F449841

General Info

Members Datasets Scaffolds Average Seq Length
467 230 467 138

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10000802|Ga0105245_1000080217
Length 156
Sequence VDGVDDVHAALDGSVRPVRALVQRVTRASVAIDGTEVAAIGPGLLVLLGVTHDDDEESADRLADKVRALRVFDDAEGRMNEPLGDREVLCVSQFTLYGDARKGNRPSFVAAARPAQAEPLYERFAARLGAQTGRFGARMAVELVNDGPVTLLLEGR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 15.2
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10038080 3300003203 Bacteria 1727
2 Ga0070683_100003749 3300005329 Bacteria 12400
3 Ga0070683_100010491 3300005329 Bacteria 7968
4 Ga0070683_100625615 3300005329 Bacteria 1030
5 Ga0070683_100714269 3300005329 Bacteria 960
6 Ga0070670_100870653 3300005331 Bacteria 816
7 Ga0068869_100079699 3300005334 Bacteria 2441
8 Ga0068869_100485948 3300005334 Bacteria 1029
9 Ga0070682_100010672 3300005337 Bacteria 5221
10 Ga0070682_100243377 3300005337 Bacteria 1292
11 Ga0068868_100002747 3300005338 Bacteria 12189
12 Ga0068868_100003045 3300005338 Bacteria 11667
13 Ga0068868_100066175 3300005338 Bacteria 2873
14 Ga0070660_100053823 3300005339 Bacteria 3105
15 Ga0070660_101065988 3300005339 Bacteria 684
16 Ga0070689_100262238 3300005340 Bacteria 1428
17 Ga0070687_100002752 3300005343 Bacteria 6674
18 Ga0070687_100246369 3300005343 Bacteria 1108
19 Ga0070661_100546055 3300005344 Bacteria 932
20 Ga0070668_100171900 3300005347 Bacteria 1765
21 Ga0070675_101221182 3300005354 Bacteria 692
22 Ga0070671_100309196 3300005355 Bacteria 1346
23 Ga0070671_101182087 3300005355 Bacteria 673
24 Ga0070674_100055030 3300005356 Bacteria 2754
25 Ga0070673_100079228 3300005364 Bacteria 2659
26 Ga0070688_100018659 3300005365 Bacteria 4006
27 Ga0070688_100090068 3300005365 Bacteria 2003
28 Ga0070659_100064198 3300005366 Bacteria 2906
29 Ga0070659_100117405 3300005366 Bacteria 2152
30 Ga0070659_100760111 3300005366 Bacteria 841
31 Ga0070713_100469557 3300005436 Bacteria 1184
32 Ga0070710_10070738 3300005437 Bacteria 2010
33 Ga0070701_10121375 3300005438 Bacteria 1473
34 Ga0070711_100156317 3300005439 Bacteria 1724
35 Ga0070711_100228836 3300005439 Bacteria 1449
36 Ga0070700_100085217 3300005441 Bacteria 2049
37 Ga0070700_100086331 3300005441 Bacteria 2037
38 Ga0070700_100207836 3300005441 Bacteria 1379
39 Ga0070700_100896365 3300005441 Bacteria 722
40 Ga0070663_100202071 3300005455 Bacteria 1551
41 Ga0070662_100893517 3300005457 Bacteria 758
42 Ga0068867_100933655 3300005459 Bacteria 783
43 Ga0070707_100013518 3300005468 Bacteria 7637
44 Ga0070707_100682768 3300005468 Archaea 990
45 Ga0070684_100008144 3300005535 Bacteria 8182
46 Ga0070684_101283285 3300005535 Bacteria 689
47 Ga0068853_100170289 3300005539 Bacteria 1970
48 Ga0070686_100029436 3300005544 Bacteria 3342
49 Ga0070695_101056579 3300005545 Bacteria 663
50 Ga0070693_100371876 3300005547 Bacteria 984
51 Ga0070665_100640422 3300005548 Bacteria 1076
52 Ga0070665_102180504 3300005548 Bacteria 558
53 Ga0070704_100127277 3300005549 Bacteria 1967
54 Ga0070704_100181917 3300005549 Bacteria 1682
55 Ga0070664_100068075 3300005564 Bacteria 3044
56 Ga0070664_100110765 3300005564 Bacteria 2396
57 Ga0070664_100220288 3300005564 Bacteria 1698
58 Ga0070664_100746916 3300005564 Bacteria 913
59 Ga0068854_100570338 3300005578 Bacteria 962
60 Ga0068856_100127421 3300005614 Bacteria 2549
61 Ga0068856_100211091 3300005614 Bacteria 1957
62 Ga0070702_100014681 3300005615 Bacteria 3979
63 Ga0070702_100015218 3300005615 Bacteria 3922
64 Ga0070702_100016138 3300005615 Bacteria 3826
65 Ga0070702_100067705 3300005615 Bacteria 2099
66 Ga0070702_100272671 3300005615 Bacteria 1158
67 Ga0068852_100038360 3300005616 Bacteria 4026
68 Ga0068852_100162944 3300005616 Bacteria 2084
69 Ga0068852_100422832 3300005616 Bacteria 1315
70 Ga0068859_100751696 3300005617 Bacteria 1064
71 Ga0068859_100762686 3300005617 Bacteria 1056
72 Ga0068864_100029038 3300005618 Bacteria 4679
73 Ga0068864_100248246 3300005618 Bacteria 1651
74 Ga0068864_100333914 3300005618 Bacteria 1427
75 Ga0068864_100421057 3300005618 Bacteria 1272
76 Ga0068864_100866511 3300005618 Bacteria 891
77 Ga0068866_10426412 3300005718 Bacteria 862
78 Ga0068861_100169884 3300005719 Bacteria 1806
79 Ga0068861_100199349 3300005719 Bacteria 1679
80 Ga0068861_100381383 3300005719 Bacteria 1246
81 Ga0068851_10676343 3300005834 Bacteria 634
82 Ga0068863_100153483 3300005841 Bacteria 2204
83 Ga0068858_101549970 3300005842 Bacteria 654
84 Ga0068860_100140360 3300005843 Bacteria 2322
85 Ga0068860_101358294 3300005843 Bacteria 732
86 Ga0081455_10057996 3300005937 Bacteria 3279
87 Ga0081538_10005554 3300005981 Bacteria 11314
88 Ga0081539_10003039 3300005985 Bacteria 21722
89 Ga0081539_10007462 3300005985 Bacteria 9963
90 Ga0081539_10042680 3300005985 Bacteria 2639
91 Ga0070717_10236849 3300006028 Bacteria 1608
92 Ga0070717_10521705 3300006028 Bacteria 1075
93 Ga0075365_10000294 3300006038 Bacteria 17330
94 Ga0075365_10796946 3300006038 Bacteria 667
95 Ga0075364_10057439 3300006051 Bacteria 2549
96 Ga0075364_10212778 3300006051 Bacteria 1311
97 Ga0075432_10306506 3300006058 Bacteria 661
98 Ga0070716_100204075 3300006173 Bacteria 1316
99 Ga0070712_100224695 3300006175 Bacteria 1488
100 Ga0070712_100343871 3300006175 Bacteria 1219
101 Ga0070712_100418864 3300006175 Bacteria 1109
102 Ga0097621_101032663 3300006237 Bacteria 770
103 Ga0097621_102148324 3300006237 Bacteria 534
104 Ga0075428_100037162 3300006844 Bacteria 5362
105 Ga0075428_100582373 3300006844 Bacteria 1196
106 Ga0075430_100216142 3300006846 Bacteria 1591
107 Ga0068865_100029787 3300006881 Bacteria 3625
108 Ga0068865_100059741 3300006881 Bacteria 2667
109 Ga0068865_100695133 3300006881 Bacteria 868
110 Ga0075436_100037402 3300006914 Bacteria 3351
111 Ga0097620_100751798 3300006931 Bacteria 1064
112 Ga0097620_100762618 3300006931 Bacteria 1056
113 Ga0075435_100740369 3300007076 Bacteria 855
114 Ga0105244_10453759 3300009036 Bacteria 590
115 Ga0105240_10195025 3300009093 Bacteria 2379
116 Ga0111539_10352332 3300009094 Bacteria 1713
117 Ga0111539_10609577 3300009094 Bacteria 1271
118 Ga0111539_11567374 3300009094 Bacteria 764
119 Ga0105245_10000802 3300009098 Bacteria 28539
120 Ga0105245_10056623 3300009098 Bacteria 3524
121 Ga0105245_10362720 3300009098 Bacteria 1438
122 Ga0105245_10883172 3300009098 Bacteria 935
123 Ga0105247_10391259 3300009101 Bacteria 988
124 Ga0105247_10688720 3300009101 Bacteria 768
125 Ga0114129_10325974 3300009147 Bacteria 2041
126 Ga0114129_11226684 3300009147 Bacteria 933
127 Ga0114129_11315774 3300009147 Bacteria 895
128 Ga0105243_10050913 3300009148 Bacteria 3273
129 Ga0105243_10081175 3300009148 Bacteria 2647
