ga0065165_1016674 3300005262 Bacteria 2740
18 Ga0070710_10007255 3300005437 Bacteria 5360
19 Ga0070711_100063416 3300005439 Bacteria 2579
20 Ga0070665_100215988 3300005548 Bacteria 1919
21 Ga0068855_100260533 3300005563 Bacteria 1932
22 Ga0081540_1013586 3300005983 Bacteria 5282
23 Ga0081539_10000429 3300005985 Bacteria 89452
24 Ga0075365_10025667 3300006038 Bacteria 3732
25 Ga0075365_10067344 3300006038 Bacteria 2404
26 Ga0075363_100021266 3300006048 Bacteria 3264
27 Ga0075432_10011357 3300006058 Bacteria 3025
28 Ga0070716_100034284 3300006173 Bacteria 2782
29 Ga0075369_10068941 3300006186 Bacteria 1555
30 Ga0075427_10001540 3300006194 Bacteria 2976
31 Ga0075431_100006794 3300006847 Bacteria 11364
32 Ga0075431_100025820 3300006847 Bacteria 6021
33 Ga0075434_100014619 3300006871 Bacteria 7507
34 Ga0075429_100158719 3300006880 Bacteria 1980
35 Ga0075435_100010284 3300007076 Bacteria 6837
36 Ga0105240_10026676 3300009093 Bacteria 7579
37 Ga0114129_10043003 3300009147 Bacteria 6359
38 Ga0114129_10138516 3300009147 Bacteria 3338
39 Ga0105238_10009341 3300009551 Bacteria 9820
40 Ga0105239_10246035 3300010375 Bacteria 2008
41 Ga0157370_10261604 3300013104 Bacteria 1599
42 Ga0171462_1007 3300013250 Bacteria 417698
43 Ga0163163_10049647 3300014325 Bacteria 4129
44 Ga0163163_10050813 3300014325 Bacteria 4084
45 Ga0157376_10108104 3300014969 Bacteria 2443
46 Ga0209436_100021 3300025208 Bacteria 102115
47 Ga0209026_1000141 3300025250 Bacteria 114545
48 Ga0209148_1000111 3300025254 Bacteria 198095
49 Ga0209759_1001567 3300025256 Bacteria 12468
50 Ga0209129_1005261 3300025258 Bacteria 4665
51 Ga0209233_1000118 3300025261 Bacteria 236172
52 Ga0209233_1004414 3300025261 Bacteria 4788
53 Ga0209233_1018948 3300025261 Bacteria 1839
54 Ga0209455_1000206 3300025272 Bacteria 84430
55 Ga0209130_1000001 3300025284 Bacteria 831557
56 Ga0209130_1000024 3300025284 Bacteria 354212
57 Ga0209675_1000455 3300025291 Bacteria 31451
58 Ga0209025_1000010 3300025294 Bacteria 986612
59 Ga0209025_1004168 3300025294 Bacteria 12801
60 Ga0209564_1000048 3300025295 Bacteria 364806
61 Ga0209564_1000074 3300025295 Bacteria 286043
62 Ga0209564_1002565 3300025295 Bacteria 13969
63 Ga0209758_1000058 3300025297 Bacteria 331603
64 Ga0209758_1003775 3300025297 Bacteria 13366
65 Ga0209758_1013862 3300025297 Bacteria 4347
66 Ga0209050_1024703 3300025298 Bacteria 2068
67 Ga0209256_1000041 3300025299 Bacteria 364827
68 Ga0209256_1013368 3300025299 Bacteria 3048
69 Ga0207426_1000005 3300025302 Bacteria 1037188
70 Ga0209051_1002794 3300025303 Bacteria 12041
71 Ga0209257_1004881 3300025304 Bacteria 9906
72 Ga0207692_10017401 3300025898 Bacteria 3205
73 Ga0207693_10003577 3300025915 Bacteria 13282
74 Ga0207663_10035382 3300025916 Bacteria 2995
75 Ga0207667_10262779 3300025949 Bacteria 1765
76 Ga0207639_10092621 3300026041 Bacteria 2422
77 Ga0207702_10091515 3300026078 Bacteria 2663
78 Ga0209389_1000133 3300027296 Bacteria 65939
79 Ga0209389_1006188 3300027296 Bacteria 10358
80 Ga0209589_1013845 3300027357 Bacteria 10358
81 Ga0209489_110509 3300027361 Bacteria 10358
82 Ga0209489_115928 3300027361 Bacteria 4308
83 Ga0209700_100005 3300027363 Bacteria 573969
84 Ga0207428_10004370 3300027907 Bacteria 13483
85 Ga0268266_10055586 3300028379 Bacteria 3403
86 Ga0307406_10041288 3300031901 Bacteria 2874
87 Ga0307412_10109093 3300031911 Bacteria 1973
88 Ga0373933_0025472 3300035724 Bacteria 3393
89 Ga0373937_0018118 3300036401 Bacteria 6282
90 Ga0373937_0037860 3300036401 Bacteria 4396
91 Ga0373925_0074610 3300037068 Bacteria 2569
92 Ga0373925_0091494 3300037068 Bacteria 2326
93 Ga0395899_0000114 3300037312 Bacteria 134621
94 Ga0395900_0000154 3300037418 Bacteria 113757
95 Ga0395900_0067559 3300037418 Bacteria 3673
96 Ga0395900_0122112 3300037418 Bacteria 2672
97 Ga0395900_0237219 3300037418 Bacteria 1831
98 Ga0395900_0311644 3300037418 Bacteria 1557
99 Ga0395898_0000308 3300037466 Bacteria 113757
100 Ga0395898_0020537 3300037466 Bacteria 6708
101 Ga0395905_0000153 3300037471 Bacteria 113757
102 Ga0395905_0058201 3300037471 Bacteria 3614
103 Ga0395905_0074713 3300037471 Bacteria 3177
104 Ga0395905_0083850 3300037471 Bacteria 2986
105 Ga0395905_0171614 3300037471 Bacteria 2037
106 Ga0395901_0000107 3300038443 Bacteria 113757
107 Ga0395901_0055007 3300038443 Bacteria 4138
108 Ga0395901_0209602 3300038443 Bacteria 2040
109 Ga0439465_0009089 3300041413 Bacteria 3132
110 Ga0466972_0019606 3300044658 Bacteria 3381
111 Ga0466960_0071327 3300044901 Bacteria 1730
112 Ga0466960_0109120 3300044901 Bacteria 1435
113 Ga0495638_0016018 3300046460 Bacteria 5024
