F449841
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 467 | 230 | 467 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10000802|Ga0105245_1000080217 |
| Length | 156 |
| Sequence | VDGVDDVHAALDGSVRPVRALVQRVTRASVAIDGTEVAAIGPGLLVLLGVTHDDDEESADRLADKVRALRVFDDAEGRMNEPLGDREVLCVSQFTLYGDARKGNRPSFVAAARPAQAEPLYERFAARLGAQTGRFGARMAVELVNDGPVTLLLEGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 151 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 152 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 153 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 154 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 228 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.5 |
| Nodule | 0 |
| Rhizoplane | 15.2 |
| Rhizosphere | 81.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10038080 | 3300003203 | Bacteria | 1727 |
| 2 | Ga0070683_100003749 | 3300005329 | Bacteria | 12400 |
| 3 | Ga0070683_100010491 | 3300005329 | Bacteria | 7968 |
| 4 | Ga0070683_100625615 | 3300005329 | Bacteria | 1030 |
| 5 | Ga0070683_100714269 | 3300005329 | Bacteria | 960 |
| 6 | Ga0070670_100870653 | 3300005331 | Bacteria | 816 |
| 7 | Ga0068869_100079699 | 3300005334 | Bacteria | 2441 |
| 8 | Ga0068869_100485948 | 3300005334 | Bacteria | 1029 |
| 9 | Ga0070682_100010672 | 3300005337 | Bacteria | 5221 |
| 10 | Ga0070682_100243377 | 3300005337 | Bacteria | 1292 |
| 11 | Ga0068868_100002747 | 3300005338 | Bacteria | 12189 |
| 12 | Ga0068868_100003045 | 3300005338 | Bacteria | 11667 |
| 13 | Ga0068868_100066175 | 3300005338 | Bacteria | 2873 |
| 14 | Ga0070660_100053823 | 3300005339 | Bacteria | 3105 |
| 15 | Ga0070660_101065988 | 3300005339 | Bacteria | 684 |
| 16 | Ga0070689_100262238 | 3300005340 | Bacteria | 1428 |
| 17 | Ga0070687_100002752 | 3300005343 | Bacteria | 6674 |
| 18 | Ga0070687_100246369 | 3300005343 | Bacteria | 1108 |
| 19 | Ga0070661_100546055 | 3300005344 | Bacteria | 932 |
| 20 | Ga0070668_100171900 | 3300005347 | Bacteria | 1765 |
| 21 | Ga0070675_101221182 | 3300005354 | Bacteria | 692 |
| 22 | Ga0070671_100309196 | 3300005355 | Bacteria | 1346 |
| 23 | Ga0070671_101182087 | 3300005355 | Bacteria | 673 |
| 24 | Ga0070674_100055030 | 3300005356 | Bacteria | 2754 |
| 25 | Ga0070673_100079228 | 3300005364 | Bacteria | 2659 |
| 26 | Ga0070688_100018659 | 3300005365 | Bacteria | 4006 |
| 27 | Ga0070688_100090068 | 3300005365 | Bacteria | 2003 |
| 28 | Ga0070659_100064198 | 3300005366 | Bacteria | 2906 |
| 29 | Ga0070659_100117405 | 3300005366 | Bacteria | 2152 |
| 30 | Ga0070659_100760111 | 3300005366 | Bacteria | 841 |
| 31 | Ga0070713_100469557 | 3300005436 | Bacteria | 1184 |
| 32 | Ga0070710_10070738 | 3300005437 | Bacteria | 2010 |
| 33 | Ga0070701_10121375 | 3300005438 | Bacteria | 1473 |
| 34 | Ga0070711_100156317 | 3300005439 | Bacteria | 1724 |
| 35 | Ga0070711_100228836 | 3300005439 | Bacteria | 1449 |
| 36 | Ga0070700_100085217 | 3300005441 | Bacteria | 2049 |
| 37 | Ga0070700_100086331 | 3300005441 | Bacteria | 2037 |
| 38 | Ga0070700_100207836 | 3300005441 | Bacteria | 1379 |
| 39 | Ga0070700_100896365 | 3300005441 | Bacteria | 722 |
| 40 | Ga0070663_100202071 | 3300005455 | Bacteria | 1551 |
| 41 | Ga0070662_100893517 | 3300005457 | Bacteria | 758 |
| 42 | Ga0068867_100933655 | 3300005459 | Bacteria | 783 |
| 43 | Ga0070707_100013518 | 3300005468 | Bacteria | 7637 |
| 44 | Ga0070707_100682768 | 3300005468 | Archaea | 990 |
| 45 | Ga0070684_100008144 | 3300005535 | Bacteria | 8182 |
| 46 | Ga0070684_101283285 | 3300005535 | Bacteria | 689 |
| 47 | Ga0068853_100170289 | 3300005539 | Bacteria | 1970 |
| 48 | Ga0070686_100029436 | 3300005544 | Bacteria | 3342 |
| 49 | Ga0070695_101056579 | 3300005545 | Bacteria | 663 |
| 50 | Ga0070693_100371876 | 3300005547 | Bacteria | 984 |
| 51 | Ga0070665_100640422 | 3300005548 | Bacteria | 1076 |
| 52 | Ga0070665_102180504 | 3300005548 | Bacteria | 558 |
| 53 | Ga0070704_100127277 | 3300005549 | Bacteria | 1967 |
| 54 | Ga0070704_100181917 | 3300005549 | Bacteria | 1682 |
| 55 | Ga0070664_100068075 | 3300005564 | Bacteria | 3044 |
| 56 | Ga0070664_100110765 | 3300005564 | Bacteria | 2396 |
| 57 | Ga0070664_100220288 | 3300005564 | Bacteria | 1698 |
| 58 | Ga0070664_100746916 | 3300005564 | Bacteria | 913 |
| 59 | Ga0068854_100570338 | 3300005578 | Bacteria | 962 |
| 60 | Ga0068856_100127421 | 3300005614 | Bacteria | 2549 |
| 61 | Ga0068856_100211091 | 3300005614 | Bacteria | 1957 |
| 62 | Ga0070702_100014681 | 3300005615 | Bacteria | 3979 |
| 63 | Ga0070702_100015218 | 3300005615 | Bacteria | 3922 |
| 64 | Ga0070702_100016138 | 3300005615 | Bacteria | 3826 |
| 65 | Ga0070702_100067705 | 3300005615 | Bacteria | 2099 |
| 66 | Ga0070702_100272671 | 3300005615 | Bacteria | 1158 |
| 67 | Ga0068852_100038360 | 3300005616 | Bacteria | 4026 |
| 68 | Ga0068852_100162944 | 3300005616 | Bacteria | 2084 |
| 69 | Ga0068852_100422832 | 3300005616 | Bacteria | 1315 |
| 70 | Ga0068859_100751696 | 3300005617 | Bacteria | 1064 |
| 71 | Ga0068859_100762686 | 3300005617 | Bacteria | 1056 |
| 72 | Ga0068864_100029038 | 3300005618 | Bacteria | 4679 |
| 73 | Ga0068864_100248246 | 3300005618 | Bacteria | 1651 |
| 74 | Ga0068864_100333914 | 3300005618 | Bacteria | 1427 |
| 75 | Ga0068864_100421057 | 3300005618 | Bacteria | 1272 |
| 76 | Ga0068864_100866511 | 3300005618 | Bacteria | 891 |
| 77 | Ga0068866_10426412 | 3300005718 | Bacteria | 862 |
| 78 | Ga0068861_100169884 | 3300005719 | Bacteria | 1806 |
| 79 | Ga0068861_100199349 | 3300005719 | Bacteria | 1679 |
| 80 | Ga0068861_100381383 | 3300005719 | Bacteria | 1246 |
| 81 | Ga0068851_10676343 | 3300005834 | Bacteria | 634 |
| 82 | Ga0068863_100153483 | 3300005841 | Bacteria | 2204 |
| 83 | Ga0068858_101549970 | 3300005842 | Bacteria | 654 |
| 84 | Ga0068860_100140360 | 3300005843 | Bacteria | 2322 |
| 85 | Ga0068860_101358294 | 3300005843 | Bacteria | 732 |
| 86 | Ga0081455_10057996 | 3300005937 | Bacteria | 3279 |
| 87 | Ga0081538_10005554 | 3300005981 | Bacteria | 11314 |
| 88 | Ga0081539_10003039 | 3300005985 | Bacteria | 21722 |
| 89 | Ga0081539_10007462 | 3300005985 | Bacteria | 9963 |
| 90 | Ga0081539_10042680 | 3300005985 | Bacteria | 2639 |
| 91 | Ga0070717_10236849 | 3300006028 | Bacteria | 1608 |
| 92 | Ga0070717_10521705 | 3300006028 | Bacteria | 1075 |
| 93 | Ga0075365_10000294 | 3300006038 | Bacteria | 17330 |
| 94 | Ga0075365_10796946 | 3300006038 | Bacteria | 667 |
| 95 | Ga0075364_10057439 | 3300006051 | Bacteria | 2549 |
| 96 | Ga0075364_10212778 | 3300006051 | Bacteria | 1311 |
| 97 | Ga0075432_10306506 | 3300006058 | Bacteria | 661 |
| 98 | Ga0070716_100204075 | 3300006173 | Bacteria | 1316 |
| 99 | Ga0070712_100224695 | 3300006175 | Bacteria | 1488 |
| 100 | Ga0070712_100343871 | 3300006175 | Bacteria | 1219 |
| 101 | Ga0070712_100418864 | 3300006175 | Bacteria | 1109 |
| 102 | Ga0097621_101032663 | 3300006237 | Bacteria | 770 |
| 103 | Ga0097621_102148324 | 3300006237 | Bacteria | 534 |
| 104 | Ga0075428_100037162 | 3300006844 | Bacteria | 5362 |
| 105 | Ga0075428_100582373 | 3300006844 | Bacteria | 1196 |
| 106 | Ga0075430_100216142 | 3300006846 | Bacteria | 1591 |
| 107 | Ga0068865_100029787 | 3300006881 | Bacteria | 3625 |
| 108 | Ga0068865_100059741 | 3300006881 | Bacteria | 2667 |
| 109 | Ga0068865_100695133 | 3300006881 | Bacteria | 868 |
| 110 | Ga0075436_100037402 | 3300006914 | Bacteria | 3351 |
| 111 | Ga0097620_100751798 | 3300006931 | Bacteria | 1064 |
| 112 | Ga0097620_100762618 | 3300006931 | Bacteria | 1056 |
| 113 | Ga0075435_100740369 | 3300007076 | Bacteria | 855 |
| 114 | Ga0105244_10453759 | 3300009036 | Bacteria | 590 |
| 115 | Ga0105240_10195025 | 3300009093 | Bacteria | 2379 |
| 116 | Ga0111539_10352332 | 3300009094 | Bacteria | 1713 |
| 117 | Ga0111539_10609577 | 3300009094 | Bacteria | 1271 |
| 118 | Ga0111539_11567374 | 3300009094 | Bacteria | 764 |
| 119 | Ga0105245_10000802 | 3300009098 | Bacteria | 28539 |
| 120 | Ga0105245_10056623 | 3300009098 | Bacteria | 3524 |
| 121 | Ga0105245_10362720 | 3300009098 | Bacteria | 1438 |