130 Ga0105243_10098547 3300009148 Bacteria 2421
131 Ga0105243_10269527 3300009148 Bacteria 1528
132 Ga0105243_11891195 3300009148 Bacteria 629
133 Ga0105242_10491450 3300009176 Bacteria 1165
134 Ga0105242_10840262 3300009176 Bacteria 913
135 Ga0105248_10260727 3300009177 Bacteria 1951
136 Ga0105248_11103723 3300009177 Bacteria 897
137 Ga0105249_10127241 3300009553 Bacteria 2427
138 Ga0105249_10165695 3300009553 Bacteria 2139
139 Ga0105249_10167843 3300009553 Bacteria 2126
140 Ga0105249_10599231 3300009553 Bacteria 1156
141 Ga0105249_10632779 3300009553 Bacteria 1126
142 Ga0105239_10006437 3300010375 Bacteria 13618
143 Ga0105239_10044466 3300010375 Bacteria 4868
144 Ga0105239_10544864 3300010375 Bacteria 1321
145 Ga0105246_10610272 3300011119 Bacteria 944
146 Ga0105246_11087429 3300011119 Bacteria 729
147 Ga0157369_11582708 3300013105 Bacteria 666
148 Ga0157374_10002477 3300013296 Bacteria 15587
149 Ga0157374_10005918 3300013296 Bacteria 10331
150 Ga0157374_11058989 3300013296 Bacteria 831
151 Ga0157378_10225855 3300013297 Bacteria 1782
152 Ga0163162_10400169 3300013306 Bacteria 1506
153 Ga0157372_10300751 3300013307 Bacteria 1866
154 Ga0157372_10647559 3300013307 Bacteria 1231
155 Ga0157375_10032753 3300013308 Bacteria 4932
156 Ga0163163_10085338 3300014325 Bacteria 3165
157 Ga0163163_10098920 3300014325 Bacteria 2938
158 Ga0163163_10299164 3300014325 Bacteria 1661
159 Ga0163163_10317491 3300014325 Bacteria 1611
160 Ga0157380_11007257 3300014326 Bacteria 867
161 Ga0182008_10179621 3300014497 Bacteria 1070
162 Ga0182008_10249286 3300014497 Bacteria 916
163 Ga0157377_10207874 3300014745 Bacteria 1246
164 Ga0157379_10343728 3300014968 Bacteria 1365
165 Ga0157379_10736625 3300014968 Bacteria 927
166 Ga0157376_10390180 3300014969 Bacteria 1343
167 Ga0157376_12132805 3300014969 Bacteria 599
168 Ga0163161_10045227 3300017792 Bacteria 3174
169 Ga0206353_11229392 3300020082 Bacteria 886
170 Ga0213875_10002283 3300021388 Bacteria 11621
171 Ga0207692_10047094 3300025898 Bacteria 2164
172 Ga0207642_10007922 3300025899 Bacteria 3614
173 Ga0207642_10214194 3300025899 Bacteria 1072
174 Ga0207710_10257950 3300025900 Bacteria 873
175 Ga0207710_10352599 3300025900 Bacteria 750
176 Ga0207688_10000308 3300025901 Bacteria 22493
177 Ga0207688_10021015 3300025901 Bacteria 3564
178 Ga0207688_10136190 3300025901 Bacteria 1442
179 Ga0207705_10079098 3300025909 Bacteria 2394
180 Ga0207705_10583198 3300025909 Bacteria 869
181 Ga0207693_10292334 3300025915 Bacteria 1277
182 Ga0207693_10468058 3300025915 Bacteria 984
183 Ga0207693_10953059 3300025915 Bacteria 657
184 Ga0207693_10989011 3300025915 Bacteria 643
185 Ga0207663_10176103 3300025916 Bacteria 1523
186 Ga0207663_10209667 3300025916 Bacteria 1411
187 Ga0207662_10026273 3300025918 Bacteria 3357
188 Ga0207662_10071884 3300025918 Bacteria 2095
189 Ga0207662_10264278 3300025918 Bacteria 1134
190 Ga0207657_10034610 3300025919 Bacteria 4540
191 Ga0207657_10119214 3300025919 Bacteria 2172
192 Ga0207657_10215103 3300025919 Bacteria 1541
193 Ga0207657_10668227 3300025919 Bacteria 808
194 Ga0207646_10511265 3300025922 Bacteria 1082
195 Ga0207681_11065672 3300025923 Bacteria 679
196 Ga0207694_10473207 3300025924 Bacteria 1047
197 Ga0207650_10086695 3300025925 Bacteria 2384
198 Ga0207650_10796224 3300025925 Bacteria 801
199 Ga0207659_10056643 3300025926 Bacteria 2808
200 Ga0207687_10006451 3300025927 Bacteria 7749
201 Ga0207687_10104866 3300025927 Bacteria 2088
202 Ga0207687_10115340 3300025927 Bacteria 2001
203 Ga0207687_10129015 3300025927 Bacteria 1903
204 Ga0207700_10220915 3300025928 Bacteria 1606
205 Ga0207644_10484425 3300025931 Bacteria 1019
206 Ga0207644_10710486 3300025931 Bacteria 838
207 Ga0207690_10282544 3300025932 Bacteria 1293
208 Ga0207706_10008975 3300025933 Bacteria 9203
209 Ga0207706_10975464 3300025933 Bacteria 713
210 Ga0207686_10366596 3300025934 Bacteria 1089
211 Ga0207709_10056112 3300025935 Bacteria 2436
212 Ga0207709_10067829 3300025935 Bacteria 2253
213 Ga0207709_10079374 3300025935 Bacteria 2110
214 Ga0207709_10171881 3300025935 Bacteria 1522
215 Ga0207670_10052758 3300025936 Bacteria 2735
216 Ga0207669_10075612 3300025937 Bacteria 2135
217 Ga0207704_10660184 3300025938 Bacteria 862
218 Ga0207704_11117205 3300025938 Bacteria 670
219 Ga0207704_11165449 3300025938 Bacteria 656
220 Ga0207704_11782214 3300025938 Bacteria 529
221 Ga0207665_10088918 3300025939 Bacteria 2138
222 Ga0207665_10121063 3300025939 Bacteria 1849
223 Ga0207665_10182870 3300025939 Bacteria 1519
224 Ga0207711_10601478 3300025941 Bacteria 1026
225 Ga0207711_10611464 3300025941 Bacteria 1017
226 Ga0207711_10658937 3300025941 Bacteria 976
227 Ga0207711_10785210 3300025941 Bacteria 887
228 Ga0207689_10100273 3300025942 Bacteria 2379
229 Ga0207689_10132567 3300025942 Bacteria 2051
230 Ga0207661_10001202 3300025944 Bacteria 17324
231 Ga0207661_10004007 3300025944 Bacteria 10294
232 Ga0207661_10322667 3300025944 Bacteria 1389
233 Ga0207679_10097176 3300025945 Bacteria 2293
234 Ga0207679_10106435 3300025945 Bacteria 2205
235 Ga0207679_10237412 3300025945 Bacteria 1543
236 Ga0207679_10403165 3300025945 Bacteria 1203
237 Ga0207651_10228762 3300025960 Bacteria 1508
238 Ga0207651_10294246 3300025960 Bacteria 1348
239 Ga0207712_10100411 3300025961 Bacteria 2150
240 Ga0207712_10664456 3300025961 Bacteria 907
241 Ga0207668_10330397 3300025972 Bacteria 1268
242 Ga0207640_10703459 3300025981 Bacteria 867
243 Ga0207677_10001707 3300026023 Bacteria 11608
244 Ga0207677_10008831 3300026023 Bacteria 5647
245 Ga0207677_10113649 3300026023 Bacteria 2021
246 Ga0207677_11101856 3300026023 Bacteria 724
247 Ga0207677_11382962 3300026023 Bacteria 648
248 Ga0207703_10100574 3300026035 Bacteria 2450
249 Ga0207703_10847256 3300026035 Bacteria 874
250 Ga0207678_10018333 3300026067 Bacteria 6148
251 Ga0207678_10159622 3300026067 Bacteria 1926
252 Ga0207708_10016330 3300026075 Bacteria 5580
253 Ga0207708_10095468 3300026075 Bacteria 2296
254 Ga0207708_10500254 3300026075 Bacteria 1019
255 Ga0207708_10633469 3300026075 Bacteria 909
256 Ga0207708_10877412 3300026075 Bacteria 775
257 Ga0207702_10041624 3300026078 Bacteria 3853
258 Ga0207702_10135822 3300026078 Bacteria 2219
259 Ga0207702_11319315 3300026078 Bacteria 716
260 Ga0207676_10225571 3300026095 Bacteria 1672
261 Ga0207676_11328322 3300026095 Bacteria 714
262 Ga0207675_100010551 3300026118 Bacteria 8655
263 Ga0207675_100047006 3300026118 Bacteria 4031
264 Ga0207675_100349805 3300026118 Bacteria 1448
265 Ga0207698_10020107 3300026142 Bacteria 4589
266 Ga0207698_10314853 3300026142 Bacteria 1463