114 Ga0495664_0037408 3300046477 Bacteria 2864
115 Ga0495608_0013532 3300046511 Bacteria 5659
116 Ga0495618_0056239 3300046514 Bacteria 2491
117 Ga0495628_0033076 3300046516 Bacteria 4170
118 Ga0495630_0258334 3300046517 Bacteria 1331
119 Ga0495643_0053994 3300046522 Bacteria 2153
120 Ga0495587_0017870 3300046536 Bacteria 4399
121 Ga0495645_0001029 3300046543 Bacteria 18986
122 Ga0495667_0025459 3300046559 Bacteria 3987
123 Ga0495635_0109498 3300046663 Bacteria 1887
124 Ga0495599_0016044 3300046678 Bacteria 4648
125 Ga0495600_0016468 3300046809 Bacteria 4692
126 Ga0495604_0024761 3300047317 Bacteria 4788
127 Ga0495674_0235549 3300047319 Bacteria 1510
128 Ga0495675_0094965 3300047444 Bacteria 1869
129 Ga0495684_0150471 3300047471 Bacteria 1740
130 Ga0495602_0000790 3300048088 Bacteria 30230
131 Ga0495602_0172070 3300048088 Bacteria 1680
132 Ga0496112_0119718 3300048915 Bacteria 2603
133 Ga0496112_0282237 3300048915 Bacteria 1608
134 Ga0496115_0110821 3300048918 Bacteria 2255
135 Ga0496120_0020389 3300048923 Bacteria 4214
136 Ga0496121_0146789 3300048924 Bacteria 1742
137 Ga0496122_0000042 3300048925 Bacteria 280482
138 Ga0496122_0005598 3300048925 Bacteria 14868
139 Ga0496122_0008213 3300048925 Bacteria 11340
140 Ga0496122_0033280 3300048925 Bacteria 4243
141 Ga0496123_0000030 3300048926 Bacteria 291764
142 Ga0496123_0002829 3300048926 Bacteria 20519
143 Ga0496123_0026300 3300048926 Bacteria 4362
144 Ga0496123_0032096 3300048926 Bacteria 3809
145 Ga0496125_0008338 3300048928 Bacteria 10872
146 Ga0501032_0046626 3300049569 Bacteria 2928
147 Ga0501034_0052236 3300049571 Bacteria 4118
148 Ga0501034_0096598 3300049571 Bacteria 2950
149 Ga0501034_0097939 3300049571 Bacteria 2928
150 Ga0501036_0067741 3300049572 Bacteria 3020
151 Ga0501036_0070735 3300049572 Bacteria 2950
152 Ga0501037_0023998 3300049573 Bacteria 4509
153 Ga0501037_0054413 3300049573 Bacteria 2926
154 Ga0501038_0072094 3300049574 Bacteria 2927
155 Ga0501043_0026654 3300049579 Bacteria 4534
156 Ga0501043_0035844 3300049579 Bacteria 3904
157 Ga0501043_0063061 3300049579 Bacteria 2910
158 Ga0501046_0041558 3300049580 Bacteria 3668
159 Ga0501047_0090983 3300049581 Bacteria 2928
160 Ga0501047_0133341 3300049581 Bacteria 2364
161 Ga0501070_0056246 3300049586 Bacteria 3261
162 Ga0501073_0007755 3300049589 Bacteria 7971
163 Ga0501035_0048270 3300049822 Bacteria 3818
164 Ga0501044_0055494 3300049823 Bacteria 4069
165 Ga0501044_0098085 3300049823 Bacteria 2950
166 Ga0501044_0099366 3300049823 Bacteria 2928
167 nmdc:mga03n38_15215_c1 3300050490 Bacteria 2966
168 nmdc:mga0yw44_12728_c1 3300050492 Bacteria 4396
169 nmdc:mga0yw44_64337_c1 3300050492 Bacteria 2257
170 nmdc:mga09592_24447_c1 3300050508 Bacteria 4997
171 nmdc:mga06r32_127526_c1 3300050510 Bacteria 2514
172 nmdc:mga06r32_3229_c1 3300050510 Bacteria 14583
173 nmdc:mga08y16_35503_c1 3300050511 Bacteria 5236
174 nmdc:mga0n895_62303_c1 3300050512 Bacteria 3686
175 nmdc:mga0a205_5649_c1 3300050515 Bacteria 11267
176 Ga0495601_0010434 3300053077 Bacteria 5528
177 Ga0500568_0000202 3300053139 Bacteria 52432
178 Ga0500622_0032988 3300053156 Bacteria 2715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0258334 Ga0495630_0258334_130_1263 377
2 3300048915 Ga0496112_0282237 Ga0496112_0282237_338_1570 403
3 3300037068 Ga0373925_0074610 Ga0373925_0074610_15_1319 434
4 iso_pu_bacteria 2924710171 2924716050 439
5 3300025916 Ga0207663_10035382 Ga0207663_100353822 456
6 iso_pu_bacteria 2791355199 2793077689 459
7 iso_pu_bacteria 2512875016 2512933688 460
8 iso_pu_bacteria 2512875024 2512961839 460
9 iso_pu_bacteria 2513237164 2514035479 460
10 iso_pu_bacteria 2534681786 2535486492 460
11 iso_pu_bacteria 2588253730 2588519768 460
12 iso_pu_bacteria 2751185800 2753358246 460
13 iso_pu_bacteria 2824704595 2824706777 460
14 iso_pu_bacteria 2824753945 2824755175 460
15 iso_pu_bacteria 2824763712 2824764315 460
16 iso_pu_bacteria 2854911287 2854916656 460
17 iso_pu_bacteria 2856320880 2856325308 460
18 iso_pu_bacteria 2856342000 2856348133 460
19 iso_pu_bacteria 2869278585 2869283143 460
20 iso_pu_bacteria 2876363079 2876364057 460
21 iso_pu_bacteria 2878738818 2878739720 460
22 iso_pu_bacteria 2885312484 2885313933 460
23 iso_pu_bacteria 2903448605 2903453843 460
24 iso_pu_bacteria 2903521522 2903525783 460
25 iso_pu_bacteria 2903528002 2903532670 460
26 iso_pu_bacteria 2904711408 2904712750 460
27 iso_pu_bacteria 2915650412 2915652472 460
28 iso_pu_bacteria 2924776078 2924777249 460
29 iso_pu_bacteria 2958034702 2958035295 460
30 iso_pu_bacteria 2958041894 2958052494 460
