F449796

General Info

Members Datasets Scaffolds Average Seq Length
467 292 934 160

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100593297|Ga0070680_1005932972
Length 183
Sequence MYDTPTIAPRKDAAQFVAVGRYEFRPMTADDLPLIRRWLETPHVAEWWHDPAEQFERVSGHLSDPDIVQFIVSTDTRPFAYLQCYNLSDWHIGFGPQPEGTRGIDQFIGEPDLVGRGHGSAFIRGFIGGLLATGMPRAVTDPNPANARAIRSYEKAGFRRDRVVDTPDGPALLMVRNAHLDKR

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
126 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
155 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
286 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
287 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
288 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
289 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
290 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
291 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
292 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 0.43
Rhizoplane 12.21
Rhizosphere 76.23
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100593297 3300005336 Bacteria 951
2 JGI25406J46586_10000066 3300003203 Bacteria 48110
3 JGI25406J46586_10002429 3300003203 Bacteria 8810
4 rootH1_10241868 3300003323 Bacteria 1578
5 rootH1_10271242 3300003323 Bacteria 1212
6 Ga0065165_1001495 3300005262 Bacteria 24729
7 Ga0070676_10511285 3300005328 Bacteria 854
8 Ga0070670_100512102 3300005331 Bacteria 1068
9 Ga0070670_100594367 3300005331 Bacteria 990
10 Ga0070670_100652534 3300005331 Bacteria 944
11 Ga0070670_100741612 3300005331 Bacteria 885
12 Ga0070666_10796105 3300005335 Bacteria 696
13 Ga0070680_100690729 3300005336 Bacteria 878
14 Ga0068868_100029566 3300005338 Bacteria 4196
15 Ga0068868_101259891 3300005338 Bacteria 686
16 Ga0070689_100559046 3300005340 Bacteria 987
17 Ga0070675_100045786 3300005354 Bacteria 3580
18 Ga0070675_101557648 3300005354 Bacteria 610
19 Ga0070671_100747555 3300005355 Bacteria 850
20 Ga0070671_100942825 3300005355 Bacteria 755
21 Ga0070671_101015795 3300005355 Bacteria 727
22 Ga0070674_100048468 3300005356 Bacteria 2916
23 Ga0070674_100983440 3300005356 Bacteria 740
24 Ga0070667_100202691 3300005367 Bacteria 1761
25 Ga0070667_100315983 3300005367 Bacteria 1409
26 Ga0070667_100838667 3300005367 Bacteria 854
27 Ga0070714_100224719 3300005435 Bacteria 1727
28 Ga0070713_100002056 3300005436 Bacteria 12998
29 Ga0070701_10107717 3300005438 Bacteria 1553
30 Ga0070711_100034277 3300005439 Bacteria 3385
31 Ga0070705_100112697 3300005440 Bacteria 1741
32 Ga0070663_100251566 3300005455 Bacteria 1399
33 Ga0070663_100791587 3300005455 Bacteria 812
34 Ga0070678_100113435 3300005456 Bacteria 2124
35 Ga0070678_100218922 3300005456 Bacteria 1582
36 Ga0070678_100232980 3300005456 Bacteria 1536
37 Ga0070662_100448275 3300005457 Bacteria 1071
38 Ga0070681_10708229 3300005458 Bacteria 923
39 Ga0070685_10465150 3300005466 Bacteria 889
40 Ga0070686_100593488 3300005544 Bacteria 872
41 Ga0070665_100125371 3300005548 Bacteria 2570
42 Ga0070665_100349553 3300005548 Bacteria 1484
43 Ga0070665_100387166 3300005548 Bacteria 1406
44 Ga0068857_100849425 3300005577 Bacteria 873
45 Ga0068854_100394968 3300005578 Bacteria 1143
46 Ga0070702_101159612 3300005615 Bacteria 621
47 Ga0068852_100378819 3300005616 Bacteria 1388
48 Ga0068852_100719973 3300005616 Bacteria 1009
49 Ga0068859_100614506 3300005617 Bacteria 1180
50 Ga0068864_100199913 3300005618 Bacteria 1835
51 Ga0068864_100420966 3300005618 Bacteria 1273
52 Ga0068861_100073527 3300005719 Bacteria 2656
53 Ga0068861_100707173 3300005719 Bacteria 937
54 Ga0068863_101318248 3300005841 Bacteria 729
55 Ga0068863_102024593 3300005841 Bacteria 586
56 Ga0068858_100294800 3300005842 Bacteria 1546
57 Ga0068858_100389732 3300005842 Bacteria 1337
58 Ga0068860_100250558 3300005843 Bacteria 1724
59 Ga0068860_100394788 3300005843 Bacteria 1368
60 Ga0068860_100500920 3300005843 Bacteria 1212
61 Ga0068862_100628364 3300005844 Bacteria 1034
62 Ga0068862_101484962 3300005844 Bacteria 683
63 Ga0081455_10027089 3300005937 Bacteria 5258
64 Ga0081540_1000166 3300005983 Bacteria 68242
65 Ga0081540_1094279 3300005983 Bacteria 1308
66 Ga0081539_10000064 3300005985 Bacteria 247020
67 Ga0081539_10002259 3300005985 Bacteria 28018
68 Ga0070717_10044823 3300006028 Bacteria 3614
69 Ga0070717_10830316 3300006028 Bacteria 841
70 Ga0075365_10187130 3300006038 Bacteria 1448
71 Ga0075365_10269035 3300006038 Bacteria 1199
72 Ga0075365_10303530 3300006038 Bacteria 1124
73 Ga0075365_10322130 3300006038 Bacteria 1088
74 Ga0075368_10015216 3300006042 Bacteria 2850
75 Ga0075363_100001418 3300006048 Bacteria 9077
76 Ga0075363_100040644 3300006048 Bacteria 2451
77 Ga0075363_100062330 3300006048 Bacteria 2010
78 Ga0070715_10001673 3300006163 Bacteria 6581
79 Ga0070716_100000922 3300006173 Bacteria 12727
80 Ga0075367_10429139 3300006178 Bacteria 837