267 Ga0207698_10498178 3300026142 Bacteria 1185
268 Ga0207698_11059187 3300026142 Bacteria 823
269 Ga0268266_10150638 3300028379 Bacteria 2096
270 Ga0268265_10084918 3300028380 Bacteria 2511
271 Ga0268264_10153735 3300028381 Bacteria 2065
272 Ga0268264_10199318 3300028381 Bacteria 1830
273 Ga0268264_10308735 3300028381 Bacteria 1492
274 Ga0307408_100173201 3300031548 Bacteria 1725
275 Ga0307413_10203022 3300031824 Bacteria 1433
276 Ga0307410_10025512 3300031852 Bacteria 3710
277 Ga0307410_10546038 3300031852 Bacteria 960
278 Ga0307406_10182320 3300031901 Bacteria 1530
279 Ga0307407_10081919 3300031903 Bacteria 1954
280 Ga0307412_10090417 3300031911 Bacteria 2140
281 Ga0307409_100007135 3300031995 Bacteria 6656
282 Ga0307409_100210430 3300031995 Bacteria 1747
283 Ga0307409_100211144 3300031995 Bacteria 1745
284 Ga0307409_100253952 3300031995 Bacteria 1609
285 Ga0307416_100005359 3300032002 Bacteria 7872
286 Ga0307416_100496035 3300032002 Bacteria 1284
287 Ga0307416_100561087 3300032002 Bacteria 1217
288 Ga0307416_100876501 3300032002 Bacteria 997
289 Ga0307414_10920808 3300032004 Bacteria 802
290 Ga0307414_11090821 3300032004 Bacteria 737
291 Ga0307415_100173713 3300032126 Bacteria 1683
292 Ga0373938_0107594 3300034957 Bacteria 707
293 Ga0373954_0596424 3300035118 Bacteria 548
294 Ga0373957_0165746 3300035120 Bacteria 912
295 Ga0373937_0264774 3300036401 Bacteria 1621
296 Ga0395900_0817513 3300037418 Bacteria 859
297 Ga0395898_0553169 3300037466 Bacteria 1093
298 Ga0436364_1345153 3300037853 Bacteria 31795
299 Ga0436363_0240307 3300039450 Bacteria 914
300 Ga0436363_1657134 3300039450 Bacteria 698
301 Ga0451839_0598573 3300041496 Bacteria 1793
302 Ga0451839_1431220 3300041496 Bacteria 777
303 Ga0451845_0854746 3300041501 Bacteria 827
304 Ga0466965_0087547 3300044683 Bacteria 1581
305 Ga0466963_0037331 3300044694 Bacteria 3171
306 Ga0466963_0443847 3300044694 Bacteria 915
307 Ga0466963_0534190 3300044694 Bacteria 828
308 Ga0466963_0912106 3300044694 Bacteria 619
309 Ga0466964_0367318 3300044706 Bacteria 744
310 Ga0466971_0242631 3300044719 Bacteria 857
311 Ga0466971_0513519 3300044719 Bacteria 592
312 Ga0466957_0657296 3300044842 Bacteria 737
313 Ga0466960_0241593 3300044901 Bacteria 1000
314 Ga0466958_0164952 3300045836 Bacteria 1401
315 Ga0466958_0240125 3300045836 Bacteria 1158
316 Ga0466967_0009164 3300045976 Bacteria 7323
317 Ga0466967_0014580 3300045976 Bacteria 6129
318 Ga0466967_0061597 3300045976 Bacteria 3329
319 Ga0466967_0071996 3300045976 Bacteria 3096
320 Ga0466967_0107841 3300045976 Bacteria 2555
321 Ga0466967_0185361 3300045976 Bacteria 1965
322 Ga0466967_0462404 3300045976 Bacteria 1241
323 Ga0466967_0473122 3300045976 Bacteria 1227
324 Ga0466967_0637906 3300045976 Bacteria 1053
325 Ga0466967_0802513 3300045976 Bacteria 935
326 Ga0466967_1214494 3300045976 Bacteria 751
327 Ga0466967_1408054 3300045976 Bacteria 694
328 Ga0495592_0082922 3300046454 Bacteria 2316
329 Ga0495641_0115583 3300046461 Unclassified 1197
330 Ga0495651_0252892 3300046462 Bacteria 1202
331 Ga0495651_1012643 3300046462 Bacteria 504
332 Ga0495653_0365946 3300046463 Bacteria 924
333 Ga0495664_0786530 3300046477 Bacteria 560
334 Ga0495608_0000423 3300046511 Bacteria 29473
335 Ga0495618_0183308 3300046514 Bacteria 1330
336 Ga0495628_0614784 3300046516 Bacteria 775
337 Ga0495630_1488819 3300046517 Bacteria 508
338 Ga0495643_0228466 3300046522 Bacteria 879
339 Ga0495652_0376978 3300046529 Bacteria 1010
340 Ga0495665_0567721 3300046531 Bacteria 569
341 Ga0495587_0002896 3300046536 Bacteria 11489
342 Ga0495587_0158501 3300046536 Bacteria 1289
343 Ga0495667_0049315 3300046559 Bacteria 2779
344 Ga0495667_0631843 3300046559 Bacteria 666
345 Ga0495635_0183136 3300046663 Bacteria 1423
346 Ga0495588_0013117 3300046674 Bacteria 3940
347 Ga0495657_0155095 3300046675 Bacteria 1420
348 Ga0495657_0304714 3300046675 Bacteria 949
349 Ga0495646_0097970 3300046680 Bacteria 1684
350 Ga0495646_0520471 3300046680 Bacteria 610
351 Ga0495658_0302139 3300046683 Bacteria 1012
352 Ga0495613_0100856 3300046689 Bacteria 2085
353 Ga0495604_0268485 3300047317 Bacteria 1157
354 Ga0495674_0261412 3300047319 Bacteria 1422
355 Ga0495674_0552092 3300047319 Bacteria 917
356 Ga0495675_0056878 3300047444 Bacteria 2480
357 Ga0495602_0413398 3300048088 Bacteria 959
358 Ga0495614_0328687 3300048089 Bacteria 710
359 Ga0496100_0003617 3300048903 Bacteria 8072
360 Ga0496100_0218256 3300048903 Bacteria 1398
361 Ga0496101_0117876 3300048904 Bacteria 2005
362 Ga0496101_0416017 3300048904 Bacteria 1059
363 Ga0496101_0780801 3300048904 Bacteria 753
364 Ga0496102_0010224 3300048905 Bacteria 8067
365 Ga0496102_0015396 3300048905 Bacteria 6662
366 Ga0496103_0000057 3300048906 Bacteria 142223
367 Ga0496103_0099813 3300048906 Bacteria 1837
368 Ga0496103_0123140 3300048906 Bacteria 1653
369 Ga0496104_0064352 3300048907 Bacteria 3479
370 Ga0496104_1266755 3300048907 Bacteria 640
371 Ga0496105_0039774 3300048908 Bacteria 3877
372 Ga0496105_0085954 3300048908 Bacteria 2599
373 Ga0496105_0328529 3300048908 Bacteria 1224
374 Ga0496105_0729600 3300048908 Bacteria 758
375 Ga0496106_0049579 3300048909 Bacteria 3163
376 Ga0496106_0055651 3300048909 Bacteria 2990
377 Ga0496106_0087104 3300048909 Bacteria 2406
378 Ga0496106_0091044 3300048909 Bacteria 2354
379 Ga0496106_0546528 3300048909 Bacteria 929
380 Ga0496106_0853439 3300048909 Bacteria 721
381 Ga0496107_0038644 3300048910 Bacteria 3423
382 Ga0496107_0065912 3300048910 Bacteria 2625
383 Ga0496107_0207267 3300048910 Bacteria 1457
384 Ga0496107_1304268 3300048910 Bacteria 519
385 Ga0496108_0002908 3300048911 Bacteria 13761
386 Ga0496108_0006262 3300048911 Bacteria 9641
387 Ga0496108_0064860 3300048911 Bacteria 3077
388 Ga0496108_1010094 3300048911 Bacteria 710
389 Ga0496109_0004213 3300048912 Bacteria 11998
390 Ga0496109_0055905 3300048912 Bacteria 3600
391 Ga0496109_0213965 3300048912 Bacteria 1812
392 Ga0496109_0292512 3300048912 Bacteria 1536
393 Ga0496109_0415928 3300048912 Bacteria 1270
394 Ga0496109_0671634 3300048912 Bacteria 973
395 Ga0496109_0777695 3300048912 Bacteria 895
396 Ga0496110_0003133 3300048913 Bacteria 12562
397 Ga0496110_0030581 3300048913 Bacteria 4642
398 Ga0496110_0176236 3300048913 Bacteria 1940
399 Ga0496110_0213156 3300048913 Bacteria 1756
400 Ga0496110_0817081 3300048913 Bacteria 837
401 Ga0496110_1906619 3300048913 Bacteria 504
402 Ga0496111_0001519 3300048914 Bacteria 13304
403 Ga0496111_0024701 3300048914 Bacteria 4236
404 Ga0496111_0322594 3300048914 Bacteria 1144
405 Ga0496111_0420171 3300048914 Bacteria 988
406 Ga0496111_0683291 3300048914 Bacteria 747