31 iso_pu_bacteria 2963644680 2963645515 460
32 iso_pu_bacteria 2968083720 2968085153 460
33 iso_pu_bacteria 2970593180 2970597763 460
34 iso_pu_bacteria 2977922695 2977924708 460
35 iso_pu_bacteria 3004211236 3004218499 460
36 iso_pu_bacteria 3004218560 3004223655 460
37 iso_pu_bacteria 3004334049 3004337032 460
38 iso_pu_bacteria 637000159 637076801 460
39 iso_pu_bacteria 2508501050 2508733973 461
40 iso_pu_bacteria 2508501127 2509143094 461
41 iso_pu_bacteria 2509276018 2509371513 461
42 iso_pu_bacteria 2509276022 2509393791 461
43 iso_pu_bacteria 2510065059 2510318456 461
44 iso_pu_bacteria 2511231027 2511390515 461
45 iso_pu_bacteria 2513237092 2513628481 461
46 iso_pu_bacteria 2513237104 2513720524 461
47 iso_pu_bacteria 2513237146 2513928699 461
48 iso_pu_bacteria 2513237161 2514015765 461
49 iso_pu_bacteria 2513237305 2514421922 461
50 iso_pu_bacteria 2513237351 2514589316 461
51 iso_pu_bacteria 2585427633 2585996920 461
52 iso_pu_bacteria 2585427634 2586001509 461
53 iso_pu_bacteria 2599185170 2599415094 461
54 iso_pu_bacteria 2599185301 2599938826 461
55 iso_pu_bacteria 2643221550 2643771713 461
56 iso_pu_bacteria 2643221551 2643777421 461
57 iso_pu_bacteria 2643221555 2643795869 461
58 iso_pu_bacteria 2643221564 2643838017 461
59 iso_pu_bacteria 2643221595 2643985972 461
60 iso_pu_bacteria 2643221623 2644130877 461
61 iso_pu_bacteria 2643221627 2644154459 461
62 iso_pu_bacteria 2643221736 2644742881 461
63 iso_pu_bacteria 2687453392 2688596194 461
64 iso_pu_bacteria 2721755686 2723573328 461
65 iso_pu_bacteria 2738543024 2739309866 461
66 iso_pu_bacteria 2756170246 2756673588 461
67 iso_pu_bacteria 2765235802 2765466076 461
68 iso_pu_bacteria 2767802442 2770198294 461
69 iso_pu_bacteria 2773857925 2774871364 461
70 iso_pu_bacteria 2775506901 2776258135 461
71 iso_pu_bacteria 2775506902 2776271235 461
72 iso_pu_bacteria 2775506904 2776280767 461
73 iso_pu_bacteria 2818991467 2819720365 461
74 iso_pu_bacteria 2824671348 2824676447 461
75 iso_pu_bacteria 2824679649 2824681618 461
76 iso_pu_bacteria 2838035591 2838039183 461
77 iso_pu_bacteria 2838122688 2838123240 461
78 iso_pu_bacteria 2838661181 2838667723 461
79 iso_pu_bacteria 2839993093 2839995258 461
80 iso_pu_bacteria 2840764183 2840770016 461
81 iso_pu_bacteria 2841734538 2841736585 461
82 iso_pu_bacteria 2841760612 2841765312 461
83 iso_pu_bacteria 2841966195 2841969614 461
84 iso_pu_bacteria 2841974524 2841978948 461
85 iso_pu_bacteria 2841983080 2841983935 461
86 iso_pu_bacteria 2842871566 2842872868 461
87 iso_pu_bacteria 2844002411 2844003242 461
88 iso_pu_bacteria 2844009547 2844010998 461
89 iso_pu_bacteria 2844104063 2844106922 461
90 iso_pu_bacteria 2847670302 2847673612 461
91 iso_pu_bacteria 2847686936 2847690125 461
92 iso_pu_bacteria 2851246043 2851248962 461
93 iso_pu_bacteria 2854896431 2854900414 461
94 iso_pu_bacteria 2854916844 2854917533 461
95 iso_pu_bacteria 2856314179 2856318919 461
96 iso_pu_bacteria 2856328259 2856329476 461
97 iso_pu_bacteria 2856334872 2856339763 461
98 iso_pu_bacteria 2856364286 2856367351 461
99 iso_pu_bacteria 2857349434 2857353136 461
100 iso_pu_bacteria 2857367948 2857374283 461
101 iso_pu_bacteria 2869162929 2869169308 461
102 iso_pu_bacteria 2869234852 2869239257 461
103 iso_pu_bacteria 2869242130 2869248333 461
104 iso_pu_bacteria 2869249662 2869250964 461
105 iso_pu_bacteria 2869256925 2869263585 461
106 iso_pu_bacteria 2869264136 2869265769 461
107 iso_pu_bacteria 2869271264 2869275288 461
108 iso_pu_bacteria 2869285874 2869288492 461
109 iso_pu_bacteria 2871429161 2871431159 461
110 iso_pu_bacteria 2871435913 2871435941 461
111 iso_pu_bacteria 2871451962 2871453813 461
112 iso_pu_bacteria 2871459585 2871460818 461
113 iso_pu_bacteria 2871466892 2871473504 461
114 iso_pu_bacteria 2871474448 2871478571 461
115 iso_pu_bacteria 2871481445 2871483056 461
116 iso_pu_bacteria 2871495908 2871498852 461
117 iso_pu_bacteria 2874102143 2874107043 461
118 iso_pu_bacteria 2874109183 2874115315 461
119 iso_pu_bacteria 2874116593 2874122691 461
120 iso_pu_bacteria 2874123672 2874126328 461
121 iso_pu_bacteria 2874131515 2874132350 461
122 iso_pu_bacteria 2874139085 2874142727 461
123 iso_pu_bacteria 2874146452 2874150533 461
124 iso_pu_bacteria 2874155637 2874158274 461
125 iso_pu_bacteria 2874162495 2874163708 461
126 iso_pu_bacteria 2874612657 2874617446 461
127 iso_pu_bacteria 2876386047 2876386849 461
128 iso_pu_bacteria 2876399893 2876401079 461
129 iso_pu_bacteria 2876413966 2876416582 461
130 iso_pu_bacteria 2876420981 2876422946 461
131 iso_pu_bacteria 2878035449 2878039263 461
