F449755

General Info

Members Datasets Scaffolds Average Seq Length
466 228 932 246

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_86323_c1|nmdc:mga08y16_86323_c1_2174_2956
Length 244
Sequence VSPRLYRSLRLGAEIAVPILILLLWQLWTVHADDPKFPRLTTIIGEFQDLWLFSQFESDVLPSLERVLIGFSRWARLWAMPHVEYWRAMPPPALIPISIVLLGIYDKQKISFIAFFCLFPILLNAIDGVRGIEPTLIDTARSYGVPWRDTVRRIILPAAMPQIFAGMRTSLSLAVIIMVLTEYWSSANGVGYVLSNAKNTLQMGPMWAAILLIGLLGYGLNLLLSLVEGRVLAWHRGYRATASK

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
144 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.09
Rhizosphere 86.91
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_86323_c1 3300050511 Bacteria 3270
2 JGI24743J22301_10024751 3300001991 Bacteria 1161
3 JGI24745J21846_1004276 3300002073 Bacteria 1524
4 JGI24738J21930_10010224 3300002075 Bacteria 2093
5 JGI24742J22300_10005665 3300002244 Bacteria 2054
6 JGI25407J50210_10022769 3300003373 Bacteria 1628
7 Ga0070658_10039887 3300005327 Bacteria 3788
8 Ga0070683_100004938 3300005329 Bacteria 11060
9 Ga0070683_100129673 3300005329 Bacteria 2386
10 Ga0070683_100324543 3300005329 Bacteria 1465
11 Ga0070670_100040574 3300005331 Bacteria 4001
12 Ga0068869_100107458 3300005334 Bacteria 2118
13 Ga0070680_100172197 3300005336 Bacteria 1822
14 Ga0070682_100138401 3300005337 Bacteria 1656
15 Ga0070660_100109697 3300005339 Bacteria 2194
16 Ga0070691_10014016 3300005341 Bacteria 3676
17 Ga0070691_10213149 3300005341 Unclassified 1020
18 Ga0070661_100119564 3300005344 Bacteria 1972
19 Ga0070692_10005465 3300005345 Bacteria 5427
20 Ga0070669_100108088 3300005353 Bacteria 2107
21 Ga0070675_100050258 3300005354 Bacteria 3423
22 Ga0070675_100094146 3300005354 Bacteria 2513
23 Ga0070675_100294144 3300005354 Bacteria 1429
24 Ga0070674_100014478 3300005356 Bacteria 4903
25 Ga0070674_100041312 3300005356 Bacteria 3124
26 Ga0070673_100075001 3300005364 Bacteria 2727
27 Ga0070673_100118371 3300005364 Bacteria 2205
28 Ga0070673_100220863 3300005364 Bacteria 1640
29 Ga0070688_100094583 3300005365 Bacteria 1959
30 Ga0070659_100103755 3300005366 Bacteria 2290
31 Ga0070701_10027144 3300005438 Bacteria 2801
32 Ga0070701_10036860 3300005438 Bacteria 2466
33 Ga0070705_100028057 3300005440 Bacteria 3079
34 Ga0070700_100026710 3300005441 Bacteria 3414
35 Ga0070700_100387361 3300005441 Bacteria 1047
36 Ga0070663_100187495 3300005455 Bacteria 1608
37 Ga0070678_100025578 3300005456 Bacteria 3974
38 Ga0070678_100100505 3300005456 Bacteria 2240
39 Ga0070662_100029662 3300005457 Bacteria 3819
40 Ga0070681_10006166 3300005458 Bacteria 11644
41 Ga0070681_10139478 3300005458 Bacteria 2354
42 Ga0070685_10028410 3300005466 Bacteria 3098
43 Ga0070699_100223643 3300005518 Bacteria 1678
44 Ga0070679_100001190 3300005530 Bacteria 22847
45 Ga0070684_100002475 3300005535 Bacteria 13601
46 Ga0070684_100098446 3300005535 Bacteria 2609
47 Ga0070684_100157036 3300005535 Bacteria 2063
48 Ga0070684_100173994 3300005535 Bacteria 1956
49 Ga0068853_100055451 3300005539 Bacteria 3416
50 Ga0070672_100048032 3300005543 Bacteria 3315
51 Ga0070672_100167737 3300005543 Bacteria 1824
52 Ga0070693_100008265 3300005547 Bacteria 5119
53 Ga0070693_100011170 3300005547 Bacteria 4519
54 Ga0070665_100074293 3300005548 Bacteria 3405
55 Ga0070665_100467777 3300005548 Bacteria 1271
56 Ga0070704_100402062 3300005549 Bacteria 1169
57 Ga0070664_100048331 3300005564 Bacteria 3595
58 Ga0068854_100042565 3300005578 Bacteria 3215
59 Ga0068856_100059514 3300005614 Bacteria 3773
60 Ga0068856_100241029 3300005614 Bacteria 1823
61 Ga0068856_100421981 3300005614 Bacteria 1354
62 Ga0070702_100096371 3300005615 Bacteria 1805
63 Ga0070702_100283214 3300005615 Bacteria 1139
64 Ga0068852_100027043 3300005616 Bacteria 4670
65 Ga0068852_100155502 3300005616 Bacteria 2130
66 Ga0068866_10314030 3300005718 Bacteria 983
67 Ga0068851_10154254 3300005834 Bacteria 1257
68 Ga0068870_10045830 3300005840 Bacteria 2291
69 Ga0068870_10085870 3300005840 Bacteria 1750
70 Ga0068860_100038671 3300005843 Bacteria 4565
71 Ga0068862_100374689 3300005844 Bacteria 1326
72 Ga0081455_10021172 3300005937 Bacteria 6106
73 Ga0081455_10036397 3300005937 Bacteria 4383
74 Ga0081455_10042279 3300005937 Bacteria 4000