81 Ga0075369_10188587 3300006186 Bacteria 950
82 Ga0075369_10378863 3300006186 Bacteria 666
83 Ga0075366_10046259 3300006195 Bacteria 2578
84 Ga0075366_10309216 3300006195 Bacteria 967
85 Ga0075370_10217177 3300006353 Bacteria 1129
86 Ga0068871_100092612 3300006358 Bacteria 2521
87 Ga0075430_100000332 3300006846 Bacteria 33904
88 Ga0075431_100644730 3300006847 Bacteria 1040
89 Ga0075429_100237314 3300006880 Bacteria 1597
90 Ga0068865_100066644 3300006881 Bacteria 2541
91 Ga0068865_100347338 3300006881 Bacteria 1201
92 Ga0097620_100614562 3300006931 Bacteria 1180
93 Ga0105245_10000578 3300009098 Bacteria 33305
94 Ga0105245_10575055 3300009098 Bacteria 1151
95 Ga0105245_10723263 3300009098 Bacteria 1030
96 Ga0105245_10906945 3300009098 Bacteria 923
97 Ga0114129_10041639 3300009147 Bacteria 6470
98 Ga0105243_10069007 3300009148 Bacteria 2850
99 Ga0105243_11257788 3300009148 Bacteria 756
100 Ga0105243_12166859 3300009148 Bacteria 592
101 Ga0105241_11031226 3300009174 Bacteria 771
102 Ga0105241_12013988 3300009174 Bacteria 569
103 Ga0105242_10127241 3300009176 Bacteria 2194
104 Ga0105242_10228800 3300009176 Bacteria 1665
105 Ga0105248_10010887 3300009177 Bacteria 10037
106 Ga0105248_10540273 3300009177 Bacteria 1315
107 Ga0105248_10569989 3300009177 Bacteria 1277
108 Ga0105248_10873749 3300009177 Bacteria 1015
109 Ga0105248_11949880 3300009177 Bacteria 667
110 Ga0105237_10040634 3300009545 Bacteria 4690
111 Ga0105237_10106473 3300009545 Bacteria 2796
112 Ga0105237_11757724 3300009545 Bacteria 628
113 Ga0105238_10018505 3300009551 Bacteria 7089
114 Ga0105239_10449980 3300010375 Bacteria 1461
115 Ga0105246_10085982 3300011119 Bacteria 2253
116 Ga0157341_1010227 3300012494 Bacteria 793
117 Ga0157374_10480894 3300013296 Bacteria 1245
118 Ga0157374_11063208 3300013296 Bacteria 829
119 Ga0157374_11800086 3300013296 Bacteria 638
120 Ga0157378_10343740 3300013297 Bacteria 1456
121 Ga0157378_11379756 3300013297 Bacteria 747
122 Ga0157375_10217461 3300013308 Bacteria 2069
123 Ga0157375_10478186 3300013308 Bacteria 1411
124 Ga0157375_11761261 3300013308 Bacteria 734
125 Ga0163163_10165524 3300014325 Bacteria 2257
126 Ga0157380_10245550 3300014326 Bacteria 1617
127 Ga0157380_10561632 3300014326 Bacteria 1122
128 Ga0157380_11350201 3300014326 Bacteria 762
129 Ga0157379_10244052 3300014968 Bacteria 1629
130 Ga0157376_10450883 3300014969 Bacteria 1255
131 Ga0157376_10571191 3300014969 Bacteria 1122
132 Ga0157376_11349620 3300014969 Bacteria 744
133 Ga0163161_10453195 3300017792 Bacteria 1037
134 Ga0163161_10759674 3300017792 Bacteria 812
135 Ga0209233_1019950 3300025261 Bacteria 1769
136 Ga0209758_1000695 3300025297 Bacteria 49852
137 Ga0207426_1002297 3300025302 Bacteria 12602
138 Ga0207713_1218499 3300025735 Bacteria 575
139 Ga0207692_10001284 3300025898 Bacteria 9322
140 Ga0207710_10227333 3300025900 Bacteria 928
141 Ga0207688_10258590 3300025901 Bacteria 1056
142 Ga0207680_10747481 3300025903 Bacteria 701
143 Ga0207685_10010696 3300025905 Bacteria 2724
144 Ga0207699_10016207 3300025906 Bacteria 3892
145 Ga0207643_10313578 3300025908 Bacteria 978
146 Ga0207693_10003195 3300025915 Bacteria 14067
147 Ga0207663_10000404 3300025916 Bacteria 18698
148 Ga0207660_10451216 3300025917 Bacteria 1040
149 Ga0207694_10190590 3300025924 Bacteria 1665
150 Ga0207659_10032556 3300025926 Bacteria 3580
151 Ga0207687_10017320 3300025927 Bacteria 4742
152 Ga0207700_10014690 3300025928 Bacteria 5140
153 Ga0207664_10017118 3300025929 Bacteria 5304
154 Ga0207644_10307742 3300025931 Bacteria 1278
155 Ga0207644_11083791 3300025931 Bacteria 673
156 Ga0207706_10863739 3300025933 Bacteria 766
157 Ga0207686_10875182 3300025934 Bacteria 724
158 Ga0207709_10339238 3300025935 Bacteria 1130
159 Ga0207669_10012258 3300025937 Bacteria 4210
160 Ga0207704_10542410 3300025938 Bacteria 944
161 Ga0207704_10822281 3300025938 Bacteria 777
162 Ga0207665_10001034 3300025939 Bacteria 18732
163 Ga0207711_10354835 3300025941 Bacteria 1358
164 Ga0207679_10167251 3300025945 Bacteria 1807
165 Ga0207679_11298710 3300025945 Bacteria 668
166 Ga0207640_10639065 3300025981 Bacteria 905
167 Ga0207658_10124216 3300025986 Bacteria 2063
168 Ga0207658_10489603 3300025986 Bacteria 1094
169 Ga0207677_10065351 3300026023 Bacteria 2538
170 Ga0207677_10790206 3300026023 Bacteria 849
171 Ga0207703_10310587 3300026035 Bacteria 1441
172 Ga0207703_10523746 3300026035 Bacteria 1115
173 Ga0207678_10118028 3300026067 Bacteria 2264
174 Ga0207678_10312849 3300026067 Bacteria 1350
175 Ga0207648_10640105 3300026089 Bacteria 982
176 Ga0207676_10124950 3300026095 Bacteria 2177
177 Ga0207676_10466545 3300026095 Bacteria 1193
178 Ga0207674_10339414 3300026116 Bacteria 1453
179 Ga0207675_101526932 3300026118 Bacteria 688
180 Ga0207683_10170257 3300026121 Bacteria 1972
181 Ga0207683_10176941 3300026121 Bacteria 1934