132 iso_pu_bacteria 2878730984 2878732644 461
133 iso_pu_bacteria 2878745973 2878747763 461
134 iso_pu_bacteria 2878760144 2878763070 461
135 iso_pu_bacteria 2878767105 2878770040 461
136 iso_pu_bacteria 2878774303 2878779247 461
137 iso_pu_bacteria 2881147464 2881148409 461
138 iso_pu_bacteria 2881665667 2881666201 461
139 iso_pu_bacteria 2881861095 2881862052 461
140 iso_pu_bacteria 2882456835 2882460292 461
141 iso_pu_bacteria 2882632389 2882635203 461
142 iso_pu_bacteria 2888337043 2888343579 461
143 iso_pu_bacteria 2888343758 2888344558 461
144 iso_pu_bacteria 2888350351 2888353410 461
145 iso_pu_bacteria 2889010040 2889015123 461
146 iso_pu_bacteria 2889016732 2889019796 461
147 iso_pu_bacteria 2894232714 2894233523 461
148 iso_pu_bacteria 2894652903 2894654574 461
149 iso_pu_bacteria 2903492973 2903502244 461
150 iso_pu_bacteria 2903540706 2903543654 461
151 iso_pu_bacteria 2904578770 2904583350 461
152 iso_pu_bacteria 2906308376 2906310936 461
153 iso_pu_bacteria 2906321335 2906323047 461
154 iso_pu_bacteria 2906328253 2906334016 461
155 iso_pu_bacteria 2906363423 2906367834 461
156 iso_pu_bacteria 2906370794 2906373651 461
157 iso_pu_bacteria 2906386501 2906392152 461
158 iso_pu_bacteria 2906393657 2906395770 461
159 iso_pu_bacteria 2906401398 2906407443 461
160 iso_pu_bacteria 2906408224 2906408954 461
161 iso_pu_bacteria 2906414383 2906418990 461
162 iso_pu_bacteria 2906643746 2906647024 461
163 iso_pu_bacteria 2917699015 2917702281 461
164 iso_pu_bacteria 2919119836 2919121030 461
165 iso_pu_bacteria 2919171160 2919173216 461
166 iso_pu_bacteria 2922130491 2922136490 461
167 iso_pu_bacteria 2922151315 2922153539 461
168 iso_pu_bacteria 2922158528 2922158593 461
169 iso_pu_bacteria 2922172374 2922173226 461
170 iso_pu_bacteria 2922178524 2922183402 461
171 iso_pu_bacteria 2922185730 2922193157 461
172 iso_pu_bacteria 2922393267 2922400139 461
173 iso_pu_bacteria 2924726620 2924728171 461
174 iso_pu_bacteria 2924733363 2924740859 461
175 iso_pu_bacteria 2924741084 2924746904 461
176 iso_pu_bacteria 2924748358 2924754040 461
177 iso_pu_bacteria 2924754689 2924762090 461
178 iso_pu_bacteria 2924784321 2924790999 461
179 iso_pu_bacteria 2928521798 2928524327 461
180 iso_pu_bacteria 2933016740 2933023565 461
181 iso_pu_bacteria 2937813078 2937815547 461
182 iso_pu_bacteria 2937843397 2937848451 461
183 iso_pu_bacteria 2937848649 2937849934 461
184 iso_pu_bacteria 2937861824 2937863313 461
185 iso_pu_bacteria 2937868953 2937877268 461
186 iso_pu_bacteria 2937877337 2937880405 461
187 iso_pu_bacteria 2937891427 2937896372 461
188 iso_pu_bacteria 2937972304 2937976880 461
189 iso_pu_bacteria 2937994558 2937997500 461
190 iso_pu_bacteria 2954011201 2954015397 461
191 iso_pu_bacteria 2958041894 2958048366 461
192 iso_pu_bacteria 2958064165 2958070957 461
193 iso_pu_bacteria 2958084443 2958087540 461
194 iso_pu_bacteria 2958100919 2958104411 461
195 iso_pu_bacteria 2958108152 2958112997 461
196 iso_pu_bacteria 2958115193 2958120296 461
197 iso_pu_bacteria 2958122699 2958126793 461
198 iso_pu_bacteria 2958130278 2958132894 461
199 iso_pu_bacteria 2958137437 2958139063 461
200 iso_pu_bacteria 2958144490 2958145472 461
201 iso_pu_bacteria 2958165035 2958167974 461
202 iso_pu_bacteria 2958179912 2958182596 461
203 iso_pu_bacteria 2961077736 2961080444 461
204 iso_pu_bacteria 2961136820 2961138211 461
205 iso_pu_bacteria 2961163497 2961166442 461
206 iso_pu_bacteria 2961183825 2961189264 461
207 iso_pu_bacteria 2965018300 2965021261 461
208 iso_pu_bacteria 2965025482 2965026770 461
209 iso_pu_bacteria 2965040258 2965047376 461
210 iso_pu_bacteria 2965047637 2965052635 461
211 iso_pu_bacteria 2965062239 2965064338 461
212 iso_pu_bacteria 2965089291 2965096240 461
213 iso_pu_bacteria 2965102966 2965110938 461
214 iso_pu_bacteria 2965110997 2965115181 461
215 iso_pu_bacteria 2965119406 2965123600 461
216 iso_pu_bacteria 2968016561 2968017427 461
217 iso_pu_bacteria 2968091066 2968093407 461
218 iso_pu_bacteria 2968097103 2968098163 461
219 iso_pu_bacteria 2968117919 2968122459 461
220 iso_pu_bacteria 2968128360 2968129531 461
221 iso_pu_bacteria 2968171901 2968174843 461
222 iso_pu_bacteria 2970469710 2970472473 461
223 iso_pu_bacteria 2970489779 2970493606 461
224 iso_pu_bacteria 2970510686 2970512045 461
225 iso_pu_bacteria 2970524798 2970526279 461
226 iso_pu_bacteria 2970532167 2970534978 461
227 iso_pu_bacteria 2970547951 2970550865 461
228 iso_pu_bacteria 2970554993 2970557925 461
229 iso_pu_bacteria 2970627176 2970633512 461
230 iso_pu_bacteria 2977843712 2977846688 461