| 122 | Ga0105245_10883172 | 3300009098 | Bacteria | 935 |
| 123 | Ga0105247_10391259 | 3300009101 | Bacteria | 988 |
| 124 | Ga0105247_10688720 | 3300009101 | Bacteria | 768 |
| 125 | Ga0114129_10325974 | 3300009147 | Bacteria | 2041 |
| 126 | Ga0114129_11226684 | 3300009147 | Bacteria | 933 |
| 127 | Ga0114129_11315774 | 3300009147 | Bacteria | 895 |
| 128 | Ga0105243_10050913 | 3300009148 | Bacteria | 3273 |
| 129 | Ga0105243_10081175 | 3300009148 | Bacteria | 2647 |
| 130 | Ga0105243_10098547 | 3300009148 | Bacteria | 2421 |
| 131 | Ga0105243_10269527 | 3300009148 | Bacteria | 1528 |
| 132 | Ga0105243_11891195 | 3300009148 | Bacteria | 629 |
| 133 | Ga0105242_10491450 | 3300009176 | Bacteria | 1165 |
| 134 | Ga0105242_10840262 | 3300009176 | Bacteria | 913 |
| 135 | Ga0105248_10260727 | 3300009177 | Bacteria | 1951 |
| 136 | Ga0105248_11103723 | 3300009177 | Bacteria | 897 |
| 137 | Ga0105249_10127241 | 3300009553 | Bacteria | 2427 |
| 138 | Ga0105249_10165695 | 3300009553 | Bacteria | 2139 |
| 139 | Ga0105249_10167843 | 3300009553 | Bacteria | 2126 |
| 140 | Ga0105249_10599231 | 3300009553 | Bacteria | 1156 |
| 141 | Ga0105249_10632779 | 3300009553 | Bacteria | 1126 |
| 142 | Ga0105239_10006437 | 3300010375 | Bacteria | 13618 |
| 143 | Ga0105239_10044466 | 3300010375 | Bacteria | 4868 |
| 144 | Ga0105239_10544864 | 3300010375 | Bacteria | 1321 |
| 145 | Ga0105246_10610272 | 3300011119 | Bacteria | 944 |
| 146 | Ga0105246_11087429 | 3300011119 | Bacteria | 729 |
| 147 | Ga0157369_11582708 | 3300013105 | Bacteria | 666 |
| 148 | Ga0157374_10002477 | 3300013296 | Bacteria | 15587 |
| 149 | Ga0157374_10005918 | 3300013296 | Bacteria | 10331 |
| 150 | Ga0157374_11058989 | 3300013296 | Bacteria | 831 |
| 151 | Ga0157378_10225855 | 3300013297 | Bacteria | 1782 |
| 152 | Ga0163162_10400169 | 3300013306 | Bacteria | 1506 |
| 153 | Ga0157372_10300751 | 3300013307 | Bacteria | 1866 |
| 154 | Ga0157372_10647559 | 3300013307 | Bacteria | 1231 |
| 155 | Ga0157375_10032753 | 3300013308 | Bacteria | 4932 |
| 156 | Ga0163163_10085338 | 3300014325 | Bacteria | 3165 |
| 157 | Ga0163163_10098920 | 3300014325 | Bacteria | 2938 |
| 158 | Ga0163163_10299164 | 3300014325 | Bacteria | 1661 |
| 159 | Ga0163163_10317491 | 3300014325 | Bacteria | 1611 |
| 160 | Ga0157380_11007257 | 3300014326 | Bacteria | 867 |
| 161 | Ga0182008_10179621 | 3300014497 | Bacteria | 1070 |
| 162 | Ga0182008_10249286 | 3300014497 | Bacteria | 916 |
| 163 | Ga0157377_10207874 | 3300014745 | Bacteria | 1246 |
| 164 | Ga0157379_10343728 | 3300014968 | Bacteria | 1365 |
| 165 | Ga0157379_10736625 | 3300014968 | Bacteria | 927 |
| 166 | Ga0157376_10390180 | 3300014969 | Bacteria | 1343 |
| 167 | Ga0157376_12132805 | 3300014969 | Bacteria | 599 |
| 168 | Ga0163161_10045227 | 3300017792 | Bacteria | 3174 |
| 169 | Ga0206353_11229392 | 3300020082 | Bacteria | 886 |
| 170 | Ga0213875_10002283 | 3300021388 | Bacteria | 11621 |
| 171 | Ga0207692_10047094 | 3300025898 | Bacteria | 2164 |
| 172 | Ga0207642_10007922 | 3300025899 | Bacteria | 3614 |
| 173 | Ga0207642_10214194 | 3300025899 | Bacteria | 1072 |
| 174 | Ga0207710_10257950 | 3300025900 | Bacteria | 873 |
| 175 | Ga0207710_10352599 | 3300025900 | Bacteria | 750 |
| 176 | Ga0207688_10000308 | 3300025901 | Bacteria | 22493 |
| 177 | Ga0207688_10021015 | 3300025901 | Bacteria | 3564 |
| 178 | Ga0207688_10136190 | 3300025901 | Bacteria | 1442 |
| 179 | Ga0207705_10079098 | 3300025909 | Bacteria | 2394 |
| 180 | Ga0207705_10583198 | 3300025909 | Bacteria | 869 |
| 181 | Ga0207693_10292334 | 3300025915 | Bacteria | 1277 |
| 182 | Ga0207693_10468058 | 3300025915 | Bacteria | 984 |
| 183 | Ga0207693_10953059 | 3300025915 | Bacteria | 657 |
| 184 | Ga0207693_10989011 | 3300025915 | Bacteria | 643 |
| 185 | Ga0207663_10176103 | 3300025916 | Bacteria | 1523 |
| 186 | Ga0207663_10209667 | 3300025916 | Bacteria | 1411 |
| 187 | Ga0207662_10026273 | 3300025918 | Bacteria | 3357 |
| 188 | Ga0207662_10071884 | 3300025918 | Bacteria | 2095 |
| 189 | Ga0207662_10264278 | 3300025918 | Bacteria | 1134 |
| 190 | Ga0207657_10034610 | 3300025919 | Bacteria | 4540 |
| 191 | Ga0207657_10119214 | 3300025919 | Bacteria | 2172 |
| 192 | Ga0207657_10215103 | 3300025919 | Bacteria | 1541 |
| 193 | Ga0207657_10668227 | 3300025919 | Bacteria | 808 |
| 194 | Ga0207646_10511265 | 3300025922 | Bacteria | 1082 |
| 195 | Ga0207681_11065672 | 3300025923 | Bacteria | 679 |
| 196 | Ga0207694_10473207 | 3300025924 | Bacteria | 1047 |
| 197 | Ga0207650_10086695 | 3300025925 | Bacteria | 2384 |
| 198 | Ga0207650_10796224 | 3300025925 | Bacteria | 801 |
| 199 | Ga0207659_10056643 | 3300025926 | Bacteria | 2808 |
| 200 | Ga0207687_10006451 | 3300025927 | Bacteria | 7749 |
| 201 | Ga0207687_10104866 | 3300025927 | Bacteria | 2088 |
| 202 | Ga0207687_10115340 | 3300025927 | Bacteria | 2001 |
| 203 | Ga0207687_10129015 | 3300025927 | Bacteria | 1903 |
| 204 | Ga0207700_10220915 | 3300025928 | Bacteria | 1606 |
| 205 | Ga0207644_10484425 | 3300025931 | Bacteria | 1019 |
| 206 | Ga0207644_10710486 | 3300025931 | Bacteria | 838 |
| 207 | Ga0207690_10282544 | 3300025932 | Bacteria | 1293 |
| 208 | Ga0207706_10008975 | 3300025933 | Bacteria | 9203 |
| 209 | Ga0207706_10975464 | 3300025933 | Bacteria | 713 |
| 210 | Ga0207686_10366596 | 3300025934 | Bacteria | 1089 |
| 211 | Ga0207709_10056112 | 3300025935 | Bacteria | 2436 |
| 212 | Ga0207709_10067829 | 3300025935 | Bacteria | 2253 |
| 213 | Ga0207709_10079374 | 3300025935 | Bacteria | 2110 |
| 214 | Ga0207709_10171881 | 3300025935 | Bacteria | 1522 |
| 215 | Ga0207670_10052758 | 3300025936 | Bacteria | 2735 |
| 216 | Ga0207669_10075612 | 3300025937 | Bacteria | 2135 |
| 217 | Ga0207704_10660184 | 3300025938 | Bacteria | 862 |
| 218 | Ga0207704_11117205 | 3300025938 | Bacteria | 670 |
| 219 | Ga0207704_11165449 | 3300025938 | Bacteria | 656 |
| 220 | Ga0207704_11782214 | 3300025938 | Bacteria | 529 |
| 221 | Ga0207665_10088918 | 3300025939 | Bacteria | 2138 |
| 222 | Ga0207665_10121063 | 3300025939 | Bacteria | 1849 |
| 223 | Ga0207665_10182870 | 3300025939 | Bacteria | 1519 |
| 224 | Ga0207711_10601478 | 3300025941 | Bacteria | 1026 |
| 225 | Ga0207711_10611464 | 3300025941 | Bacteria | 1017 |
| 226 | Ga0207711_10658937 | 3300025941 | Bacteria | 976 |
| 227 | Ga0207711_10785210 | 3300025941 | Bacteria | 887 |
| 228 | Ga0207689_10100273 | 3300025942 | Bacteria | 2379 |
| 229 | Ga0207689_10132567 | 3300025942 | Bacteria | 2051 |
| 230 | Ga0207661_10001202 | 3300025944 | Bacteria | 17324 |
| 231 | Ga0207661_10004007 | 3300025944 | Bacteria | 10294 |
| 232 | Ga0207661_10322667 | 3300025944 | Bacteria | 1389 |
| 233 | Ga0207679_10097176 | 3300025945 | Bacteria | 2293 |
| 234 | Ga0207679_10106435 | 3300025945 | Bacteria | 2205 |
| 235 | Ga0207679_10237412 | 3300025945 | Bacteria | 1543 |
| 236 | Ga0207679_10403165 | 3300025945 | Bacteria | 1203 |
| 237 | Ga0207651_10228762 | 3300025960 | Bacteria | 1508 |
| 238 | Ga0207651_10294246 | 3300025960 | Bacteria | 1348 |
| 239 | Ga0207712_10100411 | 3300025961 | Bacteria | 2150 |
| 240 | Ga0207712_10664456 | 3300025961 | Bacteria | 907 |
| 241 | Ga0207668_10330397 | 3300025972 | Bacteria | 1268 |
| 242 | Ga0207640_10703459 | 3300025981 | Bacteria | 867 |
| 243 | Ga0207677_10001707 | 3300026023 | Bacteria | 11608 |
| 244 | Ga0207677_10008831 | 3300026023 | Bacteria | 5647 |
| 245 | Ga0207677_10113649 | 3300026023 | Bacteria | 2021 |
| 246 | Ga0207677_11101856 | 3300026023 | Bacteria | 724 |
| 247 | Ga0207677_11382962 | 3300026023 | Bacteria | 648 |
| 248 | Ga0207703_10100574 | 3300026035 | Bacteria | 2450 |
| 249 | Ga0207703_10847256 | 3300026035 | Bacteria | 874 |
| 250 | Ga0207678_10018333 | 3300026067 | Bacteria | 6148 |
| 251 | Ga0207678_10159622 | 3300026067 | Bacteria | 1926 |
| 252 | Ga0207708_10016330 | 3300026075 | Bacteria | 5580 |
| 253 | Ga0207708_10095468 | 3300026075 | Bacteria | 2296 |
| 254 | Ga0207708_10500254 | 3300026075 | Bacteria | 1019 |
| 255 | Ga0207708_10633469 | 3300026075 | Bacteria | 909 |
| 256 | Ga0207708_10877412 | 3300026075 | Bacteria | 775 |