407 Ga0496111_0890914 3300048914 Bacteria 641
408 Ga0496112_0011959 3300048915 Bacteria 7954
409 Ga0496112_0069673 3300048915 Bacteria 3474
410 Ga0496112_0112813 3300048915 Bacteria 2689
411 Ga0496112_0121824 3300048915 Bacteria 2578
412 Ga0496112_0189364 3300048915 Bacteria 2020
413 Ga0496112_0338732 3300048915 Bacteria 1448
414 Ga0496112_0473658 3300048915 Bacteria 1189
415 Ga0496112_0873952 3300048915 Bacteria 822
416 Ga0496113_0002360 3300048916 Bacteria 10934
417 Ga0496113_0196741 3300048916 Bacteria 1601
418 Ga0496113_0369535 3300048916 Bacteria 1151
419 Ga0496113_0577235 3300048916 Bacteria 901
420 Ga0496114_0000056 3300048917 Bacteria 95692
421 Ga0496114_0062066 3300048917 Bacteria 3127
422 Ga0496114_0087671 3300048917 Bacteria 2639
423 Ga0496114_0278920 3300048917 Bacteria 1473
424 Ga0496114_0287508 3300048917 Bacteria 1450
425 Ga0496114_0704942 3300048917 Bacteria 885
426 Ga0496115_0001143 3300048918 Bacteria 19150
427 Ga0496115_0049890 3300048918 Bacteria 3351
428 Ga0496115_0179033 3300048918 Bacteria 1753
429 Ga0496115_0463506 3300048918 Bacteria 1022
430 Ga0496121_0022605 3300048924 Bacteria 6091
431 Ga0501031_0088898 3300049568 Bacteria 2014
432 Ga0501036_0068718 3300049572 Bacteria 2998
433 Ga0501039_0020152 3300049575 Bacteria 5113
434 Ga0501042_0018781 3300049578 Bacteria 4791
435 Ga0501042_0289467 3300049578 Bacteria 1183
436 Ga0501046_0178598 3300049580 Bacteria 1589
437 Ga0501047_0051986 3300049581 Bacteria 3960
438 Ga0501070_0173201 3300049586 Bacteria 1777
439 Ga0501072_0031388 3300049588 Bacteria 4159
440 Ga0501072_1396458 3300049588 Bacteria 542
441 Ga0501074_0272096 3300049590 Bacteria 1204
442 Ga0501080_0828894 3300049742 Bacteria 810
443 Ga0501035_0741458 3300049822 Bacteria 789
444 Ga0501035_0965328 3300049822 Bacteria 672
445 Ga0501045_1005307 3300049824 Bacteria 611
446 nmdc:mga00v17_290014_c1 3300050491 Bacteria 1062
447 nmdc:mga0yw44_65833_c1 3300050492 Bacteria 2235
448 nmdc:mga0qj67_321816_c1 3300050509 Bacteria 1252
449 nmdc:mga06r32_58807_c1 3300050510 Bacteria 3695
450 nmdc:mga08y16_1037373_c1 3300050511 Bacteria 798
451 nmdc:mga08y16_1264269_c1 3300050511 Bacteria 706
452 nmdc:mga0n895_349138_c1 3300050512 Bacteria 1498
453 nmdc:mga08x19_35217_c1 3300050514 Bacteria 3166
454 Ga0495612_0074690 3300053078 Bacteria 1418
455 Ga0495655_0000002 3300053083 Bacteria 312752
456 Ga0495655_0172587 3300053083 Bacteria 693
457 Ga0495595_0066392 3300053084 Bacteria 1698
458 Ga0495619_0243791 3300053085 Bacteria 1245
459 Ga0495619_0269299 3300053085 Bacteria 1180
460 Ga0500628_000001 3300053129 Bacteria 564074
461 Ga0501084_0414992 3300054114 Bacteria 1138
462 Ga0466962_0123765 3300061719 Bacteria 1249
463 Ga0466962_0430126 3300061719 Bacteria 663
464 Ga0466962_0552653 3300061719 Bacteria 585
465 Ga0530510_0238267 3300061734 Bacteria 1354
466 Ga0530510_0350488 3300061734 Bacteria 1109
467 Ga0530510_0949314 3300061734 Bacteria 658

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100003045 Ga0068868_1000030455 118
2 3300026023 Ga0207677_10001707 Ga0207677_100017079 118
3 3300005441 Ga0070700_100086331 Ga0070700_1000863312 119
4 3300017792 Ga0163161_10045227 Ga0163161_100452272 119
5 3300026075 Ga0207708_10095468 Ga0207708_100954682 119
6 3300049578 Ga0501042_0018781 Ga0501042_0018781_694_1122 119
7 3300046536 Ga0495587_0002896 Ga0495587_0002896_621_1037 120
8 3300006237 Ga0097621_102148324 Ga0097621_1021483241 121
9 3300048906 Ga0496103_0000057 Ga0496103_0000057_19915_20346 121
10 3300048917 Ga0496114_0000056 Ga0496114_0000056_87491_87928 121
11 3300048918 Ga0496115_0001143 Ga0496115_0001143_9485_9922 121
12 3300053083 Ga0495655_0000002 Ga0495655_0000002_16741_17190 121
13 3300053129 Ga0500628_000001 Ga0500628_000001_105411_105860 121
14 3300041496 Ga0451839_0598573 Ga0451839_0598573_58_489 123
15 3300046462 Ga0495651_0252892 Ga0495651_0252892_469_885 123
16 3300046559 Ga0495667_0631843 Ga0495667_0631843_94_519 123
17 3300046675 Ga0495657_0155095 Ga0495657_0155095_432_857 123
18 3300053085 Ga0495619_0269299 Ga0495619_0269299_201_617 123
19 3300046683 Ga0495658_0302139 Ga0495658_0302139_129_545 124
20 3300046680 Ga0495646_0520471 Ga0495646_0520471_148_537 125
21 3300005329 Ga0070683_100010491 Ga0070683_1000104917 126
22 3300006844 Ga0075428_100037162 Ga0075428_1000371624 126
23 3300006846 Ga0075430_100216142 Ga0075430_1002161421 126
24 3300025944 Ga0207661_10001202 Ga0207661_1000120215 126
25 3300031911 Ga0307412_10090417 Ga0307412_100904172 126
26 3300045976 Ga0466967_0473122 Ga0466967_0473122_429_809 126
27 3300050509 nmdc:mga0qj67_321816_c1 nmdc:mga0qj67_321816_c1_259_639 126
28 3300050510 nmdc:mga06r32_58807_c1 nmdc:mga06r32_58807_c1_3281_3661 126
29 3300011119 Ga0105246_11087429 Ga0105246_110874291 127
30 3300014745 Ga0157377_10207874 Ga0157377_102078742 127
31 3300039450 Ga0436363_0240307 Ga0436363_0240307_137_520 127
32 3300041501 Ga0451845_0854746 Ga0451845_0854746_159_593 127
33 3300044683 Ga0466965_0087547 Ga0466965_0087547_439_822 127
34 3300044694 Ga0466963_0037331 Ga0466963_0037331_2610_2993 127
35 3300044694 Ga0466963_0534190 Ga0466963_0534190_84_467 127
36 3300045836 Ga0466958_0240125 Ga0466958_0240125_751_1134 127
37 3300045976 Ga0466967_0071996 Ga0466967_0071996_1311_1694 127
38 3300045976 Ga0466967_0462404 Ga0466967_0462404_475_858 127
39 3300049568 Ga0501031_0088898 Ga0501031_0088898_354_737 127
40 3300049572 Ga0501036_0068718 Ga0501036_0068718_1446_1829 127
41 3300049575 Ga0501039_0020152 Ga0501039_0020152_1765_2148 127
42 3300049578 Ga0501042_0289467 Ga0501042_0289467_304_687 127
43 3300049580 Ga0501046_0178598 Ga0501046_0178598_407_790 127
44 3300049588 Ga0501072_0031388 Ga0501072_0031388_1120_1503 127
45 3300049590 Ga0501074_0272096 Ga0501074_0272096_565_948 127
46 3300049742 Ga0501080_0828894 Ga0501080_0828894_134_517 127
47 3300049822 Ga0501035_0965328 Ga0501035_0965328_39_422 127
48 3300054114 Ga0501084_0414992 Ga0501084_0414992_446_829 127
49 3300061719 Ga0466962_0552653 Ga0466962_0552653_179_562 127
50 3300061734 Ga0530510_0238267 Ga0530510_0238267_569_952 127
51 3300061734 Ga0530510_0350488 Ga0530510_0350488_185_568 127
52 3300005329 Ga0070683_100625615 Ga0070683_1006256151 131
53 3300005545 Ga0070695_101056579 Ga0070695_1010565791 131
54 3300005549 Ga0070704_100181917 Ga0070704_1001819173 131
55 3300005937 Ga0081455_10057996 Ga0081455_100579963 131
56 3300005981 Ga0081538_10005554 Ga0081538_100055547 131
57 3300005985 Ga0081539_10042680 Ga0081539_100426802 131
58 3300006038 Ga0075365_10000294 Ga0075365_1000029415 131
59 3300006038 Ga0075365_10796946 Ga0075365_107969462 131
60 3300006051 Ga0075364_10057439 Ga0075364_100574392 131