231 iso_pu_bacteria 2977851361 2977851513 461
232 iso_pu_bacteria 2977858184 2977858928 461
233 iso_pu_bacteria 2977864932 2977865700 461
234 iso_pu_bacteria 2977872689 2977875823 461
235 iso_pu_bacteria 2977898635 2977903484 461
236 iso_pu_bacteria 2977915119 2977917842 461
237 iso_pu_bacteria 2977935797 2977937993 461
238 iso_pu_bacteria 2977942078 2977945400 461
239 iso_pu_bacteria 2977950692 2977955384 461
240 iso_pu_bacteria 2977957713 2977959593 461
241 iso_pu_bacteria 2977986579 2977988942 461
242 iso_pu_bacteria 2979742915 2979751482 461
243 iso_pu_bacteria 2979779861 2979785282 461
244 iso_pu_bacteria 2987636660 2987641728 461
245 iso_pu_bacteria 2987645492 2987645938 461
246 iso_pu_bacteria 2987652177 2987657633 461
247 iso_pu_bacteria 2987659509 2987662450 461
248 iso_pu_bacteria 2987673487 2987675544 461
249 iso_pu_bacteria 2996310559 2996314168 461
250 iso_pu_bacteria 2996336353 2996338928 461
251 iso_pu_bacteria 2996341866 2996344896 461
252 iso_pu_bacteria 2996348954 2996352225 461
253 iso_pu_bacteria 2996386984 2996389063 461
254 iso_pu_bacteria 3000135777 3000137633 461
255 iso_pu_bacteria 3002141150 3002144019 461
256 iso_pu_bacteria 3004167301 3004173513 461
257 iso_pu_bacteria 3004188549 3004191501 461
258 iso_pu_bacteria 3004195979 3004196692 461
259 iso_pu_bacteria 3004203850 3004209460 461
260 iso_pu_bacteria 3004232784 3004234229 461
261 iso_pu_bacteria 3004239961 3004242605 461
262 iso_pu_bacteria 3004248173 3004253618 461
263 iso_pu_bacteria 3004268573 3004274328 461
264 iso_pu_bacteria 3004275668 3004278900 461
265 iso_pu_bacteria 3004289098 3004290426 461
266 iso_pu_bacteria 649633066 649870753 461
267 iso_pu_bacteria 8002285264 8002290240 461
268 iso_pu_bacteria 8004300914 8004303062 461
269 iso_pu_bacteria 8004361976 8004362232 461
270 iso_pu_bacteria 8004387939 8004390461 461
271 iso_pu_bacteria 8004395343 8004402111 461
272 iso_pu_bacteria 8004445564 8004452089 461
273 iso_pu_bacteria 8004640170 8004641900 461
274 iso_pu_bacteria 8004695233 8004700615 461
275 iso_pu_bacteria 8004703790 8004706549 461
276 iso_pu_bacteria 8004714634 8004717153 461
277 iso_pu_bacteria 8004727605 8004731582 461
278 iso_pu_bacteria 8045864390 8045868616 461
279 iso_pu_bacteria 8055617313 8055618136 461
280 iso_pu_bacteria 8057529695 8057532512 461
281 3300007076 Ga0075435_100010284 Ga0075435_1000102843 462
282 iso_pu_bacteria 2617270735 2617346156 462
283 iso_pu_bacteria 2824687955 2824692852 462
284 iso_pu_bacteria 2824773399 2824774436 462
285 iso_pu_bacteria 2841941048 2841946515 462
286 iso_pu_bacteria 2841949485 2841954242 462
287 iso_pu_bacteria 2878788777 2878792544 462
288 iso_pu_bacteria 2937836603 2937838833 462
289 iso_pu_bacteria 2958071322 2958072363 462
290 iso_pu_bacteria 8004633249 8004634727 462
291 3300041413 Ga0439465_0009089 Ga0439465_0009089_200_1591 463
292 3300003762 Ga0055542_1000284 Ga0055542_100028429 464
293 3300003763 Ga0055529_1006165 Ga0055529_10061651 464
294 3300006038 Ga0075365_10025667 Ga0075365_100256673 464
295 3300006048 Ga0075363_100021266 Ga0075363_1000212661 464
296 3300006186 Ga0075369_10068941 Ga0075369_100689411 464
297 3300013104 Ga0157370_10261604 Ga0157370_102616042 464
298 3300025254 Ga0209148_1000111 Ga0209148_100011179 464
299 3300025272 Ga0209455_1000206 Ga0209455_100020678 464
300 3300025949 Ga0207667_10262779 Ga0207667_102627792 464
301 3300026078 Ga0207702_10091515 Ga0207702_100915152 464
302 3300037312 Ga0395899_0000114 Ga0395899_0000114_76527_77921 464
303 3300037418 Ga0395900_0000154 Ga0395900_0000154_55663_57057 464
304 3300037466 Ga0395898_0000308 Ga0395898_0000308_56701_58095 464
305 3300037471 Ga0395905_0000153 Ga0395905_0000153_55663_57057 464
306 3300038443 Ga0395901_0000107 Ga0395901_0000107_56701_58095 464
307 3300048915 Ga0496112_0119718 Ga0496112_0119718_179_1573 464
308 3300048925 Ga0496122_0008213 Ga0496122_0008213_3220_4614 464
309 3300048926 Ga0496123_0002829 Ga0496123_0002829_217_1611 464
310 3300048928 Ga0496125_0008338 Ga0496125_0008338_7057_8451 464
311 3300049569 Ga0501032_0046626 Ga0501032_0046626_1280_2674 464
312 3300049571 Ga0501034_0097939 Ga0501034_0097939_1280_2674 464
313 3300049572 Ga0501036_0067741 Ga0501036_0067741_1372_2766 464
314 3300049579 Ga0501043_0063061 Ga0501043_0063061_1280_2674 464
315 3300049581 Ga0501047_0090983 Ga0501047_0090983_1280_2674 464
316 3300049823 Ga0501044_0099366 Ga0501044_0099366_1280_2674 464
317 3300002773 JGI25152J39213_1001344 JGI25152J39213_10013448 465
318 3300002987 JGI25159J45721_1000565 JGI25159J45721_10005657 465