182 Ga0207683_11197202 3300026121 Bacteria 704
183 Ga0207698_10213735 3300026142 Bacteria 1737
184 Ga0207698_11054755 3300026142 Bacteria 825
185 Ga0209813_10002051 3300027866 Bacteria 4574
186 Ga0268266_10001190 3300028379 Bacteria 32120
187 Ga0268266_10356483 3300028379 Bacteria 1375
188 Ga0268266_10549084 3300028379 Bacteria 1107
189 Ga0268265_11076551 3300028380 Bacteria 797
190 Ga0268264_10162622 3300028381 Bacteria 2012
191 Ga0268264_10407391 3300028381 Bacteria 1308
192 Ga0268264_11413798 3300028381 Bacteria 706
193 Ga0265332_10243592 3300031238 Bacteria 744
194 Ga0307513_10337326 3300031456 Bacteria 1259
195 Ga0307408_100490018 3300031548 Bacteria 1074
196 Ga0265342_10003978 3300031712 Bacteria 11831
197 Ga0307412_10524936 3300031911 Bacteria 990
198 Ga0307412_10637379 3300031911 Bacteria 907
199 Ga0307409_101604429 3300031995 Bacteria 679
200 Ga0307416_101074531 3300032002 Bacteria 909
201 Ga0373958_0022026 3300034819 Bacteria 1187
202 Ga0373959_0014498 3300034820 Bacteria 1435
203 Ga0373926_0007888 3300035083 Bacteria 3547
204 Ga0373928_0037658 3300035084 Bacteria 1098
205 Ga0373929_0008293 3300035085 Bacteria 1913
206 Ga0373934_0301800 3300035086 Bacteria 664
207 Ga0373940_0019203 3300035088 Bacteria 1724
208 Ga0373949_0003433 3300035090 Bacteria 3774
209 Ga0373952_0003050 3300035092 Bacteria 3020
210 Ga0373923_0000996 3300035111 Bacteria 7664
211 Ga0373932_0010337 3300035112 Bacteria 2256
212 Ga0373936_0028517 3300035113 Bacteria 2194
213 Ga0373939_0072223 3300035114 Bacteria 1126
214 Ga0373945_0003019 3300035116 Bacteria 5290
215 Ga0373945_0023225 3300035116 Bacteria 2141
216 Ga0373953_0202838 3300035117 Bacteria 858
217 Ga0373956_0038473 3300035119 Bacteria 2116
218 Ga0373960_0073638 3300035121 Bacteria 1061
219 Ga0373943_0003862 3300035170 Bacteria 6813
220 Ga0373943_0023404 3300035170 Bacteria 2872
221 Ga0373946_0019503 3300035171 Bacteria 2613
222 Ga0373946_0034414 3300035171 Bacteria 2045
223 Ga0373942_0001735 3300035207 Bacteria 5530
224 Ga0373961_0003579 3300035241 Bacteria 3826
225 Ga0373961_0317220 3300035241 Unclassified 580
226 Ga0373924_0004453 3300035410 Bacteria 4894
227 Ga0373931_0085512 3300035691 Bacteria 1748
228 Ga0373935_0006896 3300035692 Bacteria 6779
229 Ga0373927_0054333 3300035695 Bacteria 2590
230 Ga0373927_0198096 3300035695 Bacteria 1318
231 Ga0373933_0022052 3300035724 Bacteria 3624
232 Ga0373947_0003819 3300035725 Bacteria 8871
233 Ga0373947_0009279 3300035725 Bacteria 5653
234 Ga0373947_0017110 3300035725 Bacteria 4169
235 Ga0373925_0019133 3300037068 Bacteria 4979
236 Ga0373925_0019171 3300037068 Bacteria 4974
237 Ga0373925_0512223 3300037068 Bacteria 985
238 Ga0439453_0022777 3300041408 Bacteria 1138
239 Ga0451835_0701639 3300041492 Bacteria 789
240 Ga0439454_054495 3300042011 Bacteria 682
241 Ga0439435_0011379 3300042436 Bacteria 2135
242 Ga0439440_0015444 3300042993 Bacteria 1660
243 Ga0466963_0079212 3300044694 Bacteria 2223
244 Ga0495617_007996 3300046452 Bacteria 3654
245 Ga0495627_056093 3300046453 Bacteria 1175
246 Ga0495592_0018449 3300046454 Bacteria 5306
247 Ga0495603_0006275 3300046455 Bacteria 7111
248 Ga0495603_0024810 3300046455 Bacteria 3627
249 Ga0495629_0000588 3300046459 Bacteria 29503
250 Ga0495629_0082582 3300046459 Bacteria 2242
251 Ga0495641_0013205 3300046461 Bacteria 4556
252 Ga0495641_0089055 3300046461 Bacteria 1379
253 Ga0495651_0024839 3300046462 Bacteria 4662
254 Ga0495580_0044358 3300046472 Bacteria 3163
255 Ga0495580_0089939 3300046472 Bacteria 2137
256 Ga0495582_0006350 3300046473 Bacteria 6574
257 Ga0495582_0014709 3300046473 Bacteria 4300
258 Ga0495582_0630219 3300046473 Bacteria 620
259 Ga0495639_0024100 3300046475 Bacteria 2677
260 Ga0495639_0033587 3300046475 Bacteria 2291
261 Ga0495662_0013850 3300046476 Bacteria 3924
262 Ga0495664_0003946 3300046477 Bacteria 8095
263 Ga0495584_0002387 3300046491 Bacteria 10658
264 Ga0495585_0006758 3300046492 Bacteria 7079
265 Ga0495585_0240369 3300046492 Bacteria 907
266 Ga0495594_0015814 3300046499 Bacteria 3968
267 Ga0495594_0258578 3300046499 Bacteria 991
268 Ga0495596_0149528 3300046500 Bacteria 907
269 Ga0495607_0004095 3300046501 Bacteria 10894
270 Ga0495606_0000252 3300046507 Bacteria 94511
271 Ga0495608_0005734 3300046511 Bacteria 8861
272 Ga0495616_0044042 3300046513 Bacteria 2265
273 Ga0495618_0052332 3300046514 Bacteria 2580
274 Ga0495628_0011538 3300046516 Bacteria 7471
275 Ga0495630_0215493 3300046517 Bacteria 1465
276 Ga0495644_0000563 3300046523 Bacteria 15597
277 Ga0495663_0055974 3300046525 Bacteria 1231
278 Ga0495666_0043265 3300046526 Bacteria 2176
279 Ga0495666_0140180 3300046526 Bacteria 1127
280 Ga0495652_0240143 3300046529 Bacteria 1348
281 Ga0495665_0063427 3300046531 Bacteria 1950
282 Ga0495640_0059932 3300046533 Bacteria 2590
283 Ga0495586_0005125 3300046535 Bacteria 7014
284 Ga0495587_0017363 3300046536 Bacteria 4470
285 Ga0495598_0006383 3300046537 Bacteria 2662
286 Ga0495645_0084836 3300046543 Bacteria 2268
287 Ga0495633_0009862 3300046558 Bacteria 5248
288 Ga0495667_0032553 3300046559 Bacteria 3493
289 Ga0495656_0000123 3300046615 Bacteria 29630
290 Ga0495634_0113684 3300046642 Bacteria 1738
291 Ga0495611_0006760 3300046648 Bacteria 4877
292 Ga0495635_0009801 3300046663 Bacteria 6696
293 Ga0495635_0077726 3300046663 Bacteria 2273
294 Ga0495659_0000648 3300046664 Bacteria 12635
295 Ga0495661_0018889 3300046665 Bacteria 4525
296 Ga0495588_0008051 3300046674 Bacteria 4817
297 Ga0495599_0081559 3300046678 Bacteria 2020
298 Ga0495623_0270759 3300046679 Bacteria 948
299 Ga0495646_0062518 3300046680 Bacteria 2213
300 Ga0495647_0004426 3300046681 Bacteria 4566
301 Ga0495647_0006039 3300046681 Bacteria 3994
302 Ga0495658_0000601 3300046683 Bacteria 19735
303 Ga0495658_0029635 3300046683 Bacteria 2965
304 Ga0495613_0005839 3300046689 Bacteria 9210
305 Ga0495613_0041403 3300046689 Bacteria 3411
306 Ga0495624_0015740 3300046690 Bacteria 5099
307 Ga0495670_0000220 3300046691 Bacteria 25973
308 Ga0495671_0212356 3300046692 Bacteria 938
309 Ga0495589_0056969 3300046794 Bacteria 1923
310 Ga0495600_0002039 3300046809 Bacteria 11375
311 Ga0495600_0221075 3300046809 Bacteria 1211
312 Ga0495581_0004313 3300047315 Bacteria 8208
313 Ga0495581_0009295 3300047315 Bacteria 5689
314 Ga0495604_0010125 3300047317 Bacteria 7468
315 Ga0495604_0322476 3300047317 Bacteria 1032
316 Ga0495674_0355468 3300047319 Bacteria 1188
317 Ga0495672_0090401 3300047320 Bacteria 1682
318 Ga0495676_0018062 3300047321 Bacteria 6222
319 Ga0495676_0279161 3300047321 Bacteria 1131
320 Ga0495680_0036967 3300047322 Bacteria 3913
321 Ga0495680_0090603 3300047322 Bacteria 2293
322 Ga0495679_022904 3300047446 Bacteria 2129
323 Ga0495684_0002684 3300047471 Bacteria 14089
324 Ga0495593_0009647 3300047673 Bacteria 5602
325 Ga0495593_0019872 3300047673 Bacteria 3763
326 Ga0495602_0267845 3300048088 Bacteria 1264
327 Ga0496100_0078175 3300048903 Bacteria 2226
328 Ga0496101_0104069 3300048904 Bacteria 2128
329 Ga0496101_0172541 3300048904 Bacteria 1662
330 Ga0496101_0670470 3300048904 Unclassified 819
331 Ga0496102_0227777 3300048905 Bacteria 1757
332 Ga0496102_0280279 3300048905 Bacteria 1571
333 Ga0496102_0360574 3300048905 Bacteria 1368
334 Ga0496102_0436767 3300048905 Bacteria 1229
335 Ga0496103_0110818 3300048906 Bacteria 1743
336 Ga0496104_0000355 3300048907 Bacteria 40904
337 Ga0496104_0072686 3300048907 Bacteria 3270
338 Ga0496104_0315401 3300048907 Bacteria 1476
339 Ga0496104_0444415 3300048907 Bacteria 1208
340 Ga0496104_0611818 3300048907 Bacteria 999
341 Ga0496105_0005940 3300048908 Bacteria 9315
342 Ga0496105_0099747 3300048908 Bacteria 2398
343 Ga0496105_0263718 3300048908 Bacteria 1393
344 Ga0496105_0298047 3300048908 Bacteria 1296
345 Ga0496105_0298048 3300048908 Bacteria 1296
346 Ga0496105_0574982 3300048908 Bacteria 877
347 Ga0496106_0134096 3300048909 Bacteria 1943
348 Ga0496106_0921072 3300048909 Bacteria 690
349 Ga0496107_0035002 3300048910 Bacteria 3599
350 Ga0496107_0128069 3300048910 Bacteria 1873
351 Ga0496107_0523320 3300048910 Bacteria 879
352 Ga0496108_0007743 3300048911 Bacteria 8701
353 Ga0496108_0083397 3300048911 Bacteria 2711
354 Ga0496108_0359023 3300048911 Bacteria 1271
355 Ga0496108_0899747 3300048911 Bacteria 760
356 Ga0496109_0022567 3300048912 Bacteria 5576
357 Ga0496109_0036586 3300048912 Bacteria 4432
358 Ga0496109_0161912 3300048912 Bacteria 2096
359 Ga0496109_0574585 3300048912 Bacteria 1062
360 Ga0496110_0213721 3300048913 Bacteria 1753
361 Ga0496110_0377552 3300048913 Bacteria 1292
362 Ga0496110_0457727 3300048913 Bacteria 1162
363 Ga0496110_0905638 3300048913 Bacteria 788
364 Ga0496111_0079075 3300048914 Bacteria 2398
365 Ga0496111_0122427 3300048914 Bacteria 1921
366 Ga0496111_0192417 3300048914 Bacteria 1516
367 Ga0496111_0256839 3300048914 Bacteria 1296
368 Ga0496112_0000020 3300048915 Bacteria 169373
369 Ga0496112_0011595 3300048915 Bacteria 8059
370 Ga0496112_0633658 3300048915 Bacteria 999
371 Ga0496113_0154636 3300048916 Bacteria 1810
372 Ga0496113_0763141 3300048916 Bacteria 769
373 Ga0496113_1358417 3300048916 Bacteria 551
374 Ga0496114_0005384 3300048917 Bacteria 10007
375 Ga0496114_0735862 3300048917 Bacteria 863
376 Ga0496115_0063670 3300048918 Bacteria 2975
377 Ga0496115_0069099 3300048918 Bacteria 2860
378 Ga0496115_0078918 3300048918 Bacteria 2679
379 Ga0496115_0123935 3300048918 Bacteria 2127
380 Ga0496115_0152635 3300048918 Bacteria 1907
381 Ga0496115_0528157 3300048918 Bacteria 945
382 Ga0496115_0570527 3300048918 Bacteria 902
383 Ga0496115_0961224 3300048918 Bacteria 655
384 Ga0496118_0312449 3300048921 Bacteria 857
385 Ga0496124_0088995 3300048927 Bacteria 2522
386 Ga0496126_0009570 3300048929 Bacteria 10278
387 Ga0496126_0191200 3300048929 Bacteria 1733
388 Ga0496126_0679864 3300048929 Bacteria 802
389 Ga0501031_0003364 3300049568 Bacteria 10275
390 Ga0501032_0000001 3300049569 Bacteria 422097
391 Ga0501032_0085736 3300049569 Bacteria 2093
392 Ga0501032_0387189 3300049569 Bacteria 899
393 Ga0501032_0481635 3300049569 Unclassified 794
394 Ga0501033_0000898 3300049570 Bacteria 27225
395 Ga0501034_0002200 3300049571 Bacteria 24125
396 Ga0501036_0000358 3300049572 Bacteria 32271
397 Ga0501036_0892260 3300049572 Bacteria 730
398 Ga0501037_0000091 3300049573 Bacteria 84811
399 Ga0501038_0026882 3300049574 Bacteria 5123
400 Ga0501038_0119396 3300049574 Bacteria 2176
401 Ga0501038_0739762 3300049574 Bacteria 734
402 Ga0501039_0000022 3300049575 Bacteria 160858
403 Ga0501039_0035245 3300049575 Bacteria 3861
404 Ga0501039_0427903 3300049575 Bacteria 1040
405 Ga0501040_0067136 3300049576 Bacteria 2471
406 Ga0501041_1072713 3300049577 Bacteria 519
407 Ga0501042_0174807 3300049578 Bacteria 1549
408 Ga0501042_0281026 3300049578 Bacteria 1202
409 Ga0501043_0000016 3300049579 Bacteria 170869
410 Ga0501046_0019056 3300049580 Bacteria 5696
411 Ga0501046_0037457 3300049580 Bacteria 3897
412 Ga0501046_0292687 3300049580 Bacteria 1191
413 Ga0501047_0561085 3300049581 Bacteria 966
414 Ga0501048_0816451 3300049582 Bacteria 670
415 Ga0501068_0937250 3300049584 Bacteria 570
416 Ga0501071_0295375 3300049587 Bacteria 1228
417 Ga0501072_0616393 3300049588 Bacteria 855
418 Ga0501075_0056617 3300049591 Bacteria 2952
419 Ga0501077_0511565 3300049593 Bacteria 770
420 Ga0501079_0658892 3300049741 Bacteria 824
421 Ga0501081_0008289 3300049743 Bacteria 6744
422 Ga0501035_0059723 3300049822 Bacteria 3396
423 Ga0501035_0215526 3300049822 Bacteria 1641
424 Ga0501035_0342305 3300049822 Bacteria 1253
425 Ga0501044_0561097 3300049823 Bacteria 1038
426 Ga0501045_0107574 3300049824 Bacteria 2066
427 Ga0501045_0996721 3300049824 Bacteria 614
428 nmdc:mga03n38_191370_c1 3300050490 Bacteria 1054
429 nmdc:mga03n38_500255_c1 3300050490 Bacteria 682
430 nmdc:mga03n38_5283_c1 3300050490 Bacteria 4381
431 nmdc:mga03n38_5998_c1 3300050490 Bacteria 4188
432 nmdc:mga00v17_493269_c1 3300050491 Bacteria 794
433 nmdc:mga0yw44_246156_c1 3300050492 Bacteria 1189
434 nmdc:mga0yw44_36749_c1 3300050492 Bacteria 2888
435 nmdc:mga0yw44_492090_c1 3300050492 Bacteria 832
436 nmdc:mga0yw44_98518_c1 3300050492 Bacteria 1506
437 nmdc:mga0k408_19574_c1 3300050493 Bacteria 3785
438 nmdc:mga06z11_211192_c1 3300050494 Bacteria 1131
439 nmdc:mga06z11_8949_c1 3300050494 Bacteria 4202
440 nmdc:mga04h51_532_c1 3300050495 Bacteria 9036
441 nmdc:mga07m45_4388_c1 3300050496 Bacteria 6902
442 nmdc:mga07m45_73949_c1 3300050496 Bacteria 1941
443 nmdc:mga09592_1020394_c1 3300050508 Bacteria 691
444 nmdc:mga0n895_590630_c1 3300050512 Bacteria 1114
445 nmdc:mga0rr50_151077_c1 3300050513 Bacteria 1877
446 Ga0495601_0077511 3300053077 Bacteria 2129
447 Ga0495601_0373689 3300053077 Bacteria 925
448 Ga0495612_0009835 3300053078 Bacteria 3872
449 Ga0495612_0112821 3300053078 Bacteria 1165
450 Ga0495595_0003265 3300053084 Bacteria 6438
451 Ga0495619_0004517 3300053085 Bacteria 8888
452 Ga0495619_0042848 3300053085 Bacteria 2965
453 Ga0500651_0512851 3300053093 Bacteria 660
454 Ga0500566_0333696 3300053094 Bacteria 701
455 Ga0500652_110606 3300053131 Bacteria 1148
456 Ga0501082_0136856 3300060353 Bacteria 2125
457 Ga0501082_0700619 3300060353 Bacteria 886
458 Ga0530510_0214046 3300061734 Bacteria 1432
459 Ga0530510_0366467 3300061734 Bacteria 1083
460 2513704414 2513237102 Bacteria 7703324
461 2513720322 2513237104 Bacteria 10034502
462 2824624481 2824617872 Bacteria 8814715
463 2824633396 2824626560 Bacteria 8813858
464 2824640307 2824635225 Bacteria 8785348
465 2824647259 2824644064 Bacteria 8743947
466 2824717425 2824714736 Bacteria 8717648
467 2824727612 2824723954 Bacteria 8758240
468 Ga0070680_100593297
469 JGI25406J46586_10000066
470 JGI25406J46586_10002429
471 rootH1_10241868
472 rootH1_10271242
473 Ga0065165_1001495
474 Ga0070676_10511285
475 Ga0070670_100512102
476 Ga0070670_100594367
477 Ga0070670_100652534
478 Ga0070670_100741612
479 Ga0070666_10796105
480 Ga0070680_100690729
481 Ga0068868_100029566
482 Ga0068868_101259891
483 Ga0070689_100559046
484 Ga0070675_100045786
485 Ga0070675_101557648
486 Ga0070671_100747555
487 Ga0070671_100942825
488 Ga0070671_101015795
489 Ga0070674_100048468
490 Ga0070674_100983440
491 Ga0070667_100202691
492 Ga0070667_100315983
493 Ga0070667_100838667
494 Ga0070714_100224719
495 Ga0070713_100002056
496 Ga0070701_10107717
497 Ga0070711_100034277
498 Ga0070705_100112697
499 Ga0070663_100251566
500 Ga0070663_100791587
501 Ga0070678_100113435
502 Ga0070678_100218922
503 Ga0070678_100232980
504 Ga0070662_100448275
505 Ga0070681_10708229
506 Ga0070685_10465150
507 Ga0070686_100593488
508 Ga0070665_100125371