75 Ga0081455_10067810 3300005937 Bacteria 2972
76 Ga0081455_10394236 3300005937 Bacteria 963
77 Ga0081538_10000148 3300005981 Bacteria 73051
78 Ga0081538_10035699 3300005981 Bacteria 3260
79 Ga0081539_10004647 3300005985 Bacteria 14946
80 Ga0070712_100097421 3300006175 Bacteria 2168
81 Ga0097621_100106502 3300006237 Bacteria 2365
82 Ga0068871_100034250 3300006358 Bacteria 4029
83 Ga0075430_100161571 3300006846 Bacteria 1864
84 Ga0075431_100353463 3300006847 Bacteria 1477
85 Ga0075433_10364104 3300006852 Unclassified 1277
86 Ga0075434_100216462 3300006871 Bacteria 1935
87 Ga0075434_100413937 3300006871 Bacteria 1369
88 Ga0075434_100570436 3300006871 Bacteria 1151
89 Ga0068865_100003888 3300006881 Bacteria 8961
90 Ga0105240_10542376 3300009093 Bacteria 1288
91 Ga0111539_10006713 3300009094 Bacteria 14817
92 Ga0111539_10032740 3300009094 Bacteria 6313
93 Ga0111539_10073693 3300009094 Bacteria 4025
94 Ga0111539_10087164 3300009094 Bacteria 3668
95 Ga0111539_10197998 3300009094 Bacteria 2343
96 Ga0111539_10482219 3300009094 Bacteria 1444
97 Ga0105245_10023499 3300009098 Bacteria 5411
98 Ga0105245_10050392 3300009098 Bacteria 3732
99 Ga0114129_10139027 3300009147 Bacteria 3331
100 Ga0105243_10007084 3300009148 Bacteria 8623
101 Ga0105243_10046329 3300009148 Bacteria 3420
102 Ga0105243_10054561 3300009148 Bacteria 3173
103 Ga0105241_10045502 3300009174 Bacteria 3330
104 Ga0105242_10038642 3300009176 Bacteria 3839
105 Ga0105242_10110410 3300009176 Bacteria 2343
106 Ga0105242_10305361 3300009176 Bacteria 1454
107 Ga0105242_10355702 3300009176 Bacteria 1354
108 Ga0105248_10077116 3300009177 Bacteria 3746
109 Ga0105248_10124102 3300009177 Bacteria 2913
110 Ga0105248_10522801 3300009177 Bacteria 1338
111 Ga0105249_10042523 3300009553 Bacteria 4133
112 Ga0105249_10124561 3300009553 Bacteria 2452
113 Ga0105249_10206469 3300009553 Bacteria 1925
114 Ga0105239_10863955 3300010375 Unclassified 1038
115 Ga0105246_10046077 3300011119 Bacteria 2972
116 Ga0105246_10233957 3300011119 Bacteria 1448
117 Ga0157373_10087234 3300013100 Bacteria 2199
118 Ga0157373_10220970 3300013100 Bacteria 1336
119 Ga0157371_10006491 3300013102 Bacteria 9633
120 Ga0157369_10100923 3300013105 Bacteria 3076
121 Ga0157369_10616159 3300013105 Bacteria 1120
122 Ga0157374_10227472 3300013296 Bacteria 1832
123 Ga0157374_10545100 3300013296 Bacteria 1167
124 Ga0157378_10626938 3300013297 Bacteria 1089
125 Ga0157372_11050494 3300013307 Bacteria 943
126 Ga0157375_10109941 3300013308 Bacteria 2853
127 Ga0163163_10285281 3300014325 Bacteria 1703
128 Ga0157380_10012416 3300014326 Bacteria 6181
129 Ga0157380_10069271 3300014326 Bacteria 2846
130 Ga0182008_10001520 3300014497 Bacteria 15481
131 Ga0157377_10022566 3300014745 Bacteria 3325
132 Ga0157379_10389629 3300014968 Bacteria 1279
133 Ga0157379_10449506 3300014968 Bacteria 1189
134 Ga0157376_10016708 3300014969 Bacteria 5580
135 Ga0182006_1030633 3300015261 Bacteria 2173
136 Ga0182007_10007974 3300015262 Bacteria 4388
137 Ga0207653_10002819 3300025885 Bacteria 5525
138 Ga0207642_10088423 3300025899 Bacteria 1524
139 Ga0207642_10263662 3300025899 Bacteria 983
140 Ga0207710_10053496 3300025900 Bacteria 1817
141 Ga0207688_10037640 3300025901 Bacteria 2684
142 Ga0207647_10054124 3300025904 Bacteria 2470
143 Ga0207645_10075949 3300025907 Bacteria 2151
144 Ga0207643_10005890 3300025908 Bacteria 6548
145 Ga0207643_10106368 3300025908 Bacteria 1649
146 Ga0207705_10035882 3300025909 Bacteria 3548
147 Ga0207654_10069871 3300025911 Bacteria 2083
148 Ga0207707_10019870 3300025912 Bacteria 5862
149 Ga0207663_10223144 3300025916 Bacteria 1372
150 Ga0207660_10025621 3300025917 Bacteria 4006
151 Ga0207662_10028116 3300025918 Bacteria 3249
152 Ga0207646_10464532 3300025922 Bacteria 1141
153 Ga0207681_10149571 3300025923 Bacteria 1748
154 Ga0207650_10102800 3300025925 Bacteria 2202
155 Ga0207687_10010720 3300025927 Bacteria 5986
156 Ga0207686_10166944 3300025934 Bacteria 1548
157 Ga0207709_10014708 3300025935 Bacteria 4325
158 Ga0207709_10019168 3300025935 Bacteria 3842
159 Ga0207709_10040983 3300025935 Bacteria 2776
160 Ga0207709_10099476 3300025935 Bacteria 1919
161 Ga0207669_10120867 3300025937 Bacteria 1778
162 Ga0207704_10223799 3300025938 Bacteria 1394