61 3300006051 Ga0075364_10212778 Ga0075364_102127782 131
62 3300006058 Ga0075432_10306506 Ga0075432_103065062 131
63 3300009093 Ga0105240_10195025 Ga0105240_101950252 131
64 3300009094 Ga0111539_11567374 Ga0111539_115673742 131
65 3300009147 Ga0114129_10325974 Ga0114129_103259743 131
66 3300009147 Ga0114129_11226684 Ga0114129_112266841 131
67 3300009148 Ga0105243_11891195 Ga0105243_118911952 131
68 3300009177 Ga0105248_11103723 Ga0105248_111037231 131
69 3300011119 Ga0105246_10610272 Ga0105246_106102722 131
70 3300013105 Ga0157369_11582708 Ga0157369_115827081 131
71 3300014325 Ga0163163_10299164 Ga0163163_102991642 131
72 3300014968 Ga0157379_10736625 Ga0157379_107366251 131
73 3300025933 Ga0207706_10975464 Ga0207706_109754641 131
74 3300025938 Ga0207704_11117205 Ga0207704_111172051 131
75 3300025941 Ga0207711_10601478 Ga0207711_106014781 131
76 3300025941 Ga0207711_10611464 Ga0207711_106114642 131
77 3300026075 Ga0207708_10633469 Ga0207708_106334691 131
78 3300026075 Ga0207708_10877412 Ga0207708_108774121 131
79 3300031548 Ga0307408_100173201 Ga0307408_1001732012 131
80 3300031901 Ga0307406_10182320 Ga0307406_101823202 131
81 3300031995 Ga0307409_100210430 Ga0307409_1002104301 131
82 3300031995 Ga0307409_100211144 Ga0307409_1002111443 131
83 3300031995 Ga0307409_100253952 Ga0307409_1002539521 131
84 3300032002 Ga0307416_100496035 Ga0307416_1004960352 131
85 3300032004 Ga0307414_11090821 Ga0307414_110908212 131
86 3300037418 Ga0395900_0817513 Ga0395900_0817513_98_514 131
87 3300037466 Ga0395898_0553169 Ga0395898_0553169_640_1056 131
88 3300044694 Ga0466963_0912106 Ga0466963_0912106_169_585 131
89 3300044706 Ga0466964_0367318 Ga0466964_0367318_109_525 131
90 3300045976 Ga0466967_0185361 Ga0466967_0185361_1495_1911 131
91 3300045976 Ga0466967_0802513 Ga0466967_0802513_86_502 131
92 3300045976 Ga0466967_1214494 Ga0466967_1214494_184_588 131
93 3300046461 Ga0495641_0115583 Ga0495641_0115583_146_562 131
94 3300046511 Ga0495608_0000423 Ga0495608_0000423_8658_9053 131
95 3300046517 Ga0495630_1488819 Ga0495630_1488819_103_498 131
96 3300046674 Ga0495588_0013117 Ga0495588_0013117_1434_1850 131
97 3300048089 Ga0495614_0328687 Ga0495614_0328687_167_583 131
98 3300048903 Ga0496100_0003617 Ga0496100_0003617_5626_6042 131
99 3300048912 Ga0496109_0415928 Ga0496109_0415928_116_532 131
100 3300048912 Ga0496109_0671634 Ga0496109_0671634_503_919 131
101 3300048913 Ga0496110_1906619 Ga0496110_1906619_27_443 131
102 3300048914 Ga0496111_0322594 Ga0496111_0322594_206_622 131
103 3300048915 Ga0496112_0338732 Ga0496112_0338732_108_524 131
104 3300048916 Ga0496113_0369535 Ga0496113_0369535_247_663 131
105 3300048917 Ga0496114_0704942 Ga0496114_0704942_188_604 131
106 3300049581 Ga0501047_0051986 Ga0501047_0051986_2386_2802 131
107 3300049586 Ga0501070_0173201 Ga0501070_0173201_654_1049 131
108 3300049588 Ga0501072_1396458 Ga0501072_1396458_84_500 131
109 3300049822 Ga0501035_0741458 Ga0501035_0741458_37_453 131
110 3300050491 nmdc:mga00v17_290014_c1 nmdc:mga00v17_290014_c1_611_1027 131
111 3300050492 nmdc:mga0yw44_65833_c1 nmdc:mga0yw44_65833_c1_822_1238 131
112 3300053083 Ga0495655_0172587 Ga0495655_0172587_119_541 131
113 3300061719 Ga0466962_0123765 Ga0466962_0123765_625_1041 131
114 3300003203 JGI25406J46586_10038080 JGI25406J46586_100380802 132
115 3300005329 Ga0070683_100003749 Ga0070683_10000374911 132
116 3300005329 Ga0070683_100714269 Ga0070683_1007142692 132
117 3300005331 Ga0070670_100870653 Ga0070670_1008706532 132
118 3300005334 Ga0068869_100079699 Ga0068869_1000796993 132
119 3300005334 Ga0068869_100485948 Ga0068869_1004859482 132
120 3300005337 Ga0070682_100010672 Ga0070682_1000106724 132
121 3300005337 Ga0070682_100243377 Ga0070682_1002433772 132
122 3300005338 Ga0068868_100002747 Ga0068868_1000027477 132
123 3300005338 Ga0068868_100066175 Ga0068868_1000661753 132
124 3300005339 Ga0070660_100053823 Ga0070660_1000538233 132
125 3300005339 Ga0070660_101065988 Ga0070660_1010659881 132
126 3300005340 Ga0070689_100262238 Ga0070689_1002622381 132
127 3300005343 Ga0070687_100002752 Ga0070687_1000027524 132
128 3300005343 Ga0070687_100246369 Ga0070687_1002463692 132
129 3300005344 Ga0070661_100546055 Ga0070661_1005460551 132
130 3300005347 Ga0070668_100171900 Ga0070668_1001719002 132
131 3300005354 Ga0070675_101221182 Ga0070675_1012211821 132
132 3300005355 Ga0070671_100309196 Ga0070671_1003091962 132
133 3300005355 Ga0070671_101182087 Ga0070671_1011820872 132
134 3300005356 Ga0070674_100055030 Ga0070674_1000550304 132
135 3300005364 Ga0070673_100079228 Ga0070673_1000792283 132
136 3300005365 Ga0070688_100018659 Ga0070688_1000186592 132
137 3300005365 Ga0070688_100090068 Ga0070688_1000900682 132
138 3300005366 Ga0070659_100064198 Ga0070659_1000641983 132
139 3300005366 Ga0070659_100117405 Ga0070659_1001174053 132
140 3300005366 Ga0070659_100760111 Ga0070659_1007601112 132
141 3300005436 Ga0070713_100469557 Ga0070713_1004695572 132
142 3300005437 Ga0070710_10070738 Ga0070710_100707383 132
143 3300005438 Ga0070701_10121375 Ga0070701_101213753 132
144 3300005439 Ga0070711_100156317 Ga0070711_1001563172 132
145 3300005439 Ga0070711_100228836 Ga0070711_1002288362 132
146 3300005441 Ga0070700_100085217 Ga0070700_1000852172 132
147 3300005441 Ga0070700_100207836 Ga0070700_1002078362 132
148 3300005441 Ga0070700_100896365 Ga0070700_1008963651 132
149 3300005455 Ga0070663_100202071 Ga0070663_1002020713 132
150 3300005457 Ga0070662_100893517 Ga0070662_1008935172 132
151 3300005459 Ga0068867_100933655 Ga0068867_1009336551 132
152 3300005468 Ga0070707_100013518 Ga0070707_1000135184 132
153 3300005468 Ga0070707_100682768 Ga0070707_1006827682 132
154 3300005535 Ga0070684_100008144 Ga0070684_1000081445 132
155 3300005535 Ga0070684_101283285 Ga0070684_1012832851 132
156 3300005539 Ga0068853_100170289 Ga0068853_1001702893 132
157 3300005544 Ga0070686_100029436 Ga0070686_1000294362 132
158 3300005547 Ga0070693_100371876 Ga0070693_1003718762 132
159 3300005548 Ga0070665_100640422 Ga0070665_1006404222 132
160 3300005548 Ga0070665_102180504 Ga0070665_1021805041 132
161 3300005549 Ga0070704_100127277 Ga0070704_1001272771 132
162 3300005564 Ga0070664_100068075 Ga0070664_1000680753 132
163 3300005564 Ga0070664_100110765 Ga0070664_1001107652 132
164 3300005564 Ga0070664_100220288 Ga0070664_1002202882 132
165 3300005564 Ga0070664_100746916 Ga0070664_1007469162 132
166 3300005578 Ga0068854_100570338 Ga0068854_1005703382 132
167 3300005614 Ga0068856_100127421 Ga0068856_1001274213 132
168 3300005614 Ga0068856_100211091 Ga0068856_1002110912 132
169 3300005615 Ga0070702_100014681 Ga0070702_1000146812 132