| 257 | Ga0207702_10041624 | 3300026078 | Bacteria | 3853 |
| 258 | Ga0207702_10135822 | 3300026078 | Bacteria | 2219 |
| 259 | Ga0207702_11319315 | 3300026078 | Bacteria | 716 |
| 260 | Ga0207676_10225571 | 3300026095 | Bacteria | 1672 |
| 261 | Ga0207676_11328322 | 3300026095 | Bacteria | 714 |
| 262 | Ga0207675_100010551 | 3300026118 | Bacteria | 8655 |
| 263 | Ga0207675_100047006 | 3300026118 | Bacteria | 4031 |
| 264 | Ga0207675_100349805 | 3300026118 | Bacteria | 1448 |
| 265 | Ga0207698_10020107 | 3300026142 | Bacteria | 4589 |
| 266 | Ga0207698_10314853 | 3300026142 | Bacteria | 1463 |
| 267 | Ga0207698_10498178 | 3300026142 | Bacteria | 1185 |
| 268 | Ga0207698_11059187 | 3300026142 | Bacteria | 823 |
| 269 | Ga0268266_10150638 | 3300028379 | Bacteria | 2096 |
| 270 | Ga0268265_10084918 | 3300028380 | Bacteria | 2511 |
| 271 | Ga0268264_10153735 | 3300028381 | Bacteria | 2065 |
| 272 | Ga0268264_10199318 | 3300028381 | Bacteria | 1830 |
| 273 | Ga0268264_10308735 | 3300028381 | Bacteria | 1492 |
| 274 | Ga0307408_100173201 | 3300031548 | Bacteria | 1725 |
| 275 | Ga0307413_10203022 | 3300031824 | Bacteria | 1433 |
| 276 | Ga0307410_10025512 | 3300031852 | Bacteria | 3710 |
| 277 | Ga0307410_10546038 | 3300031852 | Bacteria | 960 |
| 278 | Ga0307406_10182320 | 3300031901 | Bacteria | 1530 |
| 279 | Ga0307407_10081919 | 3300031903 | Bacteria | 1954 |
| 280 | Ga0307412_10090417 | 3300031911 | Bacteria | 2140 |
| 281 | Ga0307409_100007135 | 3300031995 | Bacteria | 6656 |
| 282 | Ga0307409_100210430 | 3300031995 | Bacteria | 1747 |
| 283 | Ga0307409_100211144 | 3300031995 | Bacteria | 1745 |
| 284 | Ga0307409_100253952 | 3300031995 | Bacteria | 1609 |
| 285 | Ga0307416_100005359 | 3300032002 | Bacteria | 7872 |
| 286 | Ga0307416_100496035 | 3300032002 | Bacteria | 1284 |
| 287 | Ga0307416_100561087 | 3300032002 | Bacteria | 1217 |
| 288 | Ga0307416_100876501 | 3300032002 | Bacteria | 997 |
| 289 | Ga0307414_10920808 | 3300032004 | Bacteria | 802 |
| 290 | Ga0307414_11090821 | 3300032004 | Bacteria | 737 |
| 291 | Ga0307415_100173713 | 3300032126 | Bacteria | 1683 |
| 292 | Ga0373938_0107594 | 3300034957 | Bacteria | 707 |
| 293 | Ga0373954_0596424 | 3300035118 | Bacteria | 548 |
| 294 | Ga0373957_0165746 | 3300035120 | Bacteria | 912 |
| 295 | Ga0373937_0264774 | 3300036401 | Bacteria | 1621 |
| 296 | Ga0395900_0817513 | 3300037418 | Bacteria | 859 |
| 297 | Ga0395898_0553169 | 3300037466 | Bacteria | 1093 |
| 298 | Ga0436364_1345153 | 3300037853 | Bacteria | 31795 |
| 299 | Ga0436363_0240307 | 3300039450 | Bacteria | 914 |
| 300 | Ga0436363_1657134 | 3300039450 | Bacteria | 698 |
| 301 | Ga0451839_0598573 | 3300041496 | Bacteria | 1793 |
| 302 | Ga0451839_1431220 | 3300041496 | Bacteria | 777 |
| 303 | Ga0451845_0854746 | 3300041501 | Bacteria | 827 |
| 304 | Ga0466965_0087547 | 3300044683 | Bacteria | 1581 |
| 305 | Ga0466963_0037331 | 3300044694 | Bacteria | 3171 |
| 306 | Ga0466963_0443847 | 3300044694 | Bacteria | 915 |
| 307 | Ga0466963_0534190 | 3300044694 | Bacteria | 828 |
| 308 | Ga0466963_0912106 | 3300044694 | Bacteria | 619 |
| 309 | Ga0466964_0367318 | 3300044706 | Bacteria | 744 |
| 310 | Ga0466971_0242631 | 3300044719 | Bacteria | 857 |
| 311 | Ga0466971_0513519 | 3300044719 | Bacteria | 592 |
| 312 | Ga0466957_0657296 | 3300044842 | Bacteria | 737 |
| 313 | Ga0466960_0241593 | 3300044901 | Bacteria | 1000 |
| 314 | Ga0466958_0164952 | 3300045836 | Bacteria | 1401 |
| 315 | Ga0466958_0240125 | 3300045836 | Bacteria | 1158 |
| 316 | Ga0466967_0009164 | 3300045976 | Bacteria | 7323 |
| 317 | Ga0466967_0014580 | 3300045976 | Bacteria | 6129 |
| 318 | Ga0466967_0061597 | 3300045976 | Bacteria | 3329 |
| 319 | Ga0466967_0071996 | 3300045976 | Bacteria | 3096 |
| 320 | Ga0466967_0107841 | 3300045976 | Bacteria | 2555 |
| 321 | Ga0466967_0185361 | 3300045976 | Bacteria | 1965 |
| 322 | Ga0466967_0462404 | 3300045976 | Bacteria | 1241 |
| 323 | Ga0466967_0473122 | 3300045976 | Bacteria | 1227 |
| 324 | Ga0466967_0637906 | 3300045976 | Bacteria | 1053 |
| 325 | Ga0466967_0802513 | 3300045976 | Bacteria | 935 |
| 326 | Ga0466967_1214494 | 3300045976 | Bacteria | 751 |
| 327 | Ga0466967_1408054 | 3300045976 | Bacteria | 694 |
| 328 | Ga0495592_0082922 | 3300046454 | Bacteria | 2316 |
| 329 | Ga0495641_0115583 | 3300046461 | Unclassified | 1197 |
| 330 | Ga0495651_0252892 | 3300046462 | Bacteria | 1202 |
| 331 | Ga0495651_1012643 | 3300046462 | Bacteria | 504 |
| 332 | Ga0495653_0365946 | 3300046463 | Bacteria | 924 |
| 333 | Ga0495664_0786530 | 3300046477 | Bacteria | 560 |
| 334 | Ga0495608_0000423 | 3300046511 | Bacteria | 29473 |
| 335 | Ga0495618_0183308 | 3300046514 | Bacteria | 1330 |
| 336 | Ga0495628_0614784 | 3300046516 | Bacteria | 775 |
| 337 | Ga0495630_1488819 | 3300046517 | Bacteria | 508 |
| 338 | Ga0495643_0228466 | 3300046522 | Bacteria | 879 |
| 339 | Ga0495652_0376978 | 3300046529 | Bacteria | 1010 |
| 340 | Ga0495665_0567721 | 3300046531 | Bacteria | 569 |
| 341 | Ga0495587_0002896 | 3300046536 | Bacteria | 11489 |
| 342 | Ga0495587_0158501 | 3300046536 | Bacteria | 1289 |
| 343 | Ga0495667_0049315 | 3300046559 | Bacteria | 2779 |
| 344 | Ga0495667_0631843 | 3300046559 | Bacteria | 666 |
| 345 | Ga0495635_0183136 | 3300046663 | Bacteria | 1423 |
| 346 | Ga0495588_0013117 | 3300046674 | Bacteria | 3940 |
| 347 | Ga0495657_0155095 | 3300046675 | Bacteria | 1420 |
| 348 | Ga0495657_0304714 | 3300046675 | Bacteria | 949 |
| 349 | Ga0495646_0097970 | 3300046680 | Bacteria | 1684 |
| 350 | Ga0495646_0520471 | 3300046680 | Bacteria | 610 |
| 351 | Ga0495658_0302139 | 3300046683 | Bacteria | 1012 |
| 352 | Ga0495613_0100856 | 3300046689 | Bacteria | 2085 |
| 353 | Ga0495604_0268485 | 3300047317 | Bacteria | 1157 |
| 354 | Ga0495674_0261412 | 3300047319 | Bacteria | 1422 |
| 355 | Ga0495674_0552092 | 3300047319 | Bacteria | 917 |
| 356 | Ga0495675_0056878 | 3300047444 | Bacteria | 2480 |
| 357 | Ga0495602_0413398 | 3300048088 | Bacteria | 959 |
| 358 | Ga0495614_0328687 | 3300048089 | Bacteria | 710 |
| 359 | Ga0496100_0003617 | 3300048903 | Bacteria | 8072 |
| 360 | Ga0496100_0218256 | 3300048903 | Bacteria | 1398 |
| 361 | Ga0496101_0117876 | 3300048904 | Bacteria | 2005 |
| 362 | Ga0496101_0416017 | 3300048904 | Bacteria | 1059 |
| 363 | Ga0496101_0780801 | 3300048904 | Bacteria | 753 |
| 364 | Ga0496102_0010224 | 3300048905 | Bacteria | 8067 |
| 365 | Ga0496102_0015396 | 3300048905 | Bacteria | 6662 |
| 366 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 367 | Ga0496103_0099813 | 3300048906 | Bacteria | 1837 |
| 368 | Ga0496103_0123140 | 3300048906 | Bacteria | 1653 |
| 369 | Ga0496104_0064352 | 3300048907 | Bacteria | 3479 |
| 370 | Ga0496104_1266755 | 3300048907 | Bacteria | 640 |
| 371 | Ga0496105_0039774 | 3300048908 | Bacteria | 3877 |
| 372 | Ga0496105_0085954 | 3300048908 | Bacteria | 2599 |
| 373 | Ga0496105_0328529 | 3300048908 | Bacteria | 1224 |
| 374 | Ga0496105_0729600 | 3300048908 | Bacteria | 758 |
| 375 | Ga0496106_0049579 | 3300048909 | Bacteria | 3163 |
| 376 | Ga0496106_0055651 | 3300048909 | Bacteria | 2990 |
| 377 | Ga0496106_0087104 | 3300048909 | Bacteria | 2406 |
| 378 | Ga0496106_0091044 | 3300048909 | Bacteria | 2354 |
| 379 | Ga0496106_0546528 | 3300048909 | Bacteria | 929 |
| 380 | Ga0496106_0853439 | 3300048909 | Bacteria | 721 |
| 381 | Ga0496107_0038644 | 3300048910 | Bacteria | 3423 |
| 382 | Ga0496107_0065912 | 3300048910 | Bacteria | 2625 |
| 383 | Ga0496107_0207267 | 3300048910 | Bacteria | 1457 |
| 384 | Ga0496107_1304268 | 3300048910 | Bacteria | 519 |
| 385 | Ga0496108_0002908 | 3300048911 | Bacteria | 13761 |
| 386 | Ga0496108_0006262 | 3300048911 | Bacteria | 9641 |
| 387 | Ga0496108_0064860 | 3300048911 | Bacteria | 3077 |
| 388 | Ga0496108_1010094 | 3300048911 | Bacteria | 710 |
| 389 | Ga0496109_0004213 | 3300048912 | Bacteria | 11998 |
| 390 | Ga0496109_0055905 | 3300048912 | Bacteria | 3600 |
| 391 | Ga0496109_0213965 | 3300048912 | Bacteria | 1812 |
| 392 | Ga0496109_0292512 | 3300048912 | Bacteria | 1536 |