319 3300003187 JGI25151J46595_10000303 JGI25151J46595_1000030337 465
320 3300003214 JGI25165J46597_1000052 JGI25165J46597_100005283 465
321 3300003354 JGI25160J50197_1022669 JGI25160J50197_10226692 465
322 3300003374 JGI25161J50226_1000227 JGI25161J50226_100022725 465
323 3300003771 Ga0055526_1000652 Ga0055526_100065218 465
324 3300003771 Ga0055526_1001080 Ga0055526_100108020 465
325 3300003775 Ga0055524_1000301 Ga0055524_100030135 465
326 3300003775 Ga0055524_1004586 Ga0055524_10045862 465
327 3300003781 Ga0055536_1003770 Ga0055536_10037703 465
328 3300003794 Ga0055531_10005530 Ga0055531_100055304 465
329 3300004625 Ga0055543_1000093 Ga0055543_100009364 465
330 3300005262 Ga0065165_1000014 Ga0065165_1000014142 465
331 3300005262 Ga0065165_1016674 Ga0065165_10166742 465
332 3300005437 Ga0070710_10007255 Ga0070710_100072553 465
333 3300005439 Ga0070711_100063416 Ga0070711_1000634163 465
334 3300005548 Ga0070665_100215988 Ga0070665_1002159882 465
335 3300005563 Ga0068855_100260533 Ga0068855_1002605332 465
336 3300005983 Ga0081540_1013586 Ga0081540_10135865 465
337 3300005985 Ga0081539_10000429 Ga0081539_100004295 465
338 3300006038 Ga0075365_10067344 Ga0075365_100673442 465
339 3300006058 Ga0075432_10011357 Ga0075432_100113572 465
340 3300006173 Ga0070716_100034284 Ga0070716_1000342842 465
341 3300006194 Ga0075427_10001540 Ga0075427_100015402 465
342 3300006847 Ga0075431_100006794 Ga0075431_1000067945 465
343 3300006847 Ga0075431_100025820 Ga0075431_1000258201 465
344 3300006871 Ga0075434_100014619 Ga0075434_1000146195 465
345 3300006880 Ga0075429_100158719 Ga0075429_1001587191 465
346 3300009093 Ga0105240_10026676 Ga0105240_100266769 465
347 3300009147 Ga0114129_10043003 Ga0114129_100430034 465
348 3300009147 Ga0114129_10138516 Ga0114129_101385162 465
349 3300009551 Ga0105238_10009341 Ga0105238_100093412 465
350 3300010375 Ga0105239_10246035 Ga0105239_102460351 465
351 3300013250 Ga0171462_1007 Ga0171462_100765 465
352 3300014325 Ga0163163_10049647 Ga0163163_100496472 465
353 3300014325 Ga0163163_10050813 Ga0163163_100508132 465
354 3300014969 Ga0157376_10108104 Ga0157376_101081042 465
355 3300025208 Ga0209436_100021 Ga0209436_10002189 465
356 3300025250 Ga0209026_1000141 Ga0209026_1000141126 465
357 3300025256 Ga0209759_1001567 Ga0209759_10015674 465
358 3300025258 Ga0209129_1005261 Ga0209129_10052614 465
359 3300025261 Ga0209233_1000118 Ga0209233_1000118180 465
360 3300025261 Ga0209233_1004414 Ga0209233_10044144 465
361 3300025261 Ga0209233_1018948 Ga0209233_10189482 465
362 3300025284 Ga0209130_1000001 Ga0209130_100000111 465
363 3300025284 Ga0209130_1000024 Ga0209130_1000024132 465
364 3300025291 Ga0209675_1000455 Ga0209675_10004557 465
365 3300025294 Ga0209025_1000010 Ga0209025_1000010649 465
366 3300025294 Ga0209025_1004168 Ga0209025_10041687 465
367 3300025295 Ga0209564_1000048 Ga0209564_1000048271 465
368 3300025295 Ga0209564_1000074 Ga0209564_100007469 465
369 3300025295 Ga0209564_1002565 Ga0209564_100256511 465
370 3300025297 Ga0209758_1000058 Ga0209758_1000058304 465
371 3300025297 Ga0209758_1003775 Ga0209758_100377514 465
372 3300025297 Ga0209758_1013862 Ga0209758_10138622 465
373 3300025298 Ga0209050_1024703 Ga0209050_10247033 465
374 3300025299 Ga0209256_1000041 Ga0209256_1000041271 465
375 3300025299 Ga0209256_1013368 Ga0209256_10133683 465
376 3300025302 Ga0207426_1000005 Ga0207426_1000005616 465
377 3300025303 Ga0209051_1002794 Ga0209051_10027944 465
378 3300025304 Ga0209257_1004881 Ga0209257_10048813 465
379 3300025898 Ga0207692_10017401 Ga0207692_100174011 465
380 3300025915 Ga0207693_10003577 Ga0207693_100035773 465
381 3300026041 Ga0207639_10092621 Ga0207639_100926212 465
382 3300027296 Ga0209389_1000133 Ga0209389_10001333 465
383 3300027296 Ga0209389_1006188 Ga0209389_100618810 465
384 3300027357 Ga0209589_1013845 Ga0209589_101384510 465
385 3300027361 Ga0209489_110509 Ga0209489_1105092 465
386 3300027361 Ga0209489_115928 Ga0209489_1159282 465
387 3300027363 Ga0209700_100005 Ga0209700_100005578 465
388 3300027907 Ga0207428_10004370 Ga0207428_100043706 465
389 3300028379 Ga0268266_10055586 Ga0268266_100555864 465
390 3300031901 Ga0307406_10041288 Ga0307406_100412883 465
391 3300031911 Ga0307412_10109093 Ga0307412_101090931 465
392 3300035724 Ga0373933_0025472 Ga0373933_0025472_1708_3105 465
393 3300036401 Ga0373937_0018118 Ga0373937_0018118_2781_4178 465
394 3300036401 Ga0373937_0037860 Ga0373937_0037860_2936_4333 465
395 3300037068 Ga0373925_0091494 Ga0373925_0091494_740_2137 465
396 3300037418 Ga0395900_0067559 Ga0395900_0067559_241_1638 465