509 Ga0070665_100349553
510 Ga0070665_100387166
511 Ga0068857_100849425
512 Ga0068854_100394968
513 Ga0070702_101159612
514 Ga0068852_100378819
515 Ga0068852_100719973
516 Ga0068859_100614506
517 Ga0068864_100199913
518 Ga0068864_100420966
519 Ga0068861_100073527
520 Ga0068861_100707173
521 Ga0068863_101318248
522 Ga0068863_102024593
523 Ga0068858_100294800
524 Ga0068858_100389732
525 Ga0068860_100250558
526 Ga0068860_100394788
527 Ga0068860_100500920
528 Ga0068862_100628364
529 Ga0068862_101484962
530 Ga0081455_10027089
531 Ga0081540_1000166
532 Ga0081540_1094279
533 Ga0081539_10000064
534 Ga0081539_10002259
535 Ga0070717_10044823
536 Ga0070717_10830316
537 Ga0075365_10187130
538 Ga0075365_10269035
539 Ga0075365_10303530
540 Ga0075365_10322130
541 Ga0075368_10015216
542 Ga0075363_100001418
543 Ga0075363_100040644
544 Ga0075363_100062330
545 Ga0070715_10001673
546 Ga0070716_100000922
547 Ga0075367_10429139
548 Ga0075369_10188587
549 Ga0075369_10378863
550 Ga0075366_10046259
551 Ga0075366_10309216
552 Ga0075370_10217177
553 Ga0068871_100092612
554 Ga0075430_100000332
555 Ga0075431_100644730
556 Ga0075429_100237314
557 Ga0068865_100066644
558 Ga0068865_100347338
559 Ga0097620_100614562
560 Ga0105245_10000578
561 Ga0105245_10575055
562 Ga0105245_10723263
563 Ga0105245_10906945
564 Ga0114129_10041639
565 Ga0105243_10069007
566 Ga0105243_11257788
567 Ga0105243_12166859
568 Ga0105241_11031226
569 Ga0105241_12013988
570 Ga0105242_10127241
571 Ga0105242_10228800
572 Ga0105248_10010887
573 Ga0105248_10540273
574 Ga0105248_10569989
575 Ga0105248_10873749
576 Ga0105248_11949880
577 Ga0105237_10040634
578 Ga0105237_10106473
579 Ga0105237_11757724
580 Ga0105238_10018505
581 Ga0105239_10449980
582 Ga0105246_10085982
583 Ga0157341_1010227
584 Ga0157374_10480894
585 Ga0157374_11063208
586 Ga0157374_11800086
587 Ga0157378_10343740
588 Ga0157378_11379756
589 Ga0157375_10217461
590 Ga0157375_10478186
591 Ga0157375_11761261
592 Ga0163163_10165524
593 Ga0157380_10245550
594 Ga0157380_10561632
595 Ga0157380_11350201
596 Ga0157379_10244052
597 Ga0157376_10450883
598 Ga0157376_10571191
599 Ga0157376_11349620
600 Ga0163161_10453195
601 Ga0163161_10759674
602 Ga0209233_1019950
603 Ga0209758_1000695
604 Ga0207426_1002297
605 Ga0207713_1218499
606 Ga0207692_10001284
607 Ga0207710_10227333
608 Ga0207688_10258590
609 Ga0207680_10747481
610 Ga0207685_10010696
611 Ga0207699_10016207
612 Ga0207643_10313578
613 Ga0207693_10003195
614 Ga0207663_10000404
615 Ga0207660_10451216
616 Ga0207694_10190590
617 Ga0207659_10032556
618 Ga0207687_10017320
619 Ga0207700_10014690
620 Ga0207664_10017118
621 Ga0207644_10307742
622 Ga0207644_11083791
623 Ga0207706_10863739
624 Ga0207686_10875182
625 Ga0207709_10339238
626 Ga0207669_10012258
627 Ga0207704_10542410
628 Ga0207704_10822281
629 Ga0207665_10001034
630 Ga0207711_10354835
631 Ga0207679_10167251
632 Ga0207679_11298710
633 Ga0207640_10639065
634 Ga0207658_10124216
635 Ga0207658_10489603
636 Ga0207677_10065351
637 Ga0207677_10790206
638 Ga0207703_10310587
639 Ga0207703_10523746
640 Ga0207678_10118028
641 Ga0207678_10312849
642 Ga0207648_10640105
643 Ga0207676_10124950
644 Ga0207676_10466545
645 Ga0207674_10339414
646 Ga0207675_101526932
647 Ga0207683_10170257
648 Ga0207683_10176941
649 Ga0207683_11197202
650 Ga0207698_10213735
651 Ga0207698_11054755
652 Ga0209813_10002051
653 Ga0268266_10001190
654 Ga0268266_10356483
655 Ga0268266_10549084
656 Ga0268265_11076551
657 Ga0268264_10162622
658 Ga0268264_10407391
659 Ga0268264_11413798
660 Ga0265332_10243592
661 Ga0307513_10337326
662 Ga0307408_100490018
663 Ga0265342_10003978
664 Ga0307412_10524936
665 Ga0307412_10637379
666 Ga0307409_101604429
667 Ga0307416_101074531
668 Ga0373958_0022026
669 Ga0373959_0014498
670 Ga0373926_0007888
671 Ga0373928_0037658
672 Ga0373929_0008293
673 Ga0373934_0301800
674 Ga0373940_0019203
675 Ga0373949_0003433
676 Ga0373952_0003050
677 Ga0373923_0000996
678 Ga0373932_0010337
679 Ga0373936_0028517
680 Ga0373939_0072223
681 Ga0373945_0003019
682 Ga0373945_0023225
683 Ga0373953_0202838
684 Ga0373956_0038473
685 Ga0373960_0073638
686 Ga0373943_0003862
687 Ga0373943_0023404
688 Ga0373946_0019503
689 Ga0373946_0034414
690 Ga0373942_0001735
691 Ga0373961_0003579
692 Ga0373961_0317220
693 Ga0373924_0004453
694 Ga0373931_0085512
695 Ga0373935_0006896
696 Ga0373927_0054333
697 Ga0373927_0198096
698 Ga0373933_0022052
699 Ga0373947_0003819
700 Ga0373947_0009279
701 Ga0373947_0017110
702 Ga0373925_0019133
703 Ga0373925_0019171
704 Ga0373925_0512223
705 Ga0439453_0022777
706 Ga0451835_0701639
707 Ga0439454_054495
708 Ga0439435_0011379
709 Ga0439440_0015444
710 Ga0466963_0079212
711 Ga0495617_007996
712 Ga0495627_056093
713 Ga0495592_0018449
714 Ga0495603_0006275
715 Ga0495603_0024810
716 Ga0495629_0000588
717 Ga0495629_0082582
718 Ga0495641_0013205
719 Ga0495641_0089055