| 393 | Ga0496109_0415928 | 3300048912 | Bacteria | 1270 |
| 394 | Ga0496109_0671634 | 3300048912 | Bacteria | 973 |
| 395 | Ga0496109_0777695 | 3300048912 | Bacteria | 895 |
| 396 | Ga0496110_0003133 | 3300048913 | Bacteria | 12562 |
| 397 | Ga0496110_0030581 | 3300048913 | Bacteria | 4642 |
| 398 | Ga0496110_0176236 | 3300048913 | Bacteria | 1940 |
| 399 | Ga0496110_0213156 | 3300048913 | Bacteria | 1756 |
| 400 | Ga0496110_0817081 | 3300048913 | Bacteria | 837 |
| 401 | Ga0496110_1906619 | 3300048913 | Bacteria | 504 |
| 402 | Ga0496111_0001519 | 3300048914 | Bacteria | 13304 |
| 403 | Ga0496111_0024701 | 3300048914 | Bacteria | 4236 |
| 404 | Ga0496111_0322594 | 3300048914 | Bacteria | 1144 |
| 405 | Ga0496111_0420171 | 3300048914 | Bacteria | 988 |
| 406 | Ga0496111_0683291 | 3300048914 | Bacteria | 747 |
| 407 | Ga0496111_0890914 | 3300048914 | Bacteria | 641 |
| 408 | Ga0496112_0011959 | 3300048915 | Bacteria | 7954 |
| 409 | Ga0496112_0069673 | 3300048915 | Bacteria | 3474 |
| 410 | Ga0496112_0112813 | 3300048915 | Bacteria | 2689 |
| 411 | Ga0496112_0121824 | 3300048915 | Bacteria | 2578 |
| 412 | Ga0496112_0189364 | 3300048915 | Bacteria | 2020 |
| 413 | Ga0496112_0338732 | 3300048915 | Bacteria | 1448 |
| 414 | Ga0496112_0473658 | 3300048915 | Bacteria | 1189 |
| 415 | Ga0496112_0873952 | 3300048915 | Bacteria | 822 |
| 416 | Ga0496113_0002360 | 3300048916 | Bacteria | 10934 |
| 417 | Ga0496113_0196741 | 3300048916 | Bacteria | 1601 |
| 418 | Ga0496113_0369535 | 3300048916 | Bacteria | 1151 |
| 419 | Ga0496113_0577235 | 3300048916 | Bacteria | 901 |
| 420 | Ga0496114_0000056 | 3300048917 | Bacteria | 95692 |
| 421 | Ga0496114_0062066 | 3300048917 | Bacteria | 3127 |
| 422 | Ga0496114_0087671 | 3300048917 | Bacteria | 2639 |
| 423 | Ga0496114_0278920 | 3300048917 | Bacteria | 1473 |
| 424 | Ga0496114_0287508 | 3300048917 | Bacteria | 1450 |
| 425 | Ga0496114_0704942 | 3300048917 | Bacteria | 885 |
| 426 | Ga0496115_0001143 | 3300048918 | Bacteria | 19150 |
| 427 | Ga0496115_0049890 | 3300048918 | Bacteria | 3351 |
| 428 | Ga0496115_0179033 | 3300048918 | Bacteria | 1753 |
| 429 | Ga0496115_0463506 | 3300048918 | Bacteria | 1022 |
| 430 | Ga0496121_0022605 | 3300048924 | Bacteria | 6091 |
| 431 | Ga0501031_0088898 | 3300049568 | Bacteria | 2014 |
| 432 | Ga0501036_0068718 | 3300049572 | Bacteria | 2998 |
| 433 | Ga0501039_0020152 | 3300049575 | Bacteria | 5113 |
| 434 | Ga0501042_0018781 | 3300049578 | Bacteria | 4791 |
| 435 | Ga0501042_0289467 | 3300049578 | Bacteria | 1183 |
| 436 | Ga0501046_0178598 | 3300049580 | Bacteria | 1589 |
| 437 | Ga0501047_0051986 | 3300049581 | Bacteria | 3960 |
| 438 | Ga0501070_0173201 | 3300049586 | Bacteria | 1777 |
| 439 | Ga0501072_0031388 | 3300049588 | Bacteria | 4159 |
| 440 | Ga0501072_1396458 | 3300049588 | Bacteria | 542 |
| 441 | Ga0501074_0272096 | 3300049590 | Bacteria | 1204 |
| 442 | Ga0501080_0828894 | 3300049742 | Bacteria | 810 |
| 443 | Ga0501035_0741458 | 3300049822 | Bacteria | 789 |
| 444 | Ga0501035_0965328 | 3300049822 | Bacteria | 672 |
| 445 | Ga0501045_1005307 | 3300049824 | Bacteria | 611 |
| 446 | nmdc:mga00v17_290014_c1 | 3300050491 | Bacteria | 1062 |
| 447 | nmdc:mga0yw44_65833_c1 | 3300050492 | Bacteria | 2235 |
| 448 | nmdc:mga0qj67_321816_c1 | 3300050509 | Bacteria | 1252 |
| 449 | nmdc:mga06r32_58807_c1 | 3300050510 | Bacteria | 3695 |
| 450 | nmdc:mga08y16_1037373_c1 | 3300050511 | Bacteria | 798 |
| 451 | nmdc:mga08y16_1264269_c1 | 3300050511 | Bacteria | 706 |
| 452 | nmdc:mga0n895_349138_c1 | 3300050512 | Bacteria | 1498 |
| 453 | nmdc:mga08x19_35217_c1 | 3300050514 | Bacteria | 3166 |
| 454 | Ga0495612_0074690 | 3300053078 | Bacteria | 1418 |
| 455 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 456 | Ga0495655_0172587 | 3300053083 | Bacteria | 693 |
| 457 | Ga0495595_0066392 | 3300053084 | Bacteria | 1698 |
| 458 | Ga0495619_0243791 | 3300053085 | Bacteria | 1245 |
| 459 | Ga0495619_0269299 | 3300053085 | Bacteria | 1180 |
| 460 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 461 | Ga0501084_0414992 | 3300054114 | Bacteria | 1138 |
| 462 | Ga0466962_0123765 | 3300061719 | Bacteria | 1249 |
| 463 | Ga0466962_0430126 | 3300061719 | Bacteria | 663 |
| 464 | Ga0466962_0552653 | 3300061719 | Bacteria | 585 |
| 465 | Ga0530510_0238267 | 3300061734 | Bacteria | 1354 |
| 466 | Ga0530510_0350488 | 3300061734 | Bacteria | 1109 |
| 467 | Ga0530510_0949314 | 3300061734 | Bacteria | 658 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100003045 | Ga0068868_1000030455 | 118 |
| 2 | 3300026023 | Ga0207677_10001707 | Ga0207677_100017079 | 118 |
| 3 | 3300005441 | Ga0070700_100086331 | Ga0070700_1000863312 | 119 |
| 4 | 3300017792 | Ga0163161_10045227 | Ga0163161_100452272 | 119 |
| 5 | 3300026075 | Ga0207708_10095468 | Ga0207708_100954682 | 119 |
| 6 | 3300049578 | Ga0501042_0018781 | Ga0501042_0018781_694_1122 | 119 |
| 7 | 3300046536 | Ga0495587_0002896 | Ga0495587_0002896_621_1037 | 120 |
| 8 | 3300006237 | Ga0097621_102148324 | Ga0097621_1021483241 | 121 |
| 9 | 3300048906 | Ga0496103_0000057 | Ga0496103_0000057_19915_20346 | 121 |
| 10 | 3300048917 | Ga0496114_0000056 | Ga0496114_0000056_87491_87928 | 121 |
| 11 | 3300048918 | Ga0496115_0001143 | Ga0496115_0001143_9485_9922 | 121 |
| 12 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_16741_17190 | 121 |
| 13 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_105411_105860 | 121 |
| 14 | 3300041496 | Ga0451839_0598573 | Ga0451839_0598573_58_489 | 123 |
| 15 | 3300046462 | Ga0495651_0252892 | Ga0495651_0252892_469_885 | 123 |
| 16 | 3300046559 | Ga0495667_0631843 | Ga0495667_0631843_94_519 | 123 |
| 17 | 3300046675 | Ga0495657_0155095 | Ga0495657_0155095_432_857 | 123 |
| 18 | 3300053085 | Ga0495619_0269299 | Ga0495619_0269299_201_617 | 123 |
| 19 | 3300046683 | Ga0495658_0302139 | Ga0495658_0302139_129_545 | 124 |
| 20 | 3300046680 | Ga0495646_0520471 | Ga0495646_0520471_148_537 | 125 |
| 21 | 3300005329 | Ga0070683_100010491 | Ga0070683_1000104917 | 126 |
| 22 | 3300006844 | Ga0075428_100037162 | Ga0075428_1000371624 | 126 |
| 23 | 3300006846 | Ga0075430_100216142 | Ga0075430_1002161421 | 126 |
| 24 | 3300025944 | Ga0207661_10001202 | Ga0207661_1000120215 | 126 |
| 25 | 3300031911 | Ga0307412_10090417 | Ga0307412_100904172 | 126 |
| 26 | 3300045976 | Ga0466967_0473122 | Ga0466967_0473122_429_809 | 126 |
| 27 | 3300050509 | nmdc:mga0qj67_321816_c1 | nmdc:mga0qj67_321816_c1_259_639 | 126 |
| 28 | 3300050510 | nmdc:mga06r32_58807_c1 | nmdc:mga06r32_58807_c1_3281_3661 | 126 |
| 29 | 3300011119 | Ga0105246_11087429 | Ga0105246_110874291 | 127 |
| 30 | 3300014745 | Ga0157377_10207874 | Ga0157377_102078742 | 127 |
| 31 | 3300039450 | Ga0436363_0240307 | Ga0436363_0240307_137_520 | 127 |
| 32 | 3300041501 | Ga0451845_0854746 | Ga0451845_0854746_159_593 | 127 |
| 33 | 3300044683 | Ga0466965_0087547 | Ga0466965_0087547_439_822 | 127 |
| 34 | 3300044694 | Ga0466963_0037331 | Ga0466963_0037331_2610_2993 | 127 |
| 35 | 3300044694 | Ga0466963_0534190 | Ga0466963_0534190_84_467 | 127 |
| 36 | 3300045836 | Ga0466958_0240125 | Ga0466958_0240125_751_1134 | 127 |
| 37 | 3300045976 | Ga0466967_0071996 | Ga0466967_0071996_1311_1694 | 127 |
| 38 | 3300045976 | Ga0466967_0462404 | Ga0466967_0462404_475_858 | 127 |
| 39 | 3300049568 | Ga0501031_0088898 | Ga0501031_0088898_354_737 | 127 |
| 40 | 3300049572 | Ga0501036_0068718 | Ga0501036_0068718_1446_1829 | 127 |
| 41 | 3300049575 | Ga0501039_0020152 | Ga0501039_0020152_1765_2148 | 127 |
| 42 | 3300049578 | Ga0501042_0289467 | Ga0501042_0289467_304_687 | 127 |
| 43 | 3300049580 | Ga0501046_0178598 | Ga0501046_0178598_407_790 | 127 |
| 44 | 3300049588 | Ga0501072_0031388 | Ga0501072_0031388_1120_1503 | 127 |
| 45 | 3300049590 | Ga0501074_0272096 | Ga0501074_0272096_565_948 | 127 |
| 46 | 3300049742 | Ga0501080_0828894 | Ga0501080_0828894_134_517 | 127 |
| 47 | 3300049822 | Ga0501035_0965328 | Ga0501035_0965328_39_422 | 127 |
| 48 | 3300054114 | Ga0501084_0414992 | Ga0501084_0414992_446_829 | 127 |