170 3300005615 Ga0070702_100015218 Ga0070702_1000152183 132
171 3300005615 Ga0070702_100016138 Ga0070702_1000161385 132
172 3300005615 Ga0070702_100067705 Ga0070702_1000677052 132
173 3300005615 Ga0070702_100272671 Ga0070702_1002726712 132
174 3300005616 Ga0068852_100038360 Ga0068852_1000383601 132
175 3300005616 Ga0068852_100162944 Ga0068852_1001629443 132
176 3300005616 Ga0068852_100422832 Ga0068852_1004228322 132
177 3300005617 Ga0068859_100751696 Ga0068859_1007516962 132
178 3300005617 Ga0068859_100762686 Ga0068859_1007626862 132
179 3300005618 Ga0068864_100029038 Ga0068864_1000290385 132
180 3300005618 Ga0068864_100248246 Ga0068864_1002482462 132
181 3300005618 Ga0068864_100333914 Ga0068864_1003339142 132
182 3300005618 Ga0068864_100421057 Ga0068864_1004210572 132
183 3300005618 Ga0068864_100866511 Ga0068864_1008665112 132
184 3300005718 Ga0068866_10426412 Ga0068866_104264122 132
185 3300005719 Ga0068861_100169884 Ga0068861_1001698842 132
186 3300005719 Ga0068861_100199349 Ga0068861_1001993492 132
187 3300005719 Ga0068861_100381383 Ga0068861_1003813832 132
188 3300005834 Ga0068851_10676343 Ga0068851_106763431 132
189 3300005841 Ga0068863_100153483 Ga0068863_1001534833 132
190 3300005842 Ga0068858_101549970 Ga0068858_1015499702 132
191 3300005843 Ga0068860_100140360 Ga0068860_1001403603 132
192 3300005843 Ga0068860_101358294 Ga0068860_1013582942 132
193 3300005985 Ga0081539_10003039 Ga0081539_100030395 132
194 3300005985 Ga0081539_10007462 Ga0081539_100074624 132
195 3300006028 Ga0070717_10236849 Ga0070717_102368492 132
196 3300006028 Ga0070717_10521705 Ga0070717_105217052 132
197 3300006173 Ga0070716_100204075 Ga0070716_1002040752 132
198 3300006175 Ga0070712_100224695 Ga0070712_1002246952 132
199 3300006175 Ga0070712_100343871 Ga0070712_1003438712 132
200 3300006175 Ga0070712_100418864 Ga0070712_1004188642 132
201 3300006237 Ga0097621_101032663 Ga0097621_1010326632 132
202 3300006844 Ga0075428_100582373 Ga0075428_1005823732 132
203 3300006881 Ga0068865_100029787 Ga0068865_1000297874 132
204 3300006881 Ga0068865_100059741 Ga0068865_1000597411 132
205 3300006881 Ga0068865_100695133 Ga0068865_1006951332 132
206 3300006914 Ga0075436_100037402 Ga0075436_1000374022 132
207 3300006931 Ga0097620_100751798 Ga0097620_1007517982 132
208 3300006931 Ga0097620_100762618 Ga0097620_1007626182 132
209 3300007076 Ga0075435_100740369 Ga0075435_1007403692 132
210 3300009036 Ga0105244_10453759 Ga0105244_104537591 132
211 3300009094 Ga0111539_10352332 Ga0111539_103523322 132
212 3300009094 Ga0111539_10609577 Ga0111539_106095773 132
213 3300009098 Ga0105245_10000802 Ga0105245_1000080217 132
214 3300009098 Ga0105245_10056623 Ga0105245_100566232 132
215 3300009098 Ga0105245_10362720 Ga0105245_103627202 132
216 3300009098 Ga0105245_10883172 Ga0105245_108831722 132
217 3300009101 Ga0105247_10391259 Ga0105247_103912592 132
218 3300009101 Ga0105247_10688720 Ga0105247_106887202 132
219 3300009147 Ga0114129_11315774 Ga0114129_113157742 132
220 3300009148 Ga0105243_10050913 Ga0105243_100509133 132
221 3300009148 Ga0105243_10081175 Ga0105243_100811752 132
222 3300009148 Ga0105243_10098547 Ga0105243_100985472 132
223 3300009148 Ga0105243_10269527 Ga0105243_102695272 132
224 3300009176 Ga0105242_10491450 Ga0105242_104914502 132
225 3300009176 Ga0105242_10840262 Ga0105242_108402623 132
226 3300009177 Ga0105248_10260727 Ga0105248_102607272 132
227 3300009553 Ga0105249_10127241 Ga0105249_101272413 132
228 3300009553 Ga0105249_10165695 Ga0105249_101656953 132
229 3300009553 Ga0105249_10167843 Ga0105249_101678432 132
230 3300009553 Ga0105249_10599231 Ga0105249_105992312 132
231 3300009553 Ga0105249_10632779 Ga0105249_106327792 132
232 3300010375 Ga0105239_10006437 Ga0105239_100064373 132
233 3300010375 Ga0105239_10044466 Ga0105239_100444665 132
234 3300010375 Ga0105239_10544864 Ga0105239_105448642 132
235 3300013296 Ga0157374_10002477 Ga0157374_1000247712 132
236 3300013296 Ga0157374_10005918 Ga0157374_1000591810 132
237 3300013296 Ga0157374_11058989 Ga0157374_110589891 132
238 3300013297 Ga0157378_10225855 Ga0157378_102258551 132
239 3300013306 Ga0163162_10400169 Ga0163162_104001692 132
240 3300013307 Ga0157372_10300751 Ga0157372_103007513 132
241 3300013307 Ga0157372_10647559 Ga0157372_106475593 132
242 3300013308 Ga0157375_10032753 Ga0157375_100327536 132
243 3300014325 Ga0163163_10085338 Ga0163163_100853385 132
244 3300014325 Ga0163163_10098920 Ga0163163_100989202 132
245 3300014325 Ga0163163_10317491 Ga0163163_103174912 132
246 3300014326 Ga0157380_11007257 Ga0157380_110072571 132
247 3300014497 Ga0182008_10179621 Ga0182008_101796212 132
248 3300014497 Ga0182008_10249286 Ga0182008_102492862 132
249 3300014968 Ga0157379_10343728 Ga0157379_103437282 132
250 3300014969 Ga0157376_10390180 Ga0157376_103901801 132
251 3300014969 Ga0157376_12132805 Ga0157376_121328051 132
252 3300020082 Ga0206353_11229392 Ga0206353_112293922 132
253 3300021388 Ga0213875_10002283 Ga0213875_100022832 132
254 3300025898 Ga0207692_10047094 Ga0207692_100470943 132
255 3300025899 Ga0207642_10007922 Ga0207642_100079223 132
256 3300025899 Ga0207642_10214194 Ga0207642_102141942 132
257 3300025900 Ga0207710_10257950 Ga0207710_102579502 132
258 3300025900 Ga0207710_10352599 Ga0207710_103525992 132
259 3300025901 Ga0207688_10000308 Ga0207688_1000030817 132
260 3300025901 Ga0207688_10021015 Ga0207688_100210155 132
261 3300025901 Ga0207688_10136190 Ga0207688_101361902 132
262 3300025909 Ga0207705_10079098 Ga0207705_100790983 132
263 3300025909 Ga0207705_10583198 Ga0207705_105831982 132
264 3300025915 Ga0207693_10292334 Ga0207693_102923342 132
265 3300025915 Ga0207693_10468058 Ga0207693_104680582 132
266 3300025915 Ga0207693_10953059 Ga0207693_109530592 132
267 3300025915 Ga0207693_10989011 Ga0207693_109890112 132
268 3300025916 Ga0207663_10176103 Ga0207663_101761032 132
269 3300025916 Ga0207663_10209667 Ga0207663_102096672 132
270 3300025918 Ga0207662_10026273 Ga0207662_100262732 132
271 3300025918 Ga0207662_10071884 Ga0207662_100718844 132
272 3300025918 Ga0207662_10264278 Ga0207662_102642783 132
273 3300025919 Ga0207657_10034610 Ga0207657_100346104 132
274 3300025919 Ga0207657_10119214 Ga0207657_101192143 132
275 3300025919 Ga0207657_10215103 Ga0207657_102151032 132
276 3300025919 Ga0207657_10668227 Ga0207657_106682271 132
277 3300025922 Ga0207646_10511265 Ga0207646_105112652 132
278 3300025923 Ga0207681_11065672 Ga0207681_110656722 132
279 3300025924 Ga0207694_10473207 Ga0207694_104732072 132
280 3300025925 Ga0207650_10086695 Ga0207650_100866953 132
281 3300025925 Ga0207650_10796224 Ga0207650_107962242 132