720 Ga0495651_0024839
721 Ga0495580_0044358
722 Ga0495580_0089939
723 Ga0495582_0006350
724 Ga0495582_0014709
725 Ga0495582_0630219
726 Ga0495639_0024100
727 Ga0495639_0033587
728 Ga0495662_0013850
729 Ga0495664_0003946
730 Ga0495584_0002387
731 Ga0495585_0006758
732 Ga0495585_0240369
733 Ga0495594_0015814
734 Ga0495594_0258578
735 Ga0495596_0149528
736 Ga0495607_0004095
737 Ga0495606_0000252
738 Ga0495608_0005734
739 Ga0495616_0044042
740 Ga0495618_0052332
741 Ga0495628_0011538
742 Ga0495630_0215493
743 Ga0495644_0000563
744 Ga0495663_0055974
745 Ga0495666_0043265
746 Ga0495666_0140180
747 Ga0495652_0240143
748 Ga0495665_0063427
749 Ga0495640_0059932
750 Ga0495586_0005125
751 Ga0495587_0017363
752 Ga0495598_0006383
753 Ga0495645_0084836
754 Ga0495633_0009862
755 Ga0495667_0032553
756 Ga0495656_0000123
757 Ga0495634_0113684
758 Ga0495611_0006760
759 Ga0495635_0009801
760 Ga0495635_0077726
761 Ga0495659_0000648
762 Ga0495661_0018889
763 Ga0495588_0008051
764 Ga0495599_0081559
765 Ga0495623_0270759
766 Ga0495646_0062518
767 Ga0495647_0004426
768 Ga0495647_0006039
769 Ga0495658_0000601
770 Ga0495658_0029635
771 Ga0495613_0005839
772 Ga0495613_0041403
773 Ga0495624_0015740
774 Ga0495670_0000220
775 Ga0495671_0212356
776 Ga0495589_0056969
777 Ga0495600_0002039
778 Ga0495600_0221075
779 Ga0495581_0004313
780 Ga0495581_0009295
781 Ga0495604_0010125
782 Ga0495604_0322476
783 Ga0495674_0355468
784 Ga0495672_0090401
785 Ga0495676_0018062
786 Ga0495676_0279161
787 Ga0495680_0036967
788 Ga0495680_0090603
789 Ga0495679_022904
790 Ga0495684_0002684
791 Ga0495593_0009647
792 Ga0495593_0019872
793 Ga0495602_0267845
794 Ga0496100_0078175
795 Ga0496101_0104069
796 Ga0496101_0172541
797 Ga0496101_0670470
798 Ga0496102_0227777
799 Ga0496102_0280279
800 Ga0496102_0360574
801 Ga0496102_0436767
802 Ga0496103_0110818
803 Ga0496104_0000355
804 Ga0496104_0072686
805 Ga0496104_0315401
806 Ga0496104_0444415
807 Ga0496104_0611818
808 Ga0496105_0005940
809 Ga0496105_0099747
810 Ga0496105_0263718
811 Ga0496105_0298047
812 Ga0496105_0298048
813 Ga0496105_0574982
814 Ga0496106_0134096
815 Ga0496106_0921072
816 Ga0496107_0035002
817 Ga0496107_0128069
818 Ga0496107_0523320
819 Ga0496108_0007743
820 Ga0496108_0083397
821 Ga0496108_0359023
822 Ga0496108_0899747
823 Ga0496109_0022567
824 Ga0496109_0036586
825 Ga0496109_0161912
826 Ga0496109_0574585
827 Ga0496110_0213721
828 Ga0496110_0377552
829 Ga0496110_0457727
830 Ga0496110_0905638
831 Ga0496111_0079075
832 Ga0496111_0122427
833 Ga0496111_0192417
834 Ga0496111_0256839
835 Ga0496112_0000020
836 Ga0496112_0011595
837 Ga0496112_0633658
838 Ga0496113_0154636
839 Ga0496113_0763141
840 Ga0496113_1358417
841 Ga0496114_0005384
842 Ga0496114_0735862
843 Ga0496115_0063670
844 Ga0496115_0069099
845 Ga0496115_0078918
846 Ga0496115_0123935
847 Ga0496115_0152635
848 Ga0496115_0528157
849 Ga0496115_0570527
850 Ga0496115_0961224
851 Ga0496118_0312449
852 Ga0496124_0088995
853 Ga0496126_0009570
854 Ga0496126_0191200
855 Ga0496126_0679864
856 Ga0501031_0003364
857 Ga0501032_0000001
858 Ga0501032_0085736
859 Ga0501032_0387189
860 Ga0501032_0481635
861 Ga0501033_0000898
862 Ga0501034_0002200
863 Ga0501036_0000358
864 Ga0501036_0892260
865 Ga0501037_0000091
866 Ga0501038_0026882
867 Ga0501038_0119396
868 Ga0501038_0739762
869 Ga0501039_0000022
870 Ga0501039_0035245
871 Ga0501039_0427903
872 Ga0501040_0067136
873 Ga0501041_1072713
874 Ga0501042_0174807
875 Ga0501042_0281026
876 Ga0501043_0000016
877 Ga0501046_0019056
878 Ga0501046_0037457
879 Ga0501046_0292687
880 Ga0501047_0561085
881 Ga0501048_0816451
882 Ga0501068_0937250
883 Ga0501071_0295375
884 Ga0501072_0616393
885 Ga0501075_0056617
886 Ga0501077_0511565
887 Ga0501079_0658892
888 Ga0501081_0008289
889 Ga0501035_0059723
890 Ga0501035_0215526
891 Ga0501035_0342305
892 Ga0501044_0561097
893 Ga0501045_0107574
894 Ga0501045_0996721
895 nmdc:mga03n38_191370_c1
896 nmdc:mga03n38_500255_c1
897 nmdc:mga03n38_5283_c1
898 nmdc:mga03n38_5998_c1
899 nmdc:mga00v17_493269_c1
900 nmdc:mga0yw44_246156_c1
901 nmdc:mga0yw44_36749_c1
902 nmdc:mga0yw44_492090_c1
903 nmdc:mga0yw44_98518_c1
904 nmdc:mga0k408_19574_c1
905 nmdc:mga06z11_211192_c1
906 nmdc:mga06z11_8949_c1
907 nmdc:mga04h51_532_c1
908 nmdc:mga07m45_4388_c1
909 nmdc:mga07m45_73949_c1
910 nmdc:mga09592_1020394_c1
911 nmdc:mga0n895_590630_c1
912 nmdc:mga0rr50_151077_c1
913 Ga0495601_0077511
914 Ga0495601_0373689
915 Ga0495612_0009835
916 Ga0495612_0112821
917 Ga0495595_0003265
918 Ga0495619_0004517
919 Ga0495619_0042848
920 Ga0500651_0512851
921 Ga0500566_0333696
922 Ga0500652_110606
923 Ga0501082_0136856
924 Ga0501082_0700619
925 Ga0530510_0214046
926 Ga0530510_0366467
927 2513704414
928 2513720322
929 2824624481
930 2824633396
931 2824640307
932 2824647259
933 2824717425
934 2824727612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13523

Acetyltransf_8

Acetyltransferase (GNAT) domain

27

166

0.96

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

32

158

0.84

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

21

159

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vqy-assembly1.cif.gz_A structure of aac(6')-ib in complex with parmomycin and acetylcoa. 0.8939 6 161
2bue-assembly1.cif.gz_A structure of aac(6')-ib in complex with ribostamycin and coenzyme a. 0.8924 6 161
2prb-assembly1.cif.gz_A crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a 0.8901 5 161
2qir-assembly1.cif.gz_A crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a and kanamycin 0.8899 5 161
2qml-assembly1.cif.gz_A crystal structure of an uncharacterized protein (bh2621) from bacillus halodurans at 1.55 a resolution 0.8764 2 161
ID Description Score Start End Superfamily
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.909 101 161 3.40.630.30
2qirA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8899 5 161 3.40.630.30
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8611 49 162 3.40.630.30
2qirA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8587 5 161 3.40.630.30
af_Q9UUE3_131_325_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8522 6 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1H0HRL5-F1-model_v4 Aminoglycoside 6'-N-acetyltransferase 0.9988 1 162 GO:0016410
GO:0019290
GO:0046677
AF-A0A1H0HRL5-F1-model_v4 Aminoglycoside 6'-N-acetyltransferase 0.9926 1 162 GO:0016410
GO:0019290
GO:0046677
AF-A0A4Q8R175-F1-model_v4 GNAT family N-acetyltransferase 0.9913 11 162 GO:0016410
GO:0046677
AF-A0A4Q8R175-F1-model_v4 GNAT family N-acetyltransferase 0.9848 11 162 GO:0016410
GO:0046677
AF-A0A4Q1V0L9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9843 6 162 GO:0016410
GO:0019290
GO:0046677

Map