| 49 | 3300061719 | Ga0466962_0552653 | Ga0466962_0552653_179_562 | 127 |
| 50 | 3300061734 | Ga0530510_0238267 | Ga0530510_0238267_569_952 | 127 |
| 51 | 3300061734 | Ga0530510_0350488 | Ga0530510_0350488_185_568 | 127 |
| 52 | 3300005329 | Ga0070683_100625615 | Ga0070683_1006256151 | 131 |
| 53 | 3300005545 | Ga0070695_101056579 | Ga0070695_1010565791 | 131 |
| 54 | 3300005549 | Ga0070704_100181917 | Ga0070704_1001819173 | 131 |
| 55 | 3300005937 | Ga0081455_10057996 | Ga0081455_100579963 | 131 |
| 56 | 3300005981 | Ga0081538_10005554 | Ga0081538_100055547 | 131 |
| 57 | 3300005985 | Ga0081539_10042680 | Ga0081539_100426802 | 131 |
| 58 | 3300006038 | Ga0075365_10000294 | Ga0075365_1000029415 | 131 |
| 59 | 3300006038 | Ga0075365_10796946 | Ga0075365_107969462 | 131 |
| 60 | 3300006051 | Ga0075364_10057439 | Ga0075364_100574392 | 131 |
| 61 | 3300006051 | Ga0075364_10212778 | Ga0075364_102127782 | 131 |
| 62 | 3300006058 | Ga0075432_10306506 | Ga0075432_103065062 | 131 |
| 63 | 3300009093 | Ga0105240_10195025 | Ga0105240_101950252 | 131 |
| 64 | 3300009094 | Ga0111539_11567374 | Ga0111539_115673742 | 131 |
| 65 | 3300009147 | Ga0114129_10325974 | Ga0114129_103259743 | 131 |
| 66 | 3300009147 | Ga0114129_11226684 | Ga0114129_112266841 | 131 |
| 67 | 3300009148 | Ga0105243_11891195 | Ga0105243_118911952 | 131 |
| 68 | 3300009177 | Ga0105248_11103723 | Ga0105248_111037231 | 131 |
| 69 | 3300011119 | Ga0105246_10610272 | Ga0105246_106102722 | 131 |
| 70 | 3300013105 | Ga0157369_11582708 | Ga0157369_115827081 | 131 |
| 71 | 3300014325 | Ga0163163_10299164 | Ga0163163_102991642 | 131 |
| 72 | 3300014968 | Ga0157379_10736625 | Ga0157379_107366251 | 131 |
| 73 | 3300025933 | Ga0207706_10975464 | Ga0207706_109754641 | 131 |
| 74 | 3300025938 | Ga0207704_11117205 | Ga0207704_111172051 | 131 |
| 75 | 3300025941 | Ga0207711_10601478 | Ga0207711_106014781 | 131 |
| 76 | 3300025941 | Ga0207711_10611464 | Ga0207711_106114642 | 131 |
| 77 | 3300026075 | Ga0207708_10633469 | Ga0207708_106334691 | 131 |
| 78 | 3300026075 | Ga0207708_10877412 | Ga0207708_108774121 | 131 |
| 79 | 3300031548 | Ga0307408_100173201 | Ga0307408_1001732012 | 131 |
| 80 | 3300031901 | Ga0307406_10182320 | Ga0307406_101823202 | 131 |
| 81 | 3300031995 | Ga0307409_100210430 | Ga0307409_1002104301 | 131 |
| 82 | 3300031995 | Ga0307409_100211144 | Ga0307409_1002111443 | 131 |
| 83 | 3300031995 | Ga0307409_100253952 | Ga0307409_1002539521 | 131 |
| 84 | 3300032002 | Ga0307416_100496035 | Ga0307416_1004960352 | 131 |
| 85 | 3300032004 | Ga0307414_11090821 | Ga0307414_110908212 | 131 |
| 86 | 3300037418 | Ga0395900_0817513 | Ga0395900_0817513_98_514 | 131 |
| 87 | 3300037466 | Ga0395898_0553169 | Ga0395898_0553169_640_1056 | 131 |
| 88 | 3300044694 | Ga0466963_0912106 | Ga0466963_0912106_169_585 | 131 |
| 89 | 3300044706 | Ga0466964_0367318 | Ga0466964_0367318_109_525 | 131 |
| 90 | 3300045976 | Ga0466967_0185361 | Ga0466967_0185361_1495_1911 | 131 |
| 91 | 3300045976 | Ga0466967_0802513 | Ga0466967_0802513_86_502 | 131 |
| 92 | 3300045976 | Ga0466967_1214494 | Ga0466967_1214494_184_588 | 131 |
| 93 | 3300046461 | Ga0495641_0115583 | Ga0495641_0115583_146_562 | 131 |
| 94 | 3300046511 | Ga0495608_0000423 | Ga0495608_0000423_8658_9053 | 131 |
| 95 | 3300046517 | Ga0495630_1488819 | Ga0495630_1488819_103_498 | 131 |
| 96 | 3300046674 | Ga0495588_0013117 | Ga0495588_0013117_1434_1850 | 131 |
| 97 | 3300048089 | Ga0495614_0328687 | Ga0495614_0328687_167_583 | 131 |
| 98 | 3300048903 | Ga0496100_0003617 | Ga0496100_0003617_5626_6042 | 131 |
| 99 | 3300048912 | Ga0496109_0415928 | Ga0496109_0415928_116_532 | 131 |
| 100 | 3300048912 | Ga0496109_0671634 | Ga0496109_0671634_503_919 | 131 |
| 101 | 3300048913 | Ga0496110_1906619 | Ga0496110_1906619_27_443 | 131 |
| 102 | 3300048914 | Ga0496111_0322594 | Ga0496111_0322594_206_622 | 131 |
| 103 | 3300048915 | Ga0496112_0338732 | Ga0496112_0338732_108_524 | 131 |
| 104 | 3300048916 | Ga0496113_0369535 | Ga0496113_0369535_247_663 | 131 |
| 105 | 3300048917 | Ga0496114_0704942 | Ga0496114_0704942_188_604 | 131 |
| 106 | 3300049581 | Ga0501047_0051986 | Ga0501047_0051986_2386_2802 | 131 |
| 107 | 3300049586 | Ga0501070_0173201 | Ga0501070_0173201_654_1049 | 131 |
| 108 | 3300049588 | Ga0501072_1396458 | Ga0501072_1396458_84_500 | 131 |
| 109 | 3300049822 | Ga0501035_0741458 | Ga0501035_0741458_37_453 | 131 |
| 110 | 3300050491 | nmdc:mga00v17_290014_c1 | nmdc:mga00v17_290014_c1_611_1027 | 131 |
| 111 | 3300050492 | nmdc:mga0yw44_65833_c1 | nmdc:mga0yw44_65833_c1_822_1238 | 131 |
| 112 | 3300053083 | Ga0495655_0172587 | Ga0495655_0172587_119_541 | 131 |
| 113 | 3300061719 | Ga0466962_0123765 | Ga0466962_0123765_625_1041 | 131 |
| 114 | 3300003203 | JGI25406J46586_10038080 | JGI25406J46586_100380802 | 132 |
| 115 | 3300005329 | Ga0070683_100003749 | Ga0070683_10000374911 | 132 |
| 116 | 3300005329 | Ga0070683_100714269 | Ga0070683_1007142692 | 132 |
| 117 | 3300005331 | Ga0070670_100870653 | Ga0070670_1008706532 | 132 |
| 118 | 3300005334 | Ga0068869_100079699 | Ga0068869_1000796993 | 132 |
| 119 | 3300005334 | Ga0068869_100485948 | Ga0068869_1004859482 | 132 |
| 120 | 3300005337 | Ga0070682_100010672 | Ga0070682_1000106724 | 132 |
| 121 | 3300005337 | Ga0070682_100243377 | Ga0070682_1002433772 | 132 |
| 122 | 3300005338 | Ga0068868_100002747 | Ga0068868_1000027477 | 132 |
| 123 | 3300005338 | Ga0068868_100066175 | Ga0068868_1000661753 | 132 |
| 124 | 3300005339 | Ga0070660_100053823 | Ga0070660_1000538233 | 132 |
| 125 | 3300005339 | Ga0070660_101065988 | Ga0070660_1010659881 | 132 |
| 126 | 3300005340 | Ga0070689_100262238 | Ga0070689_1002622381 | 132 |
| 127 | 3300005343 | Ga0070687_100002752 | Ga0070687_1000027524 | 132 |
| 128 | 3300005343 | Ga0070687_100246369 | Ga0070687_1002463692 | 132 |
| 129 | 3300005344 | Ga0070661_100546055 | Ga0070661_1005460551 | 132 |
| 130 | 3300005347 | Ga0070668_100171900 | Ga0070668_1001719002 | 132 |
| 131 | 3300005354 | Ga0070675_101221182 | Ga0070675_1012211821 | 132 |
| 132 | 3300005355 | Ga0070671_100309196 | Ga0070671_1003091962 | 132 |
| 133 | 3300005355 | Ga0070671_101182087 | Ga0070671_1011820872 | 132 |
| 134 | 3300005356 | Ga0070674_100055030 | Ga0070674_1000550304 | 132 |
| 135 | 3300005364 | Ga0070673_100079228 | Ga0070673_1000792283 | 132 |
| 136 | 3300005365 | Ga0070688_100018659 | Ga0070688_1000186592 | 132 |
| 137 | 3300005365 | Ga0070688_100090068 | Ga0070688_1000900682 | 132 |
| 138 | 3300005366 | Ga0070659_100064198 | Ga0070659_1000641983 | 132 |
| 139 | 3300005366 | Ga0070659_100117405 | Ga0070659_1001174053 | 132 |
| 140 | 3300005366 | Ga0070659_100760111 | Ga0070659_1007601112 | 132 |
| 141 | 3300005436 | Ga0070713_100469557 | Ga0070713_1004695572 | 132 |
| 142 | 3300005437 | Ga0070710_10070738 | Ga0070710_100707383 | 132 |
| 143 | 3300005438 | Ga0070701_10121375 | Ga0070701_101213753 | 132 |
| 144 | 3300005439 | Ga0070711_100156317 | Ga0070711_1001563172 | 132 |
| 145 | 3300005439 | Ga0070711_100228836 | Ga0070711_1002288362 | 132 |
| 146 | 3300005441 | Ga0070700_100085217 | Ga0070700_1000852172 | 132 |
| 147 | 3300005441 | Ga0070700_100207836 | Ga0070700_1002078362 | 132 |
| 148 | 3300005441 | Ga0070700_100896365 | Ga0070700_1008963651 | 132 |
| 149 | 3300005455 | Ga0070663_100202071 | Ga0070663_1002020713 | 132 |
| 150 | 3300005457 | Ga0070662_100893517 | Ga0070662_1008935172 | 132 |
| 151 | 3300005459 | Ga0068867_100933655 | Ga0068867_1009336551 | 132 |
| 152 | 3300005468 | Ga0070707_100013518 | Ga0070707_1000135184 | 132 |
| 153 | 3300005468 | Ga0070707_100682768 | Ga0070707_1006827682 | 132 |
| 154 | 3300005535 | Ga0070684_100008144 | Ga0070684_1000081445 | 132 |
| 155 | 3300005535 | Ga0070684_101283285 | Ga0070684_1012832851 | 132 |
| 156 | 3300005539 | Ga0068853_100170289 | Ga0068853_1001702893 | 132 |
| 157 | 3300005544 | Ga0070686_100029436 | Ga0070686_1000294362 | 132 |
| 158 | 3300005547 | Ga0070693_100371876 | Ga0070693_1003718762 | 132 |
| 159 | 3300005548 | Ga0070665_100640422 | Ga0070665_1006404222 | 132 |