282 3300025926 Ga0207659_10056643 Ga0207659_100566433 132
283 3300025927 Ga0207687_10006451 Ga0207687_100064512 132
284 3300025927 Ga0207687_10104866 Ga0207687_101048662 132
285 3300025927 Ga0207687_10115340 Ga0207687_101153404 132
286 3300025927 Ga0207687_10129015 Ga0207687_101290153 132
287 3300025928 Ga0207700_10220915 Ga0207700_102209152 132
288 3300025931 Ga0207644_10484425 Ga0207644_104844252 132
289 3300025931 Ga0207644_10710486 Ga0207644_107104862 132
290 3300025932 Ga0207690_10282544 Ga0207690_102825442 132
291 3300025933 Ga0207706_10008975 Ga0207706_100089757 132
292 3300025934 Ga0207686_10366596 Ga0207686_103665962 132
293 3300025935 Ga0207709_10056112 Ga0207709_100561122 132
294 3300025935 Ga0207709_10067829 Ga0207709_100678292 132
295 3300025935 Ga0207709_10079374 Ga0207709_100793743 132
296 3300025935 Ga0207709_10171881 Ga0207709_101718812 132
297 3300025936 Ga0207670_10052758 Ga0207670_100527582 132
298 3300025937 Ga0207669_10075612 Ga0207669_100756122 132
299 3300025938 Ga0207704_10660184 Ga0207704_106601842 132
300 3300025938 Ga0207704_11165449 Ga0207704_111654491 132
301 3300025938 Ga0207704_11782214 Ga0207704_117822141 132
302 3300025939 Ga0207665_10088918 Ga0207665_100889182 132
303 3300025939 Ga0207665_10121063 Ga0207665_101210633 132
304 3300025939 Ga0207665_10182870 Ga0207665_101828702 132
305 3300025941 Ga0207711_10658937 Ga0207711_106589372 132
306 3300025941 Ga0207711_10785210 Ga0207711_107852102 132
307 3300025942 Ga0207689_10100273 Ga0207689_101002733 132
308 3300025942 Ga0207689_10132567 Ga0207689_101325672 132
309 3300025944 Ga0207661_10004007 Ga0207661_100040079 132
310 3300025944 Ga0207661_10322667 Ga0207661_103226672 132
311 3300025945 Ga0207679_10097176 Ga0207679_100971762 132
312 3300025945 Ga0207679_10106435 Ga0207679_101064353 132
313 3300025945 Ga0207679_10237412 Ga0207679_102374122 132
314 3300025945 Ga0207679_10403165 Ga0207679_104031652 132
315 3300025960 Ga0207651_10228762 Ga0207651_102287622 132
316 3300025960 Ga0207651_10294246 Ga0207651_102942462 132
317 3300025961 Ga0207712_10100411 Ga0207712_101004112 132
318 3300025961 Ga0207712_10664456 Ga0207712_106644562 132
319 3300025972 Ga0207668_10330397 Ga0207668_103303972 132
320 3300025981 Ga0207640_10703459 Ga0207640_107034592 132
321 3300026023 Ga0207677_10008831 Ga0207677_100088316 132
322 3300026023 Ga0207677_10113649 Ga0207677_101136492 132
323 3300026023 Ga0207677_11101856 Ga0207677_111018562 132
324 3300026023 Ga0207677_11382962 Ga0207677_113829622 132
325 3300026035 Ga0207703_10100574 Ga0207703_101005742 132
326 3300026035 Ga0207703_10847256 Ga0207703_108472562 132
327 3300026067 Ga0207678_10018333 Ga0207678_100183337 132
328 3300026067 Ga0207678_10159622 Ga0207678_101596222 132
329 3300026075 Ga0207708_10016330 Ga0207708_100163305 132
330 3300026075 Ga0207708_10500254 Ga0207708_105002542 132
331 3300026078 Ga0207702_10041624 Ga0207702_100416243 132
332 3300026078 Ga0207702_10135822 Ga0207702_101358222 132
333 3300026078 Ga0207702_11319315 Ga0207702_113193152 132
334 3300026095 Ga0207676_10225571 Ga0207676_102255712 132
335 3300026095 Ga0207676_11328322 Ga0207676_113283221 132
336 3300026118 Ga0207675_100010551 Ga0207675_1000105517 132
337 3300026118 Ga0207675_100047006 Ga0207675_1000470062 132
338 3300026118 Ga0207675_100349805 Ga0207675_1003498052 132
339 3300026142 Ga0207698_10020107 Ga0207698_100201075 132
340 3300026142 Ga0207698_10314853 Ga0207698_103148531 132
341 3300026142 Ga0207698_10498178 Ga0207698_104981782 132
342 3300026142 Ga0207698_11059187 Ga0207698_110591872 132
343 3300028379 Ga0268266_10150638 Ga0268266_101506382 132
344 3300028380 Ga0268265_10084918 Ga0268265_100849184 132
345 3300028381 Ga0268264_10153735 Ga0268264_101537352 132
346 3300028381 Ga0268264_10199318 Ga0268264_101993182 132
347 3300028381 Ga0268264_10308735 Ga0268264_103087352 132
348 3300031824 Ga0307413_10203022 Ga0307413_102030223 132
349 3300031852 Ga0307410_10025512 Ga0307410_100255122 132
350 3300031852 Ga0307410_10546038 Ga0307410_105460382 132
351 3300031903 Ga0307407_10081919 Ga0307407_100819192 132
352 3300031995 Ga0307409_100007135 Ga0307409_1000071355 132
353 3300032002 Ga0307416_100005359 Ga0307416_1000053592 132
354 3300032002 Ga0307416_100561087 Ga0307416_1005610873 132
355 3300032002 Ga0307416_100876501 Ga0307416_1008765012 132
356 3300032004 Ga0307414_10920808 Ga0307414_109208082 132
357 3300032126 Ga0307415_100173713 Ga0307415_1001737132 132
358 3300034957 Ga0373938_0107594 Ga0373938_0107594_77_484 132
359 3300035118 Ga0373954_0596424 Ga0373954_0596424_96_515 132
360 3300035120 Ga0373957_0165746 Ga0373957_0165746_466_885 132
361 3300036401 Ga0373937_0264774 Ga0373937_0264774_692_1111 132
362 3300037853 Ga0436364_1345153 Ga0436364_1345153_30740_31159 132
363 3300039450 Ga0436363_1657134 Ga0436363_1657134_151_576 132
364 3300041496 Ga0451839_1431220 Ga0451839_1431220_165_584 132
365 3300044694 Ga0466963_0443847 Ga0466963_0443847_365_784 132
366 3300044719 Ga0466971_0242631 Ga0466971_0242631_13_432 132
367 3300044719 Ga0466971_0513519 Ga0466971_0513519_108_515 132
368 3300044842 Ga0466957_0657296 Ga0466957_0657296_274_693 132
369 3300044901 Ga0466960_0241593 Ga0466960_0241593_157_576 132
370 3300045836 Ga0466958_0164952 Ga0466958_0164952_151_585 132
371 3300045976 Ga0466967_0009164 Ga0466967_0009164_776_1195 132
372 3300045976 Ga0466967_0014580 Ga0466967_0014580_5048_5467 132
373 3300045976 Ga0466967_0061597 Ga0466967_0061597_2472_2891 132
374 3300045976 Ga0466967_0107841 Ga0466967_0107841_284_703 132
375 3300045976 Ga0466967_0637906 Ga0466967_0637906_53_460 132
376 3300045976 Ga0466967_1408054 Ga0466967_1408054_53_472 132
377 3300046454 Ga0495592_0082922 Ga0495592_0082922_1368_1787 132
378 3300046462 Ga0495651_1012643 Ga0495651_1012643_72_491 132
379 3300046463 Ga0495653_0365946 Ga0495653_0365946_203_622 132
380 3300046477 Ga0495664_0786530 Ga0495664_0786530_66_485 132
381 3300046514 Ga0495618_0183308 Ga0495618_0183308_545_964 132
382 3300046516 Ga0495628_0614784 Ga0495628_0614784_236_655 132
383 3300046522 Ga0495643_0228466 Ga0495643_0228466_316_735 132
384 3300046529 Ga0495652_0376978 Ga0495652_0376978_37_456 132
385 3300046531 Ga0495665_0567721 Ga0495665_0567721_24_443 132
386 3300046536 Ga0495587_0158501 Ga0495587_0158501_336_755 132
387 3300046559 Ga0495667_0049315 Ga0495667_0049315_2064_2483 132
388 3300046663 Ga0495635_0183136 Ga0495635_0183136_24_443 132
389 3300046675 Ga0495657_0304714 Ga0495657_0304714_216_635 132
390 3300046680 Ga0495646_0097970 Ga0495646_0097970_507_926 132
391 3300046689 Ga0495613_0100856 Ga0495613_0100856_1534_1953 132