397 3300037418 Ga0395900_0122112 Ga0395900_0122112_85_1527 465
398 3300037418 Ga0395900_0237219 Ga0395900_0237219_68_1465 465
399 3300037418 Ga0395900_0311644 Ga0395900_0311644_59_1456 465
400 3300037466 Ga0395898_0020537 Ga0395898_0020537_4813_6210 465
401 3300037471 Ga0395905_0058201 Ga0395905_0058201_91_1488 465
402 3300037471 Ga0395905_0074713 Ga0395905_0074713_1280_2677 465
403 3300037471 Ga0395905_0083850 Ga0395905_0083850_277_1674 465
404 3300037471 Ga0395905_0171614 Ga0395905_0171614_53_1450 465
405 3300038443 Ga0395901_0055007 Ga0395901_0055007_185_1582 465
406 3300038443 Ga0395901_0209602 Ga0395901_0209602_66_1463 465
407 3300044658 Ga0466972_0019606 Ga0466972_0019606_1922_3319 465
408 3300044901 Ga0466960_0071327 Ga0466960_0071327_149_1546 465
409 3300044901 Ga0466960_0109120 Ga0466960_0109120_19_1416 465
410 3300046460 Ga0495638_0016018 Ga0495638_0016018_255_1652 465
411 3300046477 Ga0495664_0037408 Ga0495664_0037408_481_1878 465
412 3300046511 Ga0495608_0013532 Ga0495608_0013532_57_1454 465
413 3300046514 Ga0495618_0056239 Ga0495618_0056239_954_2351 465
414 3300046516 Ga0495628_0033076 Ga0495628_0033076_502_1899 465
415 3300046522 Ga0495643_0053994 Ga0495643_0053994_694_2091 465
416 3300046536 Ga0495587_0017870 Ga0495587_0017870_23_1420 465
417 3300046543 Ga0495645_0001029 Ga0495645_0001029_3803_5200 465
418 3300046559 Ga0495667_0025459 Ga0495667_0025459_1881_3278 465
419 3300046663 Ga0495635_0109498 Ga0495635_0109498_101_1498 465
420 3300046678 Ga0495599_0016044 Ga0495599_0016044_2740_4137 465
421 3300046809 Ga0495600_0016468 Ga0495600_0016468_2782_4179 465
422 3300047317 Ga0495604_0024761 Ga0495604_0024761_2700_4097 465
423 3300047319 Ga0495674_0235549 Ga0495674_0235549_83_1480 465
424 3300047444 Ga0495675_0094965 Ga0495675_0094965_181_1578 465
425 3300047471 Ga0495684_0150471 Ga0495684_0150471_178_1575 465
426 3300048088 Ga0495602_0000790 Ga0495602_0000790_9403_10800 465
427 3300048088 Ga0495602_0172070 Ga0495602_0172070_229_1626 465
428 3300048918 Ga0496115_0110821 Ga0496115_0110821_801_2198 465
429 3300048923 Ga0496120_0020389 Ga0496120_0020389_686_2083 465
430 3300048924 Ga0496121_0146789 Ga0496121_0146789_222_1619 465
431 3300048925 Ga0496122_0000042 Ga0496122_0000042_121608_123005 465
432 3300048925 Ga0496122_0005598 Ga0496122_0005598_156_1553 465
433 3300048925 Ga0496122_0033280 Ga0496122_0033280_2691_4088 465
434 3300048926 Ga0496123_0000030 Ga0496123_0000030_168755_170152 465
435 3300048926 Ga0496123_0026300 Ga0496123_0026300_2172_3569 465
436 3300048926 Ga0496123_0032096 Ga0496123_0032096_2258_3655 465
437 3300049571 Ga0501034_0052236 Ga0501034_0052236_2567_3964 465
438 3300049571 Ga0501034_0096598 Ga0501034_0096598_1298_2695 465
439 3300049572 Ga0501036_0070735 Ga0501036_0070735_1298_2695 465
440 3300049573 Ga0501037_0023998 Ga0501037_0023998_2655_4055 465
441 3300049573 Ga0501037_0054413 Ga0501037_0054413_1298_2695 465
442 3300049574 Ga0501038_0072094 Ga0501038_0072094_1298_2695 465
443 3300049579 Ga0501043_0026654 Ga0501043_0026654_1840_3237 465
444 3300049579 Ga0501043_0035844 Ga0501043_0035844_532_1929 465
445 3300049580 Ga0501046_0041558 Ga0501046_0041558_1451_2848 465
446 3300049581 Ga0501047_0133341 Ga0501047_0133341_441_1838 465
447 3300049586 Ga0501070_0056246 Ga0501070_0056246_618_2015 465
448 3300049589 Ga0501073_0007755 Ga0501073_0007755_42_1439 465
449 3300049822 Ga0501035_0048270 Ga0501035_0048270_2261_3658 465
450 3300049823 Ga0501044_0055494 Ga0501044_0055494_2644_4041 465
451 3300049823 Ga0501044_0098085 Ga0501044_0098085_256_1653 465
452 3300050490 nmdc:mga03n38_15215_c1 nmdc:mga03n38_15215_c1_885_2282 465
453 3300050492 nmdc:mga0yw44_12728_c1 nmdc:mga0yw44_12728_c1_898_2301 465
454 3300050492 nmdc:mga0yw44_64337_c1 nmdc:mga0yw44_64337_c1_171_1568 465
455 3300050508 nmdc:mga09592_24447_c1 nmdc:mga09592_24447_c1_1391_2788 465
456 3300050510 nmdc:mga06r32_127526_c1 nmdc:mga06r32_127526_c1_424_1821 465
457 3300050510 nmdc:mga06r32_3229_c1 nmdc:mga06r32_3229_c1_5266_6663 465
458 3300050511 nmdc:mga08y16_35503_c1 nmdc:mga08y16_35503_c1_1630_3027 465
459 3300050512 nmdc:mga0n895_62303_c1 nmdc:mga0n895_62303_c1_137_1534 465
460 3300050515 nmdc:mga0a205_5649_c1 nmdc:mga0a205_5649_c1_1379_2776 465
461 3300053077 Ga0495601_0010434 Ga0495601_0010434_3740_5137 465
462 3300053139 Ga0500568_0000202 Ga0500568_0000202_159_1556 465
463 3300053156 Ga0500622_0032988 Ga0500622_0032988_1231_2628 465
464 iso_pu_bacteria 2513237090 2513613893 465
465 iso_pu_bacteria 2847930680 2847936834 465
466 iso_pu_bacteria 2879083081 2879087690 465
467 iso_pu_bacteria 8004312739 8004316453 465

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02852

Pyr_redox_dim

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

344

453

0.99

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

178

253

0.96

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

6

325

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cmz-assembly2.cif.gz_D 2.3 angstrom resolution crystal structure of dihydrolipoamide dehydrogenase from burkholderia cenocepacia in complex with fad and nad 0.9264 2 460
6cmz-assembly2.cif.gz_D 2.3 angstrom resolution crystal structure of dihydrolipoamide dehydrogenase from burkholderia cenocepacia in complex with fad and nad 0.9206 2 460
1lvl-assembly1.cif.gz_A-2 the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution 0.9101 1 465
1lvl-assembly1.cif.gz_A-2 the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution 0.9082 1 465
1ebd-assembly1.cif.gz_B dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase 0.9049 4 455
ID Description Score Start End Superfamily
1lvlA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9414 152 271 3.50.50.60
2r9zB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9357 6 342 3.50.50.60
1lvlA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9338 152 271 3.50.50.60
1lvlA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9335 4 342 3.50.50.60
1ebdB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.926 4 342 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A658G1G3-F1-model_v4 deleted 0.9622 2 355
AF-A0A1B3NMH1-F1-model_v4 Glucose inhibited division A family protein 0.9599 1 162 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-A0A519L063-F1-model_v4 Dihydrolipoyl dehydrogenase 0.9594 1 241 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-A0A519L063-F1-model_v4 Dihydrolipoyl dehydrogenase 0.9555 1 241 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-A0A658G1G3-F1-model_v4 deleted 0.9515 2 355

Feature Viewer

pLDDT pTM Quality
82.43 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map