| 160 | 3300005548 | Ga0070665_102180504 | Ga0070665_1021805041 | 132 |
| 161 | 3300005549 | Ga0070704_100127277 | Ga0070704_1001272771 | 132 |
| 162 | 3300005564 | Ga0070664_100068075 | Ga0070664_1000680753 | 132 |
| 163 | 3300005564 | Ga0070664_100110765 | Ga0070664_1001107652 | 132 |
| 164 | 3300005564 | Ga0070664_100220288 | Ga0070664_1002202882 | 132 |
| 165 | 3300005564 | Ga0070664_100746916 | Ga0070664_1007469162 | 132 |
| 166 | 3300005578 | Ga0068854_100570338 | Ga0068854_1005703382 | 132 |
| 167 | 3300005614 | Ga0068856_100127421 | Ga0068856_1001274213 | 132 |
| 168 | 3300005614 | Ga0068856_100211091 | Ga0068856_1002110912 | 132 |
| 169 | 3300005615 | Ga0070702_100014681 | Ga0070702_1000146812 | 132 |
| 170 | 3300005615 | Ga0070702_100015218 | Ga0070702_1000152183 | 132 |
| 171 | 3300005615 | Ga0070702_100016138 | Ga0070702_1000161385 | 132 |
| 172 | 3300005615 | Ga0070702_100067705 | Ga0070702_1000677052 | 132 |
| 173 | 3300005615 | Ga0070702_100272671 | Ga0070702_1002726712 | 132 |
| 174 | 3300005616 | Ga0068852_100038360 | Ga0068852_1000383601 | 132 |
| 175 | 3300005616 | Ga0068852_100162944 | Ga0068852_1001629443 | 132 |
| 176 | 3300005616 | Ga0068852_100422832 | Ga0068852_1004228322 | 132 |
| 177 | 3300005617 | Ga0068859_100751696 | Ga0068859_1007516962 | 132 |
| 178 | 3300005617 | Ga0068859_100762686 | Ga0068859_1007626862 | 132 |
| 179 | 3300005618 | Ga0068864_100029038 | Ga0068864_1000290385 | 132 |
| 180 | 3300005618 | Ga0068864_100248246 | Ga0068864_1002482462 | 132 |
| 181 | 3300005618 | Ga0068864_100333914 | Ga0068864_1003339142 | 132 |
| 182 | 3300005618 | Ga0068864_100421057 | Ga0068864_1004210572 | 132 |
| 183 | 3300005618 | Ga0068864_100866511 | Ga0068864_1008665112 | 132 |
| 184 | 3300005718 | Ga0068866_10426412 | Ga0068866_104264122 | 132 |
| 185 | 3300005719 | Ga0068861_100169884 | Ga0068861_1001698842 | 132 |
| 186 | 3300005719 | Ga0068861_100199349 | Ga0068861_1001993492 | 132 |
| 187 | 3300005719 | Ga0068861_100381383 | Ga0068861_1003813832 | 132 |
| 188 | 3300005834 | Ga0068851_10676343 | Ga0068851_106763431 | 132 |
| 189 | 3300005841 | Ga0068863_100153483 | Ga0068863_1001534833 | 132 |
| 190 | 3300005842 | Ga0068858_101549970 | Ga0068858_1015499702 | 132 |
| 191 | 3300005843 | Ga0068860_100140360 | Ga0068860_1001403603 | 132 |
| 192 | 3300005843 | Ga0068860_101358294 | Ga0068860_1013582942 | 132 |
| 193 | 3300005985 | Ga0081539_10003039 | Ga0081539_100030395 | 132 |
| 194 | 3300005985 | Ga0081539_10007462 | Ga0081539_100074624 | 132 |
| 195 | 3300006028 | Ga0070717_10236849 | Ga0070717_102368492 | 132 |
| 196 | 3300006028 | Ga0070717_10521705 | Ga0070717_105217052 | 132 |
| 197 | 3300006173 | Ga0070716_100204075 | Ga0070716_1002040752 | 132 |
| 198 | 3300006175 | Ga0070712_100224695 | Ga0070712_1002246952 | 132 |
| 199 | 3300006175 | Ga0070712_100343871 | Ga0070712_1003438712 | 132 |
| 200 | 3300006175 | Ga0070712_100418864 | Ga0070712_1004188642 | 132 |
| 201 | 3300006237 | Ga0097621_101032663 | Ga0097621_1010326632 | 132 |
| 202 | 3300006844 | Ga0075428_100582373 | Ga0075428_1005823732 | 132 |
| 203 | 3300006881 | Ga0068865_100029787 | Ga0068865_1000297874 | 132 |
| 204 | 3300006881 | Ga0068865_100059741 | Ga0068865_1000597411 | 132 |
| 205 | 3300006881 | Ga0068865_100695133 | Ga0068865_1006951332 | 132 |
| 206 | 3300006914 | Ga0075436_100037402 | Ga0075436_1000374022 | 132 |
| 207 | 3300006931 | Ga0097620_100751798 | Ga0097620_1007517982 | 132 |
| 208 | 3300006931 | Ga0097620_100762618 | Ga0097620_1007626182 | 132 |
| 209 | 3300007076 | Ga0075435_100740369 | Ga0075435_1007403692 | 132 |
| 210 | 3300009036 | Ga0105244_10453759 | Ga0105244_104537591 | 132 |
| 211 | 3300009094 | Ga0111539_10352332 | Ga0111539_103523322 | 132 |
| 212 | 3300009094 | Ga0111539_10609577 | Ga0111539_106095773 | 132 |
| 213 | 3300009098 | Ga0105245_10000802 | Ga0105245_1000080217 | 132 |
| 214 | 3300009098 | Ga0105245_10056623 | Ga0105245_100566232 | 132 |
| 215 | 3300009098 | Ga0105245_10362720 | Ga0105245_103627202 | 132 |
| 216 | 3300009098 | Ga0105245_10883172 | Ga0105245_108831722 | 132 |
| 217 | 3300009101 | Ga0105247_10391259 | Ga0105247_103912592 | 132 |
| 218 | 3300009101 | Ga0105247_10688720 | Ga0105247_106887202 | 132 |
| 219 | 3300009147 | Ga0114129_11315774 | Ga0114129_113157742 | 132 |
| 220 | 3300009148 | Ga0105243_10050913 | Ga0105243_100509133 | 132 |
| 221 | 3300009148 | Ga0105243_10081175 | Ga0105243_100811752 | 132 |
| 222 | 3300009148 | Ga0105243_10098547 | Ga0105243_100985472 | 132 |
| 223 | 3300009148 | Ga0105243_10269527 | Ga0105243_102695272 | 132 |
| 224 | 3300009176 | Ga0105242_10491450 | Ga0105242_104914502 | 132 |
| 225 | 3300009176 | Ga0105242_10840262 | Ga0105242_108402623 | 132 |
| 226 | 3300009177 | Ga0105248_10260727 | Ga0105248_102607272 | 132 |
| 227 | 3300009553 | Ga0105249_10127241 | Ga0105249_101272413 | 132 |
| 228 | 3300009553 | Ga0105249_10165695 | Ga0105249_101656953 | 132 |
| 229 | 3300009553 | Ga0105249_10167843 | Ga0105249_101678432 | 132 |
| 230 | 3300009553 | Ga0105249_10599231 | Ga0105249_105992312 | 132 |
| 231 | 3300009553 | Ga0105249_10632779 | Ga0105249_106327792 | 132 |
| 232 | 3300010375 | Ga0105239_10006437 | Ga0105239_100064373 | 132 |
| 233 | 3300010375 | Ga0105239_10044466 | Ga0105239_100444665 | 132 |
| 234 | 3300010375 | Ga0105239_10544864 | Ga0105239_105448642 | 132 |
| 235 | 3300013296 | Ga0157374_10002477 | Ga0157374_1000247712 | 132 |
| 236 | 3300013296 | Ga0157374_10005918 | Ga0157374_1000591810 | 132 |
| 237 | 3300013296 | Ga0157374_11058989 | Ga0157374_110589891 | 132 |
| 238 | 3300013297 | Ga0157378_10225855 | Ga0157378_102258551 | 132 |
| 239 | 3300013306 | Ga0163162_10400169 | Ga0163162_104001692 | 132 |
| 240 | 3300013307 | Ga0157372_10300751 | Ga0157372_103007513 | 132 |
| 241 | 3300013307 | Ga0157372_10647559 | Ga0157372_106475593 | 132 |
| 242 | 3300013308 | Ga0157375_10032753 | Ga0157375_100327536 | 132 |
| 243 | 3300014325 | Ga0163163_10085338 | Ga0163163_100853385 | 132 |
| 244 | 3300014325 | Ga0163163_10098920 | Ga0163163_100989202 | 132 |
| 245 | 3300014325 | Ga0163163_10317491 | Ga0163163_103174912 | 132 |
| 246 | 3300014326 | Ga0157380_11007257 | Ga0157380_110072571 | 132 |
| 247 | 3300014497 | Ga0182008_10179621 | Ga0182008_101796212 | 132 |
| 248 | 3300014497 | Ga0182008_10249286 | Ga0182008_102492862 | 132 |
| 249 | 3300014968 | Ga0157379_10343728 | Ga0157379_103437282 | 132 |
| 250 | 3300014969 | Ga0157376_10390180 | Ga0157376_103901801 | 132 |
| 251 | 3300014969 | Ga0157376_12132805 | Ga0157376_121328051 | 132 |
| 252 | 3300020082 | Ga0206353_11229392 | Ga0206353_112293922 | 132 |
| 253 | 3300021388 | Ga0213875_10002283 | Ga0213875_100022832 | 132 |
| 254 | 3300025898 | Ga0207692_10047094 | Ga0207692_100470943 | 132 |
| 255 | 3300025899 | Ga0207642_10007922 | Ga0207642_100079223 | 132 |
| 256 | 3300025899 | Ga0207642_10214194 | Ga0207642_102141942 | 132 |
| 257 | 3300025900 | Ga0207710_10257950 | Ga0207710_102579502 | 132 |
| 258 | 3300025900 | Ga0207710_10352599 | Ga0207710_103525992 | 132 |
| 259 | 3300025901 | Ga0207688_10000308 | Ga0207688_1000030817 | 132 |
| 260 | 3300025901 | Ga0207688_10021015 | Ga0207688_100210155 | 132 |
| 261 | 3300025901 | Ga0207688_10136190 | Ga0207688_101361902 | 132 |
| 262 | 3300025909 | Ga0207705_10079098 | Ga0207705_100790983 | 132 |
| 263 | 3300025909 | Ga0207705_10583198 | Ga0207705_105831982 | 132 |
| 264 | 3300025915 | Ga0207693_10292334 | Ga0207693_102923342 | 132 |
| 265 | 3300025915 | Ga0207693_10468058 | Ga0207693_104680582 | 132 |
| 266 | 3300025915 | Ga0207693_10953059 | Ga0207693_109530592 | 132 |
| 267 | 3300025915 | Ga0207693_10989011 | Ga0207693_109890112 | 132 |
| 268 | 3300025916 | Ga0207663_10176103 | Ga0207663_101761032 | 132 |
| 269 | 3300025916 | Ga0207663_10209667 | Ga0207663_102096672 | 132 |
| 270 | 3300025918 | Ga0207662_10026273 | Ga0207662_100262732 | 132 |
| 271 | 3300025918 | Ga0207662_10071884 | Ga0207662_100718844 | 132 |
| 272 | 3300025918 | Ga0207662_10264278 | Ga0207662_102642783 | 132 |