392 3300047317 Ga0495604_0268485 Ga0495604_0268485_490_909 132
393 3300047319 Ga0495674_0261412 Ga0495674_0261412_687_1106 132
394 3300047319 Ga0495674_0552092 Ga0495674_0552092_329_748 132
395 3300047444 Ga0495675_0056878 Ga0495675_0056878_953_1372 132
396 3300048088 Ga0495602_0413398 Ga0495602_0413398_351_770 132
397 3300048903 Ga0496100_0218256 Ga0496100_0218256_234_653 132
398 3300048904 Ga0496101_0117876 Ga0496101_0117876_1142_1561 132
399 3300048904 Ga0496101_0416017 Ga0496101_0416017_212_619 132
400 3300048904 Ga0496101_0780801 Ga0496101_0780801_97_504 132
401 3300048905 Ga0496102_0010224 Ga0496102_0010224_761_1231 132
402 3300048905 Ga0496102_0015396 Ga0496102_0015396_5939_6358 132
403 3300048906 Ga0496103_0099813 Ga0496103_0099813_1176_1646 132
404 3300048906 Ga0496103_0123140 Ga0496103_0123140_754_1173 132
405 3300048907 Ga0496104_0064352 Ga0496104_0064352_1430_1849 132
406 3300048907 Ga0496104_1266755 Ga0496104_1266755_80_499 132
407 3300048908 Ga0496105_0039774 Ga0496105_0039774_1437_1856 132
408 3300048908 Ga0496105_0085954 Ga0496105_0085954_623_1093 132
409 3300048908 Ga0496105_0328529 Ga0496105_0328529_807_1214 132
410 3300048908 Ga0496105_0729600 Ga0496105_0729600_161_580 132
411 3300048909 Ga0496106_0049579 Ga0496106_0049579_542_961 132
412 3300048909 Ga0496106_0055651 Ga0496106_0055651_2456_2863 132
413 3300048909 Ga0496106_0087104 Ga0496106_0087104_727_1149 132
414 3300048909 Ga0496106_0091044 Ga0496106_0091044_1478_1948 132
415 3300048909 Ga0496106_0546528 Ga0496106_0546528_439_858 132
416 3300048909 Ga0496106_0853439 Ga0496106_0853439_267_710 132
417 3300048910 Ga0496107_0038644 Ga0496107_0038644_974_1393 132
418 3300048910 Ga0496107_0065912 Ga0496107_0065912_825_1295 132
419 3300048910 Ga0496107_0207267 Ga0496107_0207267_829_1248 132
420 3300048910 Ga0496107_1304268 Ga0496107_1304268_35_442 132
421 3300048911 Ga0496108_0002908 Ga0496108_0002908_4293_4763 132
422 3300048911 Ga0496108_0006262 Ga0496108_0006262_1536_1955 132
423 3300048911 Ga0496108_0064860 Ga0496108_0064860_1517_1924 132
424 3300048911 Ga0496108_1010094 Ga0496108_1010094_126_545 132
425 3300048912 Ga0496109_0004213 Ga0496109_0004213_9075_9545 132
426 3300048912 Ga0496109_0055905 Ga0496109_0055905_1715_2134 132
427 3300048912 Ga0496109_0213965 Ga0496109_0213965_873_1280 132
428 3300048912 Ga0496109_0292512 Ga0496109_0292512_176_595 132
429 3300048912 Ga0496109_0777695 Ga0496109_0777695_342_761 132
430 3300048913 Ga0496110_0003133 Ga0496110_0003133_8661_9131 132
431 3300048913 Ga0496110_0030581 Ga0496110_0030581_4119_4538 132
432 3300048913 Ga0496110_0176236 Ga0496110_0176236_847_1254 132
433 3300048913 Ga0496110_0213156 Ga0496110_0213156_749_1168 132
434 3300048913 Ga0496110_0817081 Ga0496110_0817081_267_686 132
435 3300048914 Ga0496111_0001519 Ga0496111_0001519_2425_2895 132
436 3300048914 Ga0496111_0024701 Ga0496111_0024701_1087_1506 132
437 3300048914 Ga0496111_0420171 Ga0496111_0420171_122_544 132
438 3300048914 Ga0496111_0683291 Ga0496111_0683291_69_476 132
439 3300048914 Ga0496111_0890914 Ga0496111_0890914_171_578 132
440 3300048915 Ga0496112_0011959 Ga0496112_0011959_452_922 132
441 3300048915 Ga0496112_0069673 Ga0496112_0069673_657_1076 132
442 3300048915 Ga0496112_0112813 Ga0496112_0112813_321_740 132
443 3300048915 Ga0496112_0121824 Ga0496112_0121824_1154_1561 132
444 3300048915 Ga0496112_0189364 Ga0496112_0189364_645_1064 132
445 3300048915 Ga0496112_0473658 Ga0496112_0473658_682_1101 132
446 3300048915 Ga0496112_0873952 Ga0496112_0873952_24_443 132
447 3300048916 Ga0496113_0002360 Ga0496113_0002360_4218_4688 132
448 3300048916 Ga0496113_0196741 Ga0496113_0196741_431_850 132
449 3300048916 Ga0496113_0577235 Ga0496113_0577235_118_537 132
450 3300048917 Ga0496114_0062066 Ga0496114_0062066_1906_2376 132
451 3300048917 Ga0496114_0087671 Ga0496114_0087671_598_1017 132
452 3300048917 Ga0496114_0278920 Ga0496114_0278920_980_1399 132
453 3300048917 Ga0496114_0287508 Ga0496114_0287508_239_646 132
454 3300048918 Ga0496115_0049890 Ga0496115_0049890_1070_1477 132
455 3300048918 Ga0496115_0179033 Ga0496115_0179033_449_868 132
456 3300048918 Ga0496115_0463506 Ga0496115_0463506_571_990 132
457 3300048924 Ga0496121_0022605 Ga0496121_0022605_1201_1623 132
458 3300049824 Ga0501045_1005307 Ga0501045_1005307_25_444 132
459 3300050511 nmdc:mga08y16_1037373_c1 nmdc:mga08y16_1037373_c1_239_646 132
460 3300050511 nmdc:mga08y16_1264269_c1 nmdc:mga08y16_1264269_c1_54_476 132
461 3300050512 nmdc:mga0n895_349138_c1 nmdc:mga0n895_349138_c1_1048_1455 132
462 3300050514 nmdc:mga08x19_35217_c1 nmdc:mga08x19_35217_c1_2456_2905 132
463 3300053078 Ga0495612_0074690 Ga0495612_0074690_467_886 132
464 3300053084 Ga0495595_0066392 Ga0495595_0066392_82_501 132
465 3300053085 Ga0495619_0243791 Ga0495619_0243791_756_1175 132
466 3300061719 Ga0466962_0430126 Ga0466962_0430126_169_603 132
467 3300061734 Ga0530510_0949314 Ga0530510_0949314_204_617 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

19

154

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9238 1 127
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9195 1 127
3ko7-assembly2.cif.gz_D dtd from plasmodium falciparum in complex with d-lysine 0.919 1 127
3kod-assembly3.cif.gz_F dtd from plasmodium falciparum in complex with d-serine 0.9171 1 127
3knp-assembly3.cif.gz_E crystal structure of dtd from plasmodium falciparum 0.916 1 127
ID Description Score Start End Superfamily
af_Q8N6C5_775_870_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9852 3 15 2.60.40.10
af_F8W457_135_238_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9797 1 17 2.60.40.10
af_Q8IIH8_94_246_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.9726 3 18 2.60.120.200
af_P45420_257_319_2.60.40.3110 Mainly Beta;Sandwich;Immunoglobulin-like;Outer membrane usher protein 0.9467 3 16 2.60.40.3110
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9264 1 127 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A1G3VYV1-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9402 1 131 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A7V4SNI9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9397 1 131 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A7C4XL70-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9375 1 131 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A2V9ZRN4-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9368 1 129 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A2D6LG21-F1-model_v4 deleted 0.9364 1 130

Feature Viewer

pLDDT pTM Quality
82.72 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map