163 Ga0207691_10008491 3300025940 Bacteria 9865
164 Ga0207691_10034457 3300025940 Bacteria 4708
165 Ga0207691_10060603 3300025940 Bacteria 3438
166 Ga0207711_10383425 3300025941 Bacteria 1304
167 Ga0207711_10495175 3300025941 Bacteria 1139
168 Ga0207689_10100922 3300025942 Bacteria 2370
169 Ga0207661_10057948 3300025944 Bacteria 3116
170 Ga0207661_10085340 3300025944 Bacteria 2617
171 Ga0207651_10040948 3300025960 Bacteria 3071
172 Ga0207712_10032702 3300025961 Bacteria 3512
173 Ga0207640_10023708 3300025981 Bacteria 3692
174 Ga0207658_10099682 3300025986 Bacteria 2273
175 Ga0207677_10423905 3300026023 Bacteria 1134
176 Ga0207677_10488935 3300026023 Bacteria 1062
177 Ga0207703_10174470 3300026035 Bacteria 1893
178 Ga0207678_10014852 3300026067 Bacteria 6850
179 Ga0207708_10006349 3300026075 Bacteria 8761
180 Ga0207708_10012518 3300026075 Bacteria 6324
181 Ga0207708_10186733 3300026075 Bacteria 1648
182 Ga0207702_10454797 3300026078 Bacteria 1243
183 Ga0207648_10062261 3300026089 Bacteria 3253
184 Ga0207648_10087502 3300026089 Bacteria 2719
185 Ga0207648_10382849 3300026089 Bacteria 1272
186 Ga0207674_10024216 3300026116 Bacteria 6491
187 Ga0207675_100008588 3300026118 Bacteria 9607
188 Ga0207675_100682655 3300026118 Bacteria 1035
189 Ga0207683_10013857 3300026121 Bacteria 6875
190 Ga0207698_10028608 3300026142 Bacteria 3977
191 Ga0207698_10032464 3300026142 Bacteria 3782
192 Ga0207428_10013589 3300027907 Bacteria 7105
193 Ga0207428_10027870 3300027907 Bacteria 4699
194 Ga0207428_10032056 3300027907 Bacteria 4327
195 Ga0207428_10164524 3300027907 Bacteria 1683
196 Ga0268266_10777229 3300028379 Bacteria 925
197 Ga0268265_10071080 3300028380 Bacteria 2709
198 Ga0268265_10358301 3300028380 Bacteria 1334
199 Ga0268264_10318588 3300028381 Bacteria 1469
200 Ga0307405_10043814 3300031731 Bacteria 2733
201 Ga0307409_100643334 3300031995 Unclassified 1053
202 Ga0307415_100051574 3300032126 Bacteria 2793
203 Ga0307415_100265846 3300032126 Bacteria 1402
204 Ga0373941_0021656 3300035115 Bacteria 1817
205 Ga0373960_0002634 3300035121 Bacteria 4059
206 Ga0373962_0019466 3300035242 Bacteria 1776
207 Ga0373937_0361198 3300036401 Bacteria 1376
208 Ga0395899_0011985 3300037312 Bacteria 6642
209 Ga0395899_0024595 3300037312 Bacteria 4552
210 Ga0395899_0033557 3300037312 Bacteria 3854
211 Ga0395899_0053386 3300037312 Bacteria 2992
212 Ga0395900_0002309 3300037418 Bacteria 21165
213 Ga0395900_0005619 3300037418 Bacteria 13112
214 Ga0395900_0007601 3300037418 Bacteria 11195
215 Ga0395900_0010901 3300037418 Bacteria 9295
216 Ga0395900_0011282 3300037418 Bacteria 9139
217 Ga0395900_0063448 3300037418 Bacteria 3797
218 Ga0395900_0106484 3300037418 Bacteria 2880
219 Ga0395900_0110898 3300037418 Bacteria 2818
220 Ga0395900_0138096 3300037418 Bacteria 2497
221 Ga0395900_0163795 3300037418 Bacteria 2267
222 Ga0395900_0174580 3300037418 Bacteria 2186
223 Ga0395900_0251457 3300037418 Bacteria 1769
224 Ga0395900_0298027 3300037418 Bacteria 1599
225 Ga0395898_0002516 3300037466 Bacteria 21550
226 Ga0395898_0007843 3300037466 Bacteria 11332
227 Ga0395898_0015553 3300037466 Bacteria 7803
228 Ga0395898_0019770 3300037466 Bacteria 6848
229 Ga0395898_0020538 3300037466 Bacteria 6708
230 Ga0395898_0095427 3300037466 Bacteria 2857
231 Ga0395898_0132824 3300037466 Bacteria 2383
232 Ga0395898_0160234 3300037466 Bacteria 2152
233 Ga0395898_0170186 3300037466 Bacteria 2082
234 Ga0395898_0203489 3300037466 Bacteria 1889
235 Ga0395898_0206430 3300037466 Bacteria 1875
236 Ga0395898_0239573 3300037466 Bacteria 1730
237 Ga0395898_0622492 3300037466 Unclassified 1022
238 Ga0395905_0010076 3300037471 Bacteria 9211
239 Ga0395905_0011356 3300037471 Bacteria 8613
240 Ga0395905_0011624 3300037471 Bacteria 8502
241 Ga0395905_0015204 3300037471 Bacteria 7320
242 Ga0395905_0057043 3300037471 Bacteria 3652
243 Ga0395905_0089358 3300037471 Bacteria 2887
244 Ga0395905_0226685 3300037471 Bacteria 1748
245 Ga0395905_0439163 3300037471 Unclassified 1202
246 Ga0395905_0500367 3300037471 Bacteria 1115
247 Ga0395901_0003590 3300038443 Bacteria 15642
248 Ga0395901_0004168 3300038443 Bacteria 14592
249 Ga0395901_0018656 3300038443 Bacteria 7085
250 Ga0395901_0026864 3300038443 Bacteria 5910
251 Ga0395901_0035305 3300038443 Bacteria 5165
252 Ga0395901_0037035 3300038443 Bacteria 5045
253 Ga0395901_0043487 3300038443 Bacteria 4659
254 Ga0395901_0050674 3300038443 Bacteria 4312
255 Ga0395901_0051836 3300038443 Bacteria 4265
256 Ga0395901_0061498 3300038443 Bacteria 3908
257 Ga0395901_0083659 3300038443 Bacteria 3335
258 Ga0395901_0166267 3300038443 Bacteria 2316
259 Ga0395901_0167028 3300038443 Bacteria 2310
260 Ga0395901_0186326 3300038443 Bacteria 2176
261 Ga0395901_0365863 3300038443 Bacteria 1486
262 Ga0395901_0428431 3300038443 Bacteria 1356
263 Ga0439431_0027247 3300041997 Bacteria 1403
264 Ga0439433_0000973 3300041999 Bacteria 5764
265 Ga0439457_011066 3300042014 Bacteria 2060
266 Ga0439462_0005591 3300042015 Bacteria 3103
267 Ga0439446_0001113 3300042156 Bacteria 5947
268 Ga0439434_0018653 3300042435 Bacteria 2078
269 Ga0439464_0159570 3300042439 Bacteria 708
270 Ga0439460_0044465 3300042461 Bacteria 1315
271 Ga0466967_0012678 3300045976 Bacteria 6468
272 Ga0495603_0003366 3300046455 Bacteria 9515
273 Ga0495629_0020571 3300046459 Bacteria 4713
274 Ga0495641_0020729 3300046461 Bacteria 3324
275 Ga0495582_0130438 3300046473 Bacteria 1420
276 Ga0495662_0134302 3300046476 Bacteria 1217
277 Ga0495584_0122040 3300046491 Bacteria 1320
278 Ga0495637_0105997 3300046520 Unclassified 1094
279 Ga0495644_0023069 3300046523 Bacteria 2370
280 Ga0495652_0104690 3300046529 Bacteria 2288
281 Ga0495586_0099841 3300046535 Bacteria 1610
282 Ga0495609_0078313 3300046538 Bacteria 1447
283 Ga0495656_0008496 3300046615 Bacteria 3667
284 Ga0495656_0018260 3300046615 Bacteria 2690
285 Ga0495656_0217866 3300046615 Bacteria 953
286 Ga0495634_0010292 3300046642 Bacteria 6855
287 Ga0495647_0016166 3300046681 Bacteria 2624
288 Ga0495658_0045571 3300046683 Bacteria 2461
289 Ga0495613_0022848 3300046689 Bacteria 4660
290 Ga0495670_0082904 3300046691 Bacteria 1635
291 Ga0495589_0055546 3300046794 Bacteria 1951
292 Ga0495581_0043530 3300047315 Bacteria 2597
293 Ga0495674_0187787 3300047319 Bacteria 1719
294 Ga0495676_0038811 3300047321 Bacteria 3952
295 Ga0496100_0093523 3300048903 Bacteria 2057
296 Ga0496101_0086015 3300048904 Bacteria 2331
297 Ga0496101_0176796 3300048904 Bacteria 1642
298 Ga0496102_0093680 3300048905 Bacteria 2783
299 Ga0496102_0105386 3300048905 Bacteria 2623
300 Ga0496102_0337020 3300048905 Bacteria 1420
301 Ga0496103_0025585 3300048906 Bacteria 3568
302 Ga0496103_0029870 3300048906 Bacteria 3314
303 Ga0496104_0018484 3300048907 Bacteria 6360
304 Ga0496104_0060633 3300048907 Bacteria 3584
305 Ga0496104_0077870 3300048907 Bacteria 3159
306 Ga0496104_0081669 3300048907 Bacteria 3083
307 Ga0496104_0095216 3300048907 Bacteria 2848
308 Ga0496104_0537962 3300048907 Bacteria 1079
309 Ga0496104_0635387 3300048907 Bacteria 977
310 Ga0496105_0029909 3300048908 Bacteria 4460
311 Ga0496105_0046258 3300048908 Bacteria 3592
312 Ga0496105_0073913 3300048908 Bacteria 2816
313 Ga0496105_0095097 3300048908 Bacteria 2461
314 Ga0496105_0097100 3300048908 Bacteria 2433
315 Ga0496105_0191007 3300048908 Bacteria 1674
316 Ga0496106_0031854 3300048909 Bacteria 3929
317 Ga0496106_0405879 3300048909 Bacteria 1095
318 Ga0496107_0041998 3300048910 Bacteria 3285
319 Ga0496107_0119704 3300048910 Bacteria 1939
320 Ga0496108_0015769 3300048911 Bacteria 6159
321 Ga0496108_0073613 3300048911 Bacteria 2884
322 Ga0496108_0101489 3300048911 Bacteria 2454
323 Ga0496108_0349341 3300048911 Unclassified 1290
324 Ga0496109_0003941 3300048912 Bacteria 12400
325 Ga0496109_0029419 3300048912 Bacteria 4919
326 Ga0496109_0034272 3300048912 Bacteria 4571
327 Ga0496109_0237120 3300048912 Bacteria 1716
328 Ga0496109_0350466 3300048912 Bacteria 1395
329 Ga0496109_0362655 3300048912 Bacteria 1369
330 Ga0496109_0787344 3300048912 Bacteria 889
331 Ga0496110_0000093 3300048913 Bacteria 48032
332 Ga0496110_0016353 3300048913 Bacteria 6194
333 Ga0496110_0055126 3300048913 Bacteria 3497
334 Ga0496110_0169531 3300048913 Bacteria 1980
335 Ga0496110_0236288 3300048913 Bacteria 1663
336 Ga0496111_0000166 3300048914 Bacteria 29882
337 Ga0496111_0001621 3300048914 Bacteria 13022
338 Ga0496111_0003100 3300048914 Bacteria 10224
339 Ga0496111_0018225 3300048914 Bacteria 4862
340 Ga0496111_0047782 3300048914 Bacteria 3082
341 Ga0496111_0136676 3300048914 Bacteria 1816
342 Ga0496112_0060652 3300048915 Bacteria 3728
343 Ga0496112_0146150 3300048915 Bacteria 2333
344 Ga0496112_0192172 3300048915 Bacteria 2003
345 Ga0496112_0211778 3300048915 Bacteria 1895
346 Ga0496113_0242936 3300048916 Bacteria 1437
347 Ga0496113_0331010 3300048916 Unclassified 1221
348 Ga0496114_0027285 3300048917 Bacteria 4677
349 Ga0496114_0043916 3300048917 Bacteria 3706
350 Ga0496114_0077572 3300048917 Bacteria 2801
351 Ga0496114_0098990 3300048917 Bacteria 2487
352 Ga0496114_0286356 3300048917 Bacteria 1453
353 Ga0496114_0341255 3300048917 Bacteria 1324
354 Ga0496115_0024399 3300048918 Bacteria 4699
355 Ga0496115_0079690 3300048918 Bacteria 2666
356 Ga0501031_0003083 3300049568 Bacteria 10659
357 Ga0501031_0282587 3300049568 Bacteria 1076
358 Ga0501032_0003723 3300049569 Bacteria 11565
359 Ga0501032_0048600 3300049569 Bacteria 2864
360 Ga0501033_0004418 3300049570 Bacteria 11253
361 Ga0501033_0006390 3300049570 Bacteria 9231
362 Ga0501033_0095740 3300049570 Bacteria 2170
363 Ga0501034_0226266 3300049571 Bacteria 1821
364 Ga0501036_0057148 3300049572 Bacteria 3305
365 Ga0501036_0064149 3300049572 Bacteria 3109
366 Ga0501036_0091711 3300049572 Bacteria 2566
367 Ga0501037_0002305 3300049573 Bacteria 13782
368 Ga0501037_0050128 3300049573 Bacteria 3056
369 Ga0501037_0107712 3300049573 Bacteria 2008
370 Ga0501038_0003053 3300049574 Bacteria 15609
371 Ga0501038_0062630 3300049574 Bacteria 3178
372 Ga0501038_0264206 3300049574 Bacteria 1359
373 Ga0501039_0010383 3300049575 Bacteria 7102
374 Ga0501039_0126191 3300049575 Bacteria 2007
375 Ga0501040_0047225 3300049576 Bacteria 2940
376 Ga0501041_0012897 3300049577 Bacteria 4951
377 Ga0501041_0015331 3300049577 Bacteria 4550
378 Ga0501042_0006858 3300049578 Bacteria 7432
379 Ga0501042_0032597 3300049578 Bacteria 3690
380 Ga0501042_0275314 3300049578 Bacteria 1215
381 Ga0501043_0004984 3300049579 Bacteria 10743
382 Ga0501043_0083385 3300049579 Bacteria 2513
383 Ga0501046_0002794 3300049580 Bacteria 16252
384 Ga0501046_0017258 3300049580 Bacteria 6028
385 Ga0501048_0017294 3300049582 Bacteria 5312
386 Ga0501048_0027909 3300049582 Bacteria 4099
387 Ga0501067_0000249 3300049583 Bacteria 29614
388 Ga0501067_0021488 3300049583 Bacteria 3571
389 Ga0501068_0001200 3300049584 Bacteria 13782
390 Ga0501068_0011919 3300049584 Bacteria 4916
391 Ga0501068_0085471 3300049584 Bacteria 1941
392 Ga0501068_0132946 3300049584 Bacteria 1556
393 Ga0501069_0045998 3300049585 Bacteria 2419
394 Ga0501069_0088232 3300049585 Bacteria 1752
395 Ga0501069_0089064 3300049585 Bacteria 1744
396 Ga0501069_0095025 3300049585 Bacteria 1688
397 Ga0501070_0004259 3300049586 Bacteria 12303
398 Ga0501070_0024753 3300049586 Bacteria 5035
399 Ga0501070_0109204 3300049586 Bacteria 2286
400 Ga0501071_0020727 3300049587 Bacteria 4571
401 Ga0501072_0004166 3300049588 Bacteria 10946
402 Ga0501072_0043072 3300049588 Bacteria 3547
403 Ga0501072_0073105 3300049588 Bacteria 2710
404 Ga0501072_0121200 3300049588 Bacteria 2083
405 Ga0501073_0002583 3300049589 Bacteria 13536
406 Ga0501073_0056090 3300049589 Bacteria 2756
407 Ga0501074_0011751 3300049590 Bacteria 6362
408 Ga0501074_0018639 3300049590 Bacteria 5043
409 Ga0501074_0143609 3300049590 Bacteria 1707
410 Ga0501075_0023669 3300049591 Bacteria 4498
411 Ga0501075_0047629 3300049591 Bacteria 3221
412 Ga0501076_0013732 3300049592 Bacteria 6075
413 Ga0501076_0022595 3300049592 Bacteria 4835
414 Ga0501077_0011224 3300049593 Bacteria 5590
415 Ga0501077_0019715 3300049593 Bacteria 4266
416 Ga0501079_0023934 3300049741 Bacteria 4685
417 Ga0501079_0029725 3300049741 Bacteria 4197
418 Ga0501079_0041336 3300049741 Bacteria 3558
419 Ga0501079_0064675 3300049741 Bacteria 2821
420 Ga0501080_0008230 3300049742 Bacteria 9442
421 Ga0501080_0017670 3300049742 Bacteria 6597
422 Ga0501080_0026496 3300049742 Bacteria 5386
423 Ga0501080_0531219 3300049742 Bacteria 1049
424 Ga0501081_0057679 3300049743 Bacteria 2685
425 Ga0501081_0344549 3300049743 Bacteria 1097
426 Ga0501083_0001500 3300049744 Bacteria 15941
427 Ga0501083_0003385 3300049744 Bacteria 11170
428 Ga0501083_0035830 3300049744 Bacteria 3389
429 Ga0501083_0437808 3300049744 Bacteria 851
430 Ga0501035_0003956 3300049822 Bacteria 14132
431 Ga0501035_0042909 3300049822 Bacteria 4077
432 Ga0501044_0043745 3300049823 Bacteria 4651
433 Ga0501044_0076986 3300049823 Bacteria 3384
434 Ga0501045_0006922 3300049824 Bacteria 7857
435 Ga0501045_0009656 3300049824 Bacteria 6751
436 Ga0501045_0074571 3300049824 Bacteria 2498
437 nmdc:mga05p37_30066_c1 3300050507 Bacteria 6629
438 nmdc:mga05p37_31730_c1 3300050507 Bacteria 6456
439 nmdc:mga06r32_193108_c1 3300050510 Bacteria 2023
440 nmdc:mga08y16_37031_c1 3300050511 Bacteria 5124
441 nmdc:mga08y16_394343_c1 3300050511 Bacteria 1417
442 nmdc:mga08y16_39679_c1 3300050511 Bacteria 4939
443 nmdc:mga08y16_56371_c1 3300050511 Bacteria 4107
444 nmdc:mga08y16_578593_c1 3300050511 Unclassified 1134
445 nmdc:mga0n895_350903_c1 3300050512 Bacteria 1494
446 nmdc:mga0n895_381161_c1 3300050512 Bacteria 1427
447 nmdc:mga0n895_438607_c1 3300050512 Bacteria 1319
448 nmdc:mga0rr50_352289_c1 3300050513 Unclassified 1238
449 nmdc:mga0a205_243191_c1 3300050515 Bacteria 1680
450 nmdc:mga0a205_437936_c1 3300050515 Unclassified 1168
451 Ga0495601_0170679 3300053077 Bacteria 1422
452 Ga0495619_0041655 3300053085 Bacteria 3005
453 Ga0501084_0083838 3300054114 Bacteria 2675
454 Ga0501084_0188672 3300054114 Bacteria 1739
455 Ga0501084_0190916 3300054114 Bacteria 1728
456 Ga0501084_0262654 3300054114 Bacteria 1457
457 Ga0501082_0029102 3300060353 Bacteria 4758
458 Ga0501082_0038562 3300060353 Bacteria 4122
459 Ga0501082_0080023 3300060353 Bacteria 2819
460 Ga0501082_0160474 3300060353 Bacteria 1954
461 Ga0501082_0190507 3300060353 Bacteria 1784
462 Ga0530510_0023435 3300061734 Bacteria 4398
463 Ga0530510_0025262 3300061734 Bacteria 4246
464 Ga0530510_0057409 3300061734 Bacteria 2812
465 Ga0530510_0058154 3300061734 Bacteria 2795
466 Ga0530510_0089467 3300061734 Bacteria 2245
467 nmdc:mga08y16_86323_c1
468 JGI24743J22301_10024751
469 JGI24745J21846_1004276
470 JGI24738J21930_10010224
471 JGI24742J22300_10005665
472 JGI25407J50210_10022769
473 Ga0070658_10039887
474 Ga0070683_100004938
475 Ga0070683_100129673
476 Ga0070683_100324543
477 Ga0070670_100040574
478 Ga0068869_100107458
479 Ga0070680_100172197
480 Ga0070682_100138401
481 Ga0070660_100109697
482 Ga0070691_10014016
483 Ga0070691_10213149
484 Ga0070661_100119564
485 Ga0070692_10005465
486 Ga0070669_100108088
487 Ga0070675_100050258
488 Ga0070675_100094146
489 Ga0070675_100294144
490 Ga0070674_100014478
491 Ga0070674_100041312
492 Ga0070673_100075001
493 Ga0070673_100118371
494 Ga0070673_100220863
495 Ga0070688_100094583
496 Ga0070659_100103755
497 Ga0070701_10027144
498 Ga0070701_10036860
499 Ga0070705_100028057
500 Ga0070700_100026710
501 Ga0070700_100387361
502 Ga0070663_100187495
503 Ga0070678_100025578
504 Ga0070678_100100505
505 Ga0070662_100029662
506 Ga0070681_10006166
507 Ga0070681_10139478
508 Ga0070685_10028410
509 Ga0070699_100223643
510 Ga0070679_100001190
511 Ga0070684_100002475
512 Ga0070684_100098446
513 Ga0070684_100157036
514 Ga0070684_100173994
515 Ga0068853_100055451
516 Ga0070672_100048032
517 Ga0070672_100167737
518 Ga0070693_100008265
519 Ga0070693_100011170
520 Ga0070665_100074293
521 Ga0070665_100467777
522 Ga0070704_100402062
523 Ga0070664_100048331
524 Ga0068854_100042565
525 Ga0068856_100059514
526 Ga0068856_100241029
527 Ga0068856_100421981
528 Ga0070702_100096371
529 Ga0070702_100283214
530 Ga0068852_100027043
531 Ga0068852_100155502
532 Ga0068866_10314030
533 Ga0068851_10154254
534 Ga0068870_10045830
535 Ga0068870_10085870
536 Ga0068860_100038671
537 Ga0068862_100374689
538 Ga0081455_10021172
539 Ga0081455_10036397
540 Ga0081455_10042279
541 Ga0081455_10067810
542 Ga0081455_10394236
543 Ga0081538_10000148
544 Ga0081538_10035699
545 Ga0081539_10004647
546 Ga0070712_100097421
547 Ga0097621_100106502
548 Ga0068871_100034250
549 Ga0075430_100161571
550 Ga0075431_100353463
551 Ga0075433_10364104
552 Ga0075434_100216462
553 Ga0075434_100413937
554 Ga0075434_100570436
555 Ga0068865_100003888
556 Ga0105240_10542376
557 Ga0111539_10006713
558 Ga0111539_10032740
559 Ga0111539_10073693
560 Ga0111539_10087164
561 Ga0111539_10197998
562 Ga0111539_10482219
563 Ga0105245_10023499
564 Ga0105245_10050392
565 Ga0114129_10139027
566 Ga0105243_10007084
567 Ga0105243_10046329
568 Ga0105243_10054561
569 Ga0105241_10045502
570 Ga0105242_10038642
571 Ga0105242_10110410
572 Ga0105242_10305361
573 Ga0105242_10355702
574 Ga0105248_10077116
575 Ga0105248_10124102
576 Ga0105248_10522801
577 Ga0105249_10042523
578 Ga0105249_10124561
579 Ga0105249_10206469
580 Ga0105239_10863955
581 Ga0105246_10046077
582 Ga0105246_10233957
583 Ga0157373_10087234
584 Ga0157373_10220970
585 Ga0157371_10006491
586 Ga0157369_10100923
587 Ga0157369_10616159
588 Ga0157374_10227472
589 Ga0157374_10545100
590 Ga0157378_10626938
591 Ga0157372_11050494
592 Ga0157375_10109941
593 Ga0163163_10285281
594 Ga0157380_10012416
595 Ga0157380_10069271
596 Ga0182008_10001520
597 Ga0157377_10022566
598 Ga0157379_10389629
599 Ga0157379_10449506
600 Ga0157376_10016708
601 Ga0182006_1030633
602 Ga0182007_10007974
603 Ga0207653_10002819
604 Ga0207642_10088423
605 Ga0207642_10263662
606 Ga0207710_10053496
607 Ga0207688_10037640
608 Ga0207647_10054124
609 Ga0207645_10075949
610 Ga0207643_10005890
611 Ga0207643_10106368
612 Ga0207705_10035882
613 Ga0207654_10069871
614 Ga0207707_10019870
615 Ga0207663_10223144
616 Ga0207660_10025621
617 Ga0207662_10028116
618 Ga0207646_10464532
619 Ga0207681_10149571
620 Ga0207650_10102800
621 Ga0207687_10010720
622 Ga0207686_10166944
623 Ga0207709_10014708
624 Ga0207709_10019168
625 Ga0207709_10040983
626 Ga0207709_10099476
627 Ga0207669_10120867
628 Ga0207704_10223799
629 Ga0207691_10008491
630 Ga0207691_10034457
631 Ga0207691_10060603
632 Ga0207711_10383425
633 Ga0207711_10495175
634 Ga0207689_10100922
635 Ga0207661_10057948
636 Ga0207661_10085340
637 Ga0207651_10040948
638 Ga0207712_10032702
639 Ga0207640_10023708
640 Ga0207658_10099682
641 Ga0207677_10423905
642 Ga0207677_10488935
643 Ga0207703_10174470
644 Ga0207678_10014852
645 Ga0207708_10006349
646 Ga0207708_10012518
647 Ga0207708_10186733
648 Ga0207702_10454797
649 Ga0207648_10062261
650 Ga0207648_10087502
651 Ga0207648_10382849
652 Ga0207674_10024216
653 Ga0207675_100008588
654 Ga0207675_100682655
655 Ga0207683_10013857
656 Ga0207698_10028608
657 Ga0207698_10032464
658 Ga0207428_10013589
659 Ga0207428_10027870
660 Ga0207428_10032056
661 Ga0207428_10164524
662 Ga0268266_10777229
663 Ga0268265_10071080
664 Ga0268265_10358301
665 Ga0268264_10318588
666 Ga0307405_10043814
667 Ga0307409_100643334
668 Ga0307415_100051574
669 Ga0307415_100265846
670 Ga0373941_0021656
671 Ga0373960_0002634
672 Ga0373962_0019466
673 Ga0373937_0361198
674 Ga0395899_0011985
675 Ga0395899_0024595
676 Ga0395899_0033557
677 Ga0395899_0053386
678 Ga0395900_0002309
679 Ga0395900_0005619
680 Ga0395900_0007601
681 Ga0395900_0010901
682 Ga0395900_0011282
683 Ga0395900_0063448
684 Ga0395900_0106484
685 Ga0395900_0110898
686 Ga0395900_0138096
687 Ga0395900_0163795
688 Ga0395900_0174580
689 Ga0395900_0251457
690 Ga0395900_0298027
691 Ga0395898_0002516
692 Ga0395898_0007843
693 Ga0395898_0015553
694 Ga0395898_0019770
695 Ga0395898_0020538
696 Ga0395898_0095427
697 Ga0395898_0132824
698 Ga0395898_0160234
699 Ga0395898_0170186
700 Ga0395898_0203489
701 Ga0395898_0206430
702 Ga0395898_0239573
703 Ga0395898_0622492
704 Ga0395905_0010076
705 Ga0395905_0011356
706 Ga0395905_0011624
707 Ga0395905_0015204
708 Ga0395905_0057043
709 Ga0395905_0089358
710 Ga0395905_0226685
711 Ga0395905_0439163
712 Ga0395905_0500367
713 Ga0395901_0003590
714 Ga0395901_0004168
715 Ga0395901_0018656
716 Ga0395901_0026864
717 Ga0395901_0035305
718 Ga0395901_0037035
719 Ga0395901_0043487
720 Ga0395901_0050674
721 Ga0395901_0051836
722 Ga0395901_0061498
723 Ga0395901_0083659
724 Ga0395901_0166267
725 Ga0395901_0167028
726 Ga0395901_0186326
727 Ga0395901_0365863
728 Ga0395901_0428431
729 Ga0439431_0027247
730 Ga0439433_0000973
731 Ga0439457_011066
732 Ga0439462_0005591
733 Ga0439446_0001113
734 Ga0439434_0018653
735 Ga0439464_0159570
736 Ga0439460_0044465
737 Ga0466967_0012678
738 Ga0495603_0003366
739 Ga0495629_0020571
740 Ga0495641_0020729
741 Ga0495582_0130438
742 Ga0495662_0134302
743 Ga0495584_0122040
744 Ga0495637_0105997
745 Ga0495644_0023069
746 Ga0495652_0104690
747 Ga0495586_0099841
748 Ga0495609_0078313
749 Ga0495656_0008496
750 Ga0495656_0018260
751 Ga0495656_0217866
752 Ga0495634_0010292
753 Ga0495647_0016166
754 Ga0495658_0045571
755 Ga0495613_0022848
756 Ga0495670_0082904
757 Ga0495589_0055546
758 Ga0495581_0043530
759 Ga0495674_0187787
760 Ga0495676_0038811
761 Ga0496100_0093523
762 Ga0496101_0086015
763 Ga0496101_0176796
764 Ga0496102_0093680
765 Ga0496102_0105386
766 Ga0496102_0337020
767 Ga0496103_0025585
768 Ga0496103_0029870
769 Ga0496104_0018484
770 Ga0496104_0060633
771 Ga0496104_0077870
772 Ga0496104_0081669
773 Ga0496104_0095216
774 Ga0496104_0537962
775 Ga0496104_0635387
776 Ga0496105_0029909
777 Ga0496105_0046258
778 Ga0496105_0073913
779 Ga0496105_0095097
780 Ga0496105_0097100
781 Ga0496105_0191007
782 Ga0496106_0031854
783 Ga0496106_0405879
784 Ga0496107_0041998
785 Ga0496107_0119704
786 Ga0496108_0015769
787 Ga0496108_0073613
788 Ga0496108_0101489
789 Ga0496108_0349341
790 Ga0496109_0003941
791 Ga0496109_0029419
792 Ga0496109_0034272
793 Ga0496109_0237120
794 Ga0496109_0350466
795 Ga0496109_0362655
796 Ga0496109_0787344
797 Ga0496110_0000093
798 Ga0496110_0016353
799 Ga0496110_0055126
800 Ga0496110_0169531
801 Ga0496110_0236288
802 Ga0496111_0000166
803 Ga0496111_0001621
804 Ga0496111_0003100
805 Ga0496111_0018225
806 Ga0496111_0047782
807 Ga0496111_0136676
808 Ga0496112_0060652
809 Ga0496112_0146150
810 Ga0496112_0192172
811 Ga0496112_0211778
812 Ga0496113_0242936
813 Ga0496113_0331010
814 Ga0496114_0027285
815 Ga0496114_0043916
816 Ga0496114_0077572
817 Ga0496114_0098990
818 Ga0496114_0286356
819 Ga0496114_0341255
820 Ga0496115_0024399
821 Ga0496115_0079690
822 Ga0501031_0003083
823 Ga0501031_0282587
824 Ga0501032_0003723
825 Ga0501032_0048600
826 Ga0501033_0004418
827 Ga0501033_0006390
828 Ga0501033_0095740
829 Ga0501034_0226266
830 Ga0501036_0057148
831 Ga0501036_0064149
832 Ga0501036_0091711
833 Ga0501037_0002305
834 Ga0501037_0050128
835 Ga0501037_0107712
836 Ga0501038_0003053
837 Ga0501038_0062630
838 Ga0501038_0264206
839 Ga0501039_0010383
840 Ga0501039_0126191
841 Ga0501040_0047225
842 Ga0501041_0012897
843 Ga0501041_0015331
844 Ga0501042_0006858
845 Ga0501042_0032597
846 Ga0501042_0275314
847 Ga0501043_0004984
848 Ga0501043_0083385
849 Ga0501046_0002794
850 Ga0501046_0017258
851 Ga0501048_0017294
852 Ga0501048_0027909
853 Ga0501067_0000249
854 Ga0501067_0021488
855 Ga0501068_0001200
856 Ga0501068_0011919
857 Ga0501068_0085471
858 Ga0501068_0132946
859 Ga0501069_0045998
860 Ga0501069_0088232
861 Ga0501069_0089064
862 Ga0501069_0095025
863 Ga0501070_0004259
864 Ga0501070_0024753
865 Ga0501070_0109204
866 Ga0501071_0020727
867 Ga0501072_0004166
868 Ga0501072_0043072
869 Ga0501072_0073105
870 Ga0501072_0121200
871 Ga0501073_0002583
872 Ga0501073_0056090
873 Ga0501074_0011751
874 Ga0501074_0018639
875 Ga0501074_0143609
876 Ga0501075_0023669
877 Ga0501075_0047629
878 Ga0501076_0013732
879 Ga0501076_0022595
880 Ga0501077_0011224
881 Ga0501077_0019715
882 Ga0501079_0023934
883 Ga0501079_0029725
884 Ga0501079_0041336
885 Ga0501079_0064675
886 Ga0501080_0008230
887 Ga0501080_0017670
888 Ga0501080_0026496
889 Ga0501080_0531219
890 Ga0501081_0057679
891 Ga0501081_0344549
892 Ga0501083_0001500
893 Ga0501083_0003385
894 Ga0501083_0035830
895 Ga0501083_0437808
896 Ga0501035_0003956
897 Ga0501035_0042909
898 Ga0501044_0043745
899 Ga0501044_0076986
900 Ga0501045_0006922
901 Ga0501045_0009656
902 Ga0501045_0074571
903 nmdc:mga05p37_30066_c1
904 nmdc:mga05p37_31730_c1
905 nmdc:mga06r32_193108_c1
906 nmdc:mga08y16_37031_c1
907 nmdc:mga08y16_394343_c1
908 nmdc:mga08y16_39679_c1
909 nmdc:mga08y16_56371_c1
910 nmdc:mga08y16_578593_c1
911 nmdc:mga0n895_350903_c1
912 nmdc:mga0n895_381161_c1
913 nmdc:mga0n895_438607_c1
914 nmdc:mga0rr50_352289_c1
915 nmdc:mga0a205_243191_c1
916 nmdc:mga0a205_437936_c1
917 Ga0495601_0170679
918 Ga0495619_0041655
919 Ga0501084_0083838
920 Ga0501084_0188672
921 Ga0501084_0190916
922 Ga0501084_0262654
923 Ga0501082_0029102
924 Ga0501082_0038562
925 Ga0501082_0080023
926 Ga0501082_0160474
927 Ga0501082_0190507
928 Ga0530510_0023435
929 Ga0530510_0025262
930 Ga0530510_0057409
931 Ga0530510_0058154
932 Ga0530510_0089467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

67

233

0.97

Map