| 273 | 3300025919 | Ga0207657_10034610 | Ga0207657_100346104 | 132 |
| 274 | 3300025919 | Ga0207657_10119214 | Ga0207657_101192143 | 132 |
| 275 | 3300025919 | Ga0207657_10215103 | Ga0207657_102151032 | 132 |
| 276 | 3300025919 | Ga0207657_10668227 | Ga0207657_106682271 | 132 |
| 277 | 3300025922 | Ga0207646_10511265 | Ga0207646_105112652 | 132 |
| 278 | 3300025923 | Ga0207681_11065672 | Ga0207681_110656722 | 132 |
| 279 | 3300025924 | Ga0207694_10473207 | Ga0207694_104732072 | 132 |
| 280 | 3300025925 | Ga0207650_10086695 | Ga0207650_100866953 | 132 |
| 281 | 3300025925 | Ga0207650_10796224 | Ga0207650_107962242 | 132 |
| 282 | 3300025926 | Ga0207659_10056643 | Ga0207659_100566433 | 132 |
| 283 | 3300025927 | Ga0207687_10006451 | Ga0207687_100064512 | 132 |
| 284 | 3300025927 | Ga0207687_10104866 | Ga0207687_101048662 | 132 |
| 285 | 3300025927 | Ga0207687_10115340 | Ga0207687_101153404 | 132 |
| 286 | 3300025927 | Ga0207687_10129015 | Ga0207687_101290153 | 132 |
| 287 | 3300025928 | Ga0207700_10220915 | Ga0207700_102209152 | 132 |
| 288 | 3300025931 | Ga0207644_10484425 | Ga0207644_104844252 | 132 |
| 289 | 3300025931 | Ga0207644_10710486 | Ga0207644_107104862 | 132 |
| 290 | 3300025932 | Ga0207690_10282544 | Ga0207690_102825442 | 132 |
| 291 | 3300025933 | Ga0207706_10008975 | Ga0207706_100089757 | 132 |
| 292 | 3300025934 | Ga0207686_10366596 | Ga0207686_103665962 | 132 |
| 293 | 3300025935 | Ga0207709_10056112 | Ga0207709_100561122 | 132 |
| 294 | 3300025935 | Ga0207709_10067829 | Ga0207709_100678292 | 132 |
| 295 | 3300025935 | Ga0207709_10079374 | Ga0207709_100793743 | 132 |
| 296 | 3300025935 | Ga0207709_10171881 | Ga0207709_101718812 | 132 |
| 297 | 3300025936 | Ga0207670_10052758 | Ga0207670_100527582 | 132 |
| 298 | 3300025937 | Ga0207669_10075612 | Ga0207669_100756122 | 132 |
| 299 | 3300025938 | Ga0207704_10660184 | Ga0207704_106601842 | 132 |
| 300 | 3300025938 | Ga0207704_11165449 | Ga0207704_111654491 | 132 |
| 301 | 3300025938 | Ga0207704_11782214 | Ga0207704_117822141 | 132 |
| 302 | 3300025939 | Ga0207665_10088918 | Ga0207665_100889182 | 132 |
| 303 | 3300025939 | Ga0207665_10121063 | Ga0207665_101210633 | 132 |
| 304 | 3300025939 | Ga0207665_10182870 | Ga0207665_101828702 | 132 |
| 305 | 3300025941 | Ga0207711_10658937 | Ga0207711_106589372 | 132 |
| 306 | 3300025941 | Ga0207711_10785210 | Ga0207711_107852102 | 132 |
| 307 | 3300025942 | Ga0207689_10100273 | Ga0207689_101002733 | 132 |
| 308 | 3300025942 | Ga0207689_10132567 | Ga0207689_101325672 | 132 |
| 309 | 3300025944 | Ga0207661_10004007 | Ga0207661_100040079 | 132 |
| 310 | 3300025944 | Ga0207661_10322667 | Ga0207661_103226672 | 132 |
| 311 | 3300025945 | Ga0207679_10097176 | Ga0207679_100971762 | 132 |
| 312 | 3300025945 | Ga0207679_10106435 | Ga0207679_101064353 | 132 |
| 313 | 3300025945 | Ga0207679_10237412 | Ga0207679_102374122 | 132 |
| 314 | 3300025945 | Ga0207679_10403165 | Ga0207679_104031652 | 132 |
| 315 | 3300025960 | Ga0207651_10228762 | Ga0207651_102287622 | 132 |
| 316 | 3300025960 | Ga0207651_10294246 | Ga0207651_102942462 | 132 |
| 317 | 3300025961 | Ga0207712_10100411 | Ga0207712_101004112 | 132 |
| 318 | 3300025961 | Ga0207712_10664456 | Ga0207712_106644562 | 132 |
| 319 | 3300025972 | Ga0207668_10330397 | Ga0207668_103303972 | 132 |
| 320 | 3300025981 | Ga0207640_10703459 | Ga0207640_107034592 | 132 |
| 321 | 3300026023 | Ga0207677_10008831 | Ga0207677_100088316 | 132 |
| 322 | 3300026023 | Ga0207677_10113649 | Ga0207677_101136492 | 132 |
| 323 | 3300026023 | Ga0207677_11101856 | Ga0207677_111018562 | 132 |
| 324 | 3300026023 | Ga0207677_11382962 | Ga0207677_113829622 | 132 |
| 325 | 3300026035 | Ga0207703_10100574 | Ga0207703_101005742 | 132 |
| 326 | 3300026035 | Ga0207703_10847256 | Ga0207703_108472562 | 132 |
| 327 | 3300026067 | Ga0207678_10018333 | Ga0207678_100183337 | 132 |
| 328 | 3300026067 | Ga0207678_10159622 | Ga0207678_101596222 | 132 |
| 329 | 3300026075 | Ga0207708_10016330 | Ga0207708_100163305 | 132 |
| 330 | 3300026075 | Ga0207708_10500254 | Ga0207708_105002542 | 132 |
| 331 | 3300026078 | Ga0207702_10041624 | Ga0207702_100416243 | 132 |
| 332 | 3300026078 | Ga0207702_10135822 | Ga0207702_101358222 | 132 |
| 333 | 3300026078 | Ga0207702_11319315 | Ga0207702_113193152 | 132 |
| 334 | 3300026095 | Ga0207676_10225571 | Ga0207676_102255712 | 132 |
| 335 | 3300026095 | Ga0207676_11328322 | Ga0207676_113283221 | 132 |
| 336 | 3300026118 | Ga0207675_100010551 | Ga0207675_1000105517 | 132 |
| 337 | 3300026118 | Ga0207675_100047006 | Ga0207675_1000470062 | 132 |
| 338 | 3300026118 | Ga0207675_100349805 | Ga0207675_1003498052 | 132 |
| 339 | 3300026142 | Ga0207698_10020107 | Ga0207698_100201075 | 132 |
| 340 | 3300026142 | Ga0207698_10314853 | Ga0207698_103148531 | 132 |
| 341 | 3300026142 | Ga0207698_10498178 | Ga0207698_104981782 | 132 |
| 342 | 3300026142 | Ga0207698_11059187 | Ga0207698_110591872 | 132 |
| 343 | 3300028379 | Ga0268266_10150638 | Ga0268266_101506382 | 132 |
| 344 | 3300028380 | Ga0268265_10084918 | Ga0268265_100849184 | 132 |
| 345 | 3300028381 | Ga0268264_10153735 | Ga0268264_101537352 | 132 |
| 346 | 3300028381 | Ga0268264_10199318 | Ga0268264_101993182 | 132 |
| 347 | 3300028381 | Ga0268264_10308735 | Ga0268264_103087352 | 132 |
| 348 | 3300031824 | Ga0307413_10203022 | Ga0307413_102030223 | 132 |
| 349 | 3300031852 | Ga0307410_10025512 | Ga0307410_100255122 | 132 |
| 350 | 3300031852 | Ga0307410_10546038 | Ga0307410_105460382 | 132 |
| 351 | 3300031903 | Ga0307407_10081919 | Ga0307407_100819192 | 132 |
| 352 | 3300031995 | Ga0307409_100007135 | Ga0307409_1000071355 | 132 |
| 353 | 3300032002 | Ga0307416_100005359 | Ga0307416_1000053592 | 132 |
| 354 | 3300032002 | Ga0307416_100561087 | Ga0307416_1005610873 | 132 |
| 355 | 3300032002 | Ga0307416_100876501 | Ga0307416_1008765012 | 132 |
| 356 | 3300032004 | Ga0307414_10920808 | Ga0307414_109208082 | 132 |
| 357 | 3300032126 | Ga0307415_100173713 | Ga0307415_1001737132 | 132 |
| 358 | 3300034957 | Ga0373938_0107594 | Ga0373938_0107594_77_484 | 132 |
| 359 | 3300035118 | Ga0373954_0596424 | Ga0373954_0596424_96_515 | 132 |
| 360 | 3300035120 | Ga0373957_0165746 | Ga0373957_0165746_466_885 | 132 |
| 361 | 3300036401 | Ga0373937_0264774 | Ga0373937_0264774_692_1111 | 132 |
| 362 | 3300037853 | Ga0436364_1345153 | Ga0436364_1345153_30740_31159 | 132 |
| 363 | 3300039450 | Ga0436363_1657134 | Ga0436363_1657134_151_576 | 132 |
| 364 | 3300041496 | Ga0451839_1431220 | Ga0451839_1431220_165_584 | 132 |
| 365 | 3300044694 | Ga0466963_0443847 | Ga0466963_0443847_365_784 | 132 |
| 366 | 3300044719 | Ga0466971_0242631 | Ga0466971_0242631_13_432 | 132 |
| 367 | 3300044719 | Ga0466971_0513519 | Ga0466971_0513519_108_515 | 132 |
| 368 | 3300044842 | Ga0466957_0657296 | Ga0466957_0657296_274_693 | 132 |
| 369 | 3300044901 | Ga0466960_0241593 | Ga0466960_0241593_157_576 | 132 |
| 370 | 3300045836 | Ga0466958_0164952 | Ga0466958_0164952_151_585 | 132 |
| 371 | 3300045976 | Ga0466967_0009164 | Ga0466967_0009164_776_1195 | 132 |
| 372 | 3300045976 | Ga0466967_0014580 | Ga0466967_0014580_5048_5467 | 132 |
| 373 | 3300045976 | Ga0466967_0061597 | Ga0466967_0061597_2472_2891 | 132 |
| 374 | 3300045976 | Ga0466967_0107841 | Ga0466967_0107841_284_703 | 132 |
| 375 | 3300045976 | Ga0466967_0637906 | Ga0466967_0637906_53_460 | 132 |
| 376 | 3300045976 | Ga0466967_1408054 | Ga0466967_1408054_53_472 | 132 |
| 377 | 3300046454 | Ga0495592_0082922 | Ga0495592_0082922_1368_1787 | 132 |
| 378 | 3300046462 | Ga0495651_1012643 | Ga0495651_1012643_72_491 | 132 |
| 379 | 3300046463 | Ga0495653_0365946 | Ga0495653_0365946_203_622 | 132 |
| 380 | 3300046477 | Ga0495664_0786530 | Ga0495664_0786530_66_485 | 132 |
| 381 | 3300046514 | Ga0495618_0183308 | Ga0495618_0183308_545_964 | 132 |
| 382 | 3300046516 | Ga0495628_0614784 | Ga0495628_0614784_236_655 | 132 |
| 383 | 3300046522 | Ga0495643_0228466 | Ga0495643_0228466_316_735 | 132 |
| 384 | 3300046529 | Ga0495652_0376978 | Ga0495652_0376978_37_456 | 132 |
| 385 | 3300046531 | Ga0495665_0567721 | Ga0495665_0567721_24_443 | 132 |
| 386 | 3300046536 | Ga0495587_0158501 | Ga0495587_0158501_336_755 | 132 |
| 387 | 3300046559 | Ga0495667_0049315 | Ga0495667_0049315_2064_2483 | 132 |
| 388 | 3300046663 | Ga0495635_0183136 | Ga0495635_0183136_24_443 | 132 |
| 389 | 3300046675 | Ga0495657_0304714 | Ga0495657_0304714_216_635 | 132 |
| 390 | 3300046680 | Ga0495646_0097970 | Ga0495646_0097970_507_926 | 132 |
| 391 | 3300046689 | Ga0495613_0100856 | Ga0495613_0100856_1534_1953 | 132 |
| 392 | 3300047317 | Ga0495604_0268485 | Ga0495604_0268485_490_909 | 132 |
| 393 | 3300047319 | Ga0495674_0261412 | Ga0495674_0261412_687_1106 | 132 |
| 394 | 3300047319 | Ga0495674_0552092 | Ga0495674_0552092_329_748 | 132 |
| 395 | 3300047444 | Ga0495675_0056878 | Ga0495675_0056878_953_1372 | 132 |
| 396 | 3300048088 | Ga0495602_0413398 | Ga0495602_0413398_351_770 | 132 |
| 397 | 3300048903 | Ga0496100_0218256 | Ga0496100_0218256_234_653 | 132 |
| 398 | 3300048904 | Ga0496101_0117876 | Ga0496101_0117876_1142_1561 | 132 |
| 399 | 3300048904 | Ga0496101_0416017 | Ga0496101_0416017_212_619 | 132 |
| 400 | 3300048904 | Ga0496101_0780801 | Ga0496101_0780801_97_504 | 132 |
| 401 | 3300048905 | Ga0496102_0010224 | Ga0496102_0010224_761_1231 | 132 |
| 402 | 3300048905 | Ga0496102_0015396 | Ga0496102_0015396_5939_6358 | 132 |
| 403 | 3300048906 | Ga0496103_0099813 | Ga0496103_0099813_1176_1646 | 132 |
| 404 | 3300048906 | Ga0496103_0123140 | Ga0496103_0123140_754_1173 | 132 |
| 405 | 3300048907 | Ga0496104_0064352 | Ga0496104_0064352_1430_1849 | 132 |
| 406 | 3300048907 | Ga0496104_1266755 | Ga0496104_1266755_80_499 | 132 |
| 407 | 3300048908 | Ga0496105_0039774 | Ga0496105_0039774_1437_1856 | 132 |
| 408 | 3300048908 | Ga0496105_0085954 | Ga0496105_0085954_623_1093 | 132 |
| 409 | 3300048908 | Ga0496105_0328529 | Ga0496105_0328529_807_1214 | 132 |
| 410 | 3300048908 | Ga0496105_0729600 | Ga0496105_0729600_161_580 | 132 |
| 411 | 3300048909 | Ga0496106_0049579 | Ga0496106_0049579_542_961 | 132 |
| 412 | 3300048909 | Ga0496106_0055651 | Ga0496106_0055651_2456_2863 | 132 |
| 413 | 3300048909 | Ga0496106_0087104 | Ga0496106_0087104_727_1149 | 132 |
| 414 | 3300048909 | Ga0496106_0091044 | Ga0496106_0091044_1478_1948 | 132 |
| 415 | 3300048909 | Ga0496106_0546528 | Ga0496106_0546528_439_858 | 132 |
| 416 | 3300048909 | Ga0496106_0853439 | Ga0496106_0853439_267_710 | 132 |
| 417 | 3300048910 | Ga0496107_0038644 | Ga0496107_0038644_974_1393 | 132 |
| 418 | 3300048910 | Ga0496107_0065912 | Ga0496107_0065912_825_1295 | 132 |
| 419 | 3300048910 | Ga0496107_0207267 | Ga0496107_0207267_829_1248 | 132 |
| 420 | 3300048910 | Ga0496107_1304268 | Ga0496107_1304268_35_442 | 132 |
| 421 | 3300048911 | Ga0496108_0002908 | Ga0496108_0002908_4293_4763 | 132 |
| 422 | 3300048911 | Ga0496108_0006262 | Ga0496108_0006262_1536_1955 | 132 |
| 423 | 3300048911 | Ga0496108_0064860 | Ga0496108_0064860_1517_1924 | 132 |
| 424 | 3300048911 | Ga0496108_1010094 | Ga0496108_1010094_126_545 | 132 |
| 425 | 3300048912 | Ga0496109_0004213 | Ga0496109_0004213_9075_9545 | 132 |
| 426 | 3300048912 | Ga0496109_0055905 | Ga0496109_0055905_1715_2134 | 132 |
| 427 | 3300048912 | Ga0496109_0213965 | Ga0496109_0213965_873_1280 | 132 |
| 428 | 3300048912 | Ga0496109_0292512 | Ga0496109_0292512_176_595 | 132 |
| 429 | 3300048912 | Ga0496109_0777695 | Ga0496109_0777695_342_761 | 132 |
| 430 | 3300048913 | Ga0496110_0003133 | Ga0496110_0003133_8661_9131 | 132 |
| 431 | 3300048913 | Ga0496110_0030581 | Ga0496110_0030581_4119_4538 | 132 |
| 432 | 3300048913 | Ga0496110_0176236 | Ga0496110_0176236_847_1254 | 132 |
| 433 | 3300048913 | Ga0496110_0213156 | Ga0496110_0213156_749_1168 | 132 |
| 434 | 3300048913 | Ga0496110_0817081 | Ga0496110_0817081_267_686 | 132 |
| 435 | 3300048914 | Ga0496111_0001519 | Ga0496111_0001519_2425_2895 | 132 |
| 436 | 3300048914 | Ga0496111_0024701 | Ga0496111_0024701_1087_1506 | 132 |
| 437 | 3300048914 | Ga0496111_0420171 | Ga0496111_0420171_122_544 | 132 |
| 438 | 3300048914 | Ga0496111_0683291 | Ga0496111_0683291_69_476 | 132 |
| 439 | 3300048914 | Ga0496111_0890914 | Ga0496111_0890914_171_578 | 132 |
| 440 | 3300048915 | Ga0496112_0011959 | Ga0496112_0011959_452_922 | 132 |
| 441 | 3300048915 | Ga0496112_0069673 | Ga0496112_0069673_657_1076 | 132 |
| 442 | 3300048915 | Ga0496112_0112813 | Ga0496112_0112813_321_740 | 132 |
| 443 | 3300048915 | Ga0496112_0121824 | Ga0496112_0121824_1154_1561 | 132 |
| 444 | 3300048915 | Ga0496112_0189364 | Ga0496112_0189364_645_1064 | 132 |
| 445 | 3300048915 | Ga0496112_0473658 | Ga0496112_0473658_682_1101 | 132 |
| 446 | 3300048915 | Ga0496112_0873952 | Ga0496112_0873952_24_443 | 132 |
| 447 | 3300048916 | Ga0496113_0002360 | Ga0496113_0002360_4218_4688 | 132 |
| 448 | 3300048916 | Ga0496113_0196741 | Ga0496113_0196741_431_850 | 132 |
| 449 | 3300048916 | Ga0496113_0577235 | Ga0496113_0577235_118_537 | 132 |
| 450 | 3300048917 | Ga0496114_0062066 | Ga0496114_0062066_1906_2376 | 132 |
| 451 | 3300048917 | Ga0496114_0087671 | Ga0496114_0087671_598_1017 | 132 |
| 452 | 3300048917 | Ga0496114_0278920 | Ga0496114_0278920_980_1399 | 132 |
| 453 | 3300048917 | Ga0496114_0287508 | Ga0496114_0287508_239_646 | 132 |
| 454 | 3300048918 | Ga0496115_0049890 | Ga0496115_0049890_1070_1477 | 132 |
| 455 | 3300048918 | Ga0496115_0179033 | Ga0496115_0179033_449_868 | 132 |
| 456 | 3300048918 | Ga0496115_0463506 | Ga0496115_0463506_571_990 | 132 |
| 457 | 3300048924 | Ga0496121_0022605 | Ga0496121_0022605_1201_1623 | 132 |
| 458 | 3300049824 | Ga0501045_1005307 | Ga0501045_1005307_25_444 | 132 |
| 459 | 3300050511 | nmdc:mga08y16_1037373_c1 | nmdc:mga08y16_1037373_c1_239_646 | 132 |
| 460 | 3300050511 | nmdc:mga08y16_1264269_c1 | nmdc:mga08y16_1264269_c1_54_476 | 132 |
| 461 | 3300050512 | nmdc:mga0n895_349138_c1 | nmdc:mga0n895_349138_c1_1048_1455 | 132 |
| 462 | 3300050514 | nmdc:mga08x19_35217_c1 | nmdc:mga08x19_35217_c1_2456_2905 | 132 |
| 463 | 3300053078 | Ga0495612_0074690 | Ga0495612_0074690_467_886 | 132 |
| 464 | 3300053084 | Ga0495595_0066392 | Ga0495595_0066392_82_501 | 132 |
| 465 | 3300053085 | Ga0495619_0243791 | Ga0495619_0243791_756_1175 | 132 |
| 466 | 3300061719 | Ga0466962_0430126 | Ga0466962_0430126_169_603 | 132 |
| 467 | 3300061734 | Ga0530510_0949314 | Ga0530510_0949314_204_617 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lmv-assembly2.cif.gz_C | d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes | 0.9238 | 1 | 127 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9195 | 1 | 127 |
| 3ko7-assembly2.cif.gz_D | dtd from plasmodium falciparum in complex with d-lysine | 0.919 | 1 | 127 |
| 3kod-assembly3.cif.gz_F | dtd from plasmodium falciparum in complex with d-serine | 0.9171 | 1 | 127 |
| 3knp-assembly3.cif.gz_E | crystal structure of dtd from plasmodium falciparum | 0.916 | 1 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8N6C5_775_870_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9852 | 3 | 15 | 2.60.40.10 |
| af_F8W457_135_238_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9797 | 1 | 17 | 2.60.40.10 |
| af_Q8IIH8_94_246_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.9726 | 3 | 18 | 2.60.120.200 |
| af_P45420_257_319_2.60.40.3110 | Mainly Beta;Sandwich;Immunoglobulin-like;Outer membrane usher protein | 0.9467 | 3 | 16 | 2.60.40.3110 |
| af_O14274_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9264 | 1 | 127 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3VYV1-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9402 | 1 | 131 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A7V4SNI9-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9397 | 1 | 131 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A7C4XL70-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9375 | 1 | 131 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A2V9ZRN4-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9368 | 1 | 129 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A2D6LG21-F1-model_v4 | deleted | 0.9364 | 1 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar