F449658

General Info

Members Datasets Scaffolds Average Seq Length
466 356 930 273

Family's Representative Sequence

Representative Sequence 3300009766|Ga0123342_1000455|Ga0123342_100045539
Length 301
Sequence MSASYAKKRITTTSITAMKGVQPIVSLTAYTTPIARLLDPHCDLLLVGDSVGMVLYGMDTTVGVTMEMMIAHGHAVMRGAQNSCVIVDLPFGSYQASKEQAFENATRIMKETGCDGVKLEGGEEMAETVNFLTKRGIPVFGHVGLMPQLVNSLGGFRSLGRTDQEANKIRRDASAIAAAGAFAVVIEGTIEPLAREVSQSLSIPTVGIGASAACDGQVLVSDDMLALFSDFRPRFVKQYANLAPIVAQAAEAYAREVKAGIFPGPEHTFQPKQKKVQLKPASNSSEDDKDRECNDRTTVDC

Samples

Sample ID Description Type Environment
1 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
105 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
106 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
107 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
192 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
193 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
194 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
201 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
207 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
208 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
209 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
210 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
211 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
212 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
213 2534681786 Brucella suis 92/29 Isolate Unclassified
214 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
215 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
216 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
217 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
218 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
219 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
220 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
221 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
222 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
223 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
224 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
225 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
226 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
227 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
228 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
229 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
230 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
231 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
232 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
233 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
234 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
235 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
236 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
237 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
238 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
239 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
240 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
241 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
242 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
243 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
244 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
245 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
246 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
247 2643221557 Ensifer sp. Root558 Isolate Unclassified
248 2643221558 Rhizobium sp. Root149 Isolate Unclassified
249 2643221607 Rhizobium sp. Root73 Isolate Unclassified
250 2643221610 Ensifer sp. Root74 Isolate Unclassified
251 2643221618 Ensifer sp. Root231 Isolate Unclassified
252 2643221626 Ensifer sp. Root31 Isolate Unclassified
253 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
254 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
255 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
256 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
257 2643221655 Ensifer sp. Root1252 Isolate Unclassified
258 2643221659 Ensifer sp. Root127 Isolate Unclassified
259 2643221668 Ensifer sp. Root423 Isolate Unclassified
260 2643221675 Ensifer sp. Root1298 Isolate Unclassified
261 2643221680 Ensifer sp. Root1312 Isolate Unclassified
262 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
263 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
264 2643221693 Rhizobium sp. Root491 Isolate Unclassified
265 2643221698 Ensifer sp. Root142 Isolate Unclassified
266 2643221712 Ensifer sp. Root258 Isolate Unclassified
267 2643221719 Rhizobium sp. Root274 Isolate Unclassified
268 2643221723 Ensifer sp. Root278 Isolate Unclassified
269 2643221726 Ensifer sp. Root954 Isolate Unclassified
270 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
271 2738541293 Rhizobium sp. GV031 Isolate Unclassified
272 2751185800 Brucella pituitosa AA2 Isolate Unclassified
273 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
274 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
275 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
276 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
277 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
278 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
279 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
280 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
281 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
282 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
283 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
284 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
285 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
286 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
287 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
288 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
289 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
290 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
291 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
292 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
293 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
294 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
295 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
296 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
297 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
298 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
299 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
300 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
301 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
302 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
303 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
304 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
305 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
306 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
307 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
308 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
309 2844163670 Ensifer sp. 1H6 Isolate Unclassified
310 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
311 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
312 2854911287 Brucella lupini LUP21 Isolate Unclassified
313 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
314 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
315 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
316 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
317 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
318 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
319 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
320 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
321 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
322 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
323 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
324 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
325 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
326 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
327 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
328 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
329 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
330 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
331 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
332 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
333 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
334 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
335 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
336 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
337 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
338 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
339 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
340 2996887358 Rhizobium sp. R711 Isolate Nodule
341 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
342 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
343 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
344 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
345 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
346 8005258706 Rhizobium sp. R693 Isolate Nodule
347 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
348 8005321885 Rhizobium sp. R72 Isolate Nodule
349 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
350 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
351 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
352 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
353 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
354 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
355 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
356 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.38
Metatranscriptomes 0.21
Isolates 32.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 18.88
Nodule 10.52
Rhizoplane 6.44
Rhizosphere 35.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0123342_1000455 3300009766 Bacteria 64500
2 JGI24740J21852_10000015 3300001979 Bacteria 58951
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25156J39149_1000001 3300002705 Bacteria 354557
5 JGI25162J39368_1000328 3300002737 Bacteria 41728
6 JGI25162J39368_1000568 3300002737 Bacteria 27099
7 JGI25154J39366_1000150 3300002738 Bacteria 54544
8 JGI25157J39369_1000044 3300002741 Bacteria 122466
9 JGI25152J39213_1000381 3300002773 Bacteria 27228
10 JGI25150J39212_1000079 3300002774 Bacteria 58559
11 JGI25159J45721_1000693 3300002987 Bacteria 14745
12 JGI25151J46595_10000007 3300003187 Bacteria 411751
13 JGI25151J46595_10025740 3300003187 Bacteria 2388
14 JGI25165J46597_1000381 3300003214 Bacteria 48196
15 JGI25165J46597_1000543 3300003214 Bacteria 34671
16 JGI25153J46596_10006855 3300003215 Bacteria 5692
17 JGI25160J50197_1000001 3300003354 Bacteria 782301
18 JGI25160J50197_1000020 3300003354 Bacteria 232739
19 JGI25161J50226_1000001 3300003374 Bacteria 655036
20 JGI25161J50226_1000657 3300003374 Bacteria 13842
21 Ga0055539_1005535 3300003752 Bacteria 1638
22 Ga0055526_1001886 3300003771 Bacteria 14532
23 Ga0055526_1017561 3300003771 Bacteria 2726
24 Ga0055524_1013170 3300003775 Bacteria 3133
25 Ga0055524_1030742 3300003775 Bacteria 1560
26 Ga0055536_1001928 3300003781 Bacteria 11997
27 Ga0055528_1005497 3300003790 Bacteria 5889
28 Ga0055540_1011135 3300003792 Bacteria 2930
29 Ga0055543_1000003 3300004625 Bacteria 358656
30 Ga0055543_1000047 3300004625 Bacteria 111073
31 Ga0065165_1000013 3300005262 Bacteria 301887
32 Ga0065165_1000068 3300005262 Bacteria 170609
33 Ga0070683_100105695 3300005329 Bacteria 2654
34 Ga0070670_100007282 3300005331 Bacteria 9384
35 Ga0070666_10197566 3300005335 Bacteria 1414
36 Ga0070669_100046080 3300005353 Bacteria 3179
37 Ga0070671_100515054 3300005355 Bacteria 1030
38 Ga0070665_100011322 3300005548 Bacteria 9022
39 Ga0070665_100159016 3300005548 Bacteria 2261
40 Ga0068855_100083033 3300005563 Bacteria 3712
41 Ga0068852_100022148 3300005616 Bacteria 5091
42 Ga0075365_10045083 3300006038 Bacteria 2891
43 Ga0075368_10003338 3300006042 Bacteria 5341
44 Ga0075367_10016312 3300006178 Bacteria 4056
45 Ga0075369_10007738 3300006186 Bacteria 4107
46 Ga0075366_10093565 3300006195 Bacteria 1801
47 Ga0075370_10133323 3300006353 Bacteria 1450
48 Ga0099826_10000080 3300006948 Bacteria 48855
49 Ga0099826_10006901 3300006948 Bacteria 8317
50 Ga0105251_10022177 3300009011 Bacteria 3302
51 Ga0105244_10000297 3300009036 Bacteria 48618
52 Ga0105244_10146779 3300009036 Bacteria 1132
53 Ga0105250_10018112 3300009092 Bacteria 2856
54 Ga0105240_10000076 3300009093 Bacteria 198848
55 Ga0105248_10130847 3300009177 Bacteria 2831
56 Ga0105237_10000226 3300009545 Bacteria 79798
57 Ga0105249_10230495 3300009553 Bacteria 1826
58 Ga0123342_1024231 3300009766 Bacteria 3827
59 Ga0105239_10000641 3300010375 Bacteria 49765
60 Ga0157373_10004987 3300013100 Bacteria 9972
61 Ga0157371_10000002 3300013102 Bacteria 665040
62 Ga0157371_10000084 3300013102 Bacteria 149557
63 Ga0157370_10000143 3300013104 Bacteria 87289
64 Ga0157370_10000455 3300013104 Bacteria 51231
65 Ga0163163_10002984 3300014325 Bacteria 14317
66 Ga0182008_10010583 3300014497 Bacteria 4932
67 Ga0182007_10001342 3300015262 Bacteria 13277
68 Ga0182007_10006068 3300015262 Bacteria 5223
69 Ga0182005_1001263 3300015265 Bacteria 10409
70 Ga0182005_1001367 3300015265 Bacteria 9931
71 Ga0213874_10003901 3300021377 Bacteria 3356
72 Ga0209435_100012 3300025206 Bacteria 401621
73 Ga0209436_100614 3300025208 Bacteria 15265
74 Ga0209672_102574 3300025228 Bacteria 4331
75 Ga0209437_100051 3300025233 Bacteria 392523
76 Ga0209437_100098 3300025233 Bacteria 229766
77 Ga0207425_1000018 3300025245 Bacteria 411841
78 Ga0209646_1000026 3300025246 Bacteria 401621
79 Ga0209026_1000014 3300025250 Bacteria 401621
80 Ga0209677_103577 3300025253 Bacteria 4941
81 Ga0209148_1005017 3300025254 Bacteria 3111
82 Ga0209759_1000012 3300025256 Bacteria 401621
83 Ga0209129_1000026 3300025258 Bacteria 411839
84 Ga0209129_1000315 3300025258 Bacteria 43061
85 Ga0209233_1000048 3300025261 Bacteria 453669
86 Ga0209233_1000069 3300025261 Bacteria 367639
87 Ga0209233_1000260 3300025261 Bacteria 79607
88 Ga0209673_1004433 3300025273 Bacteria 7527
89 Ga0209673_1006006 3300025273 Bacteria 5971
90 Ga0209673_1016387 3300025273 Bacteria 2773
91 Ga0209130_1000003 3300025284 Bacteria 677988
92 Ga0209130_1000034 3300025284 Bacteria 302439
93 Ga0209676_1000482 3300025292 Bacteria 65372
94 Ga0209025_1000035 3300025294 Bacteria 411841
95 Ga0209025_1000140 3300025294 Bacteria 184765
96 Ga0209025_1000314 3300025294 Bacteria 107720
97 Ga0209025_1000478 3300025294 Bacteria 77516
98 Ga0209025_1013577 3300025294 Bacteria 5104
99 Ga0209025_1033332 3300025294 Bacteria 2382
100 Ga0209564_1000013 3300025295 Bacteria 775755
101 Ga0209564_1010591 3300025295 Bacteria 4225
102 Ga0209758_1000040 3300025297 Bacteria 411841
103 Ga0209050_1000646 3300025298 Bacteria 54050
104 Ga0209256_1000618 3300025299 Bacteria 49082
105 Ga0209256_1002360 3300025299 Bacteria 15682
106 Ga0209256_1022929 3300025299 Bacteria 1876
107 Ga0209256_1023261 3300025299 Bacteria 1852
108 Ga0207426_1000006 3300025302 Bacteria 1025969
109 Ga0207426_1000011 3300025302 Bacteria 791203
110 Ga0207426_1001329 3300025302 Bacteria 21086
111 Ga0209051_1002315 3300025303 Bacteria 13868
112 Ga0209051_1011948 3300025303 Bacteria 4240
113 Ga0207656_10055394 3300025321 Bacteria 1726
114 Ga0207655_1000465 3300025728 Bacteria 53059
115 Ga0207713_1049599 3300025735 Bacteria 1681
116 Ga0207713_1054146 3300025735 Bacteria 1575
117 Ga0207695_10000011 3300025913 Bacteria 910221
118 Ga0207671_10000093 3300025914 Bacteria 138939
119 Ga0207681_10038215 3300025923 Bacteria 3179
120 Ga0207650_10002206 3300025925 Bacteria 13610
121 Ga0207690_10133352 3300025932 Bacteria 1821
122 Ga0207661_10082744 3300025944 Bacteria 2655
123 Ga0207679_10259006 3300025945 Bacteria 1483
124 Ga0207678_10243636 3300026067 Bacteria 1540
125 Ga0207698_10441992 3300026142 Bacteria 1253
126 Ga0209371_1001235 3300027312 Bacteria 18370
127 Ga0209371_1001599 3300027312 Bacteria 14748
128 Ga0209282_1000643 3300027666 Bacteria 17216
129 Ga0268266_10123823 3300028379 Bacteria 2304
130 Ga0307515_10001978 3300028794 Bacteria 45366
131 Ga0307515_10050933 3300028794 Bacteria 6187
132 Ga0268256_1000004 3300030500 Bacteria 1122967
133 Ga0268256_1002124 3300030500 Bacteria 10581
134 Ga0268256_1035776 3300030500 Bacteria 1151
135 Ga0307513_10012647 3300031456 Bacteria 10403
136 Ga0307513_10015545 3300031456 Bacteria 9224
137 Ga0265313_10020534 3300031595 Bacteria 3641
138 Ga0307405_10045522 3300031731 Bacteria 2690
139 Ga0307406_10032467 3300031901 Bacteria 3188
140 Ga0307412_10047155 3300031911 Bacteria 2828
141 Ga0307510_10221369 3300033180 Bacteria 1404
142 Ga0373927_0000969 3300035695 Bacteria 21801
143 Ga0373947_0041082 3300035725 Bacteria 2757
144 Ga0436365_0797645 3300039437 Bacteria 1730
145 Ga0436363_0858757 3300039450 Bacteria 3347
146 Ga0436363_1176309 3300039450 Bacteria 1512
147 Ga0439438_000903 3300041405 Bacteria 13195
148 Ga0439447_000153 3300041407 Bacteria 23880
149 Ga0439456_000095 3300042013 Bacteria 30436
150 Ga0439456_002406 3300042013 Bacteria 3770
151 Ga0450900_007102 3300042136 Bacteria 1372
152 Ga0466966_0086419 3300044684 Bacteria 1950
153 Ga0466963_0007418 3300044694 Bacteria 6535
154 Ga0466970_0000440 3300044765 Bacteria 20322
155 Ga0466967_0057314 3300045976 Bacteria 3439
156 Ga0495629_0054062 3300046459 Bacteria 2808
157 Ga0495638_0002790 3300046460 Bacteria 14020
158 Ga0495605_0003910 3300046474 Bacteria 8818
159 Ga0495639_0042479 3300046475 Bacteria 2051
160 Ga0495662_0010152 3300046476 Bacteria 4616
161 Ga0495585_0018399 3300046492 Bacteria 4030
162 Ga0495583_0003274 3300046506 Bacteria 12577
163 Ga0495583_0018866 3300046506 Bacteria 3617
164 Ga0495610_0000970 3300046512 Bacteria 26496
165 Ga0495616_0006252 3300046513 Bacteria 7236
166 Ga0495620_0116216 3300046515 Bacteria 1057
167 Ga0495631_0000920 3300046518 Bacteria 18341
168 Ga0495632_0000099 3300046519 Bacteria 88415
169 Ga0495632_0011350 3300046519 Bacteria 5201
170 Ga0495632_0064552 3300046519 Bacteria 1770
171 Ga0495643_0041531 3300046522 Bacteria 2507
172 Ga0495648_0131652 3300046524 Bacteria 1329
173 Ga0495652_0197643 3300046529 Bacteria 1529
174 Ga0495587_0034524 3300046536 Bacteria 3050
175 Ga0495622_0031140 3300046557 Bacteria 2494
176 Ga0495633_0042098 3300046558 Bacteria 2171
177 Ga0495668_0002306 3300046616 Bacteria 16004
178 Ga0495611_0019391 3300046648 Bacteria 2921
179 Ga0495625_0001510 3300046660 Bacteria 27936
180 Ga0495625_0255029 3300046660 Bacteria 1137
181 Ga0495588_0001944 3300046674 Bacteria 8812
182 Ga0495657_0322065 3300046675 Bacteria 918
183 Ga0495624_0147403 3300046690 Bacteria 1440
184 Ga0495671_0083803 3300046692 Bacteria 1562
185 Ga0495671_0141851 3300046692 Bacteria 1171
186 Ga0495600_0009271 3300046809 Bacteria 6074
187 Ga0495660_0024485 3300046810 Bacteria 3437
188 Ga0495581_0130826 3300047315 Bacteria 1462
189 Ga0495604_0026612 3300047317 Bacteria 4604
190 Ga0495672_0026676 3300047320 Bacteria 3682
191 Ga0495683_0031853 3300047323 Bacteria 2686
192 Ga0495681_0008524 3300047470 Bacteria 6418
193 Ga0495686_0003405 3300047472 Bacteria 13831
194 Ga0495602_0224858 3300048088 Bacteria 1414
195 Ga0496100_0084181 3300048903 Bacteria 2155
196 Ga0496101_0040033 3300048904 Bacteria 3337
197 Ga0496101_0281026 3300048904 Bacteria 1301
198 Ga0496101_0384268 3300048904 Bacteria 1105
199 Ga0496102_0002045 3300048905 Bacteria 17418
200 Ga0496102_0145304 3300048905 Bacteria 2226
201 Ga0496103_0005310 3300048906 Bacteria 7727
202 Ga0496104_0003282 3300048907 Bacteria 13957
203 Ga0496105_0000482 3300048908 Bacteria 26214
204 Ga0496105_0025630 3300048908 Bacteria 4802
205 Ga0496107_0227969 3300048910 Bacteria 1386
206 Ga0496108_0004344 3300048911 Bacteria 11396
207 Ga0496109_0001031 3300048912 Bacteria 23062
208 Ga0496110_0433121 3300048913 Bacteria 1198
209 Ga0496111_0001301 3300048914 Bacteria 14005
210 Ga0496111_0277752 3300048914 Bacteria 1242
211 Ga0496112_0091238 3300048915 Bacteria 3016
212 Ga0496113_0171019 3300048916 Bacteria 1721
213 Ga0496113_0407087 3300048916 Bacteria 1092
214 Ga0496114_0045072 3300048917 Bacteria 3662
215 Ga0496114_0060849 3300048917 Bacteria 3157
216 Ga0496114_0730256 3300048917 Bacteria 867
217 Ga0496115_0027543 3300048918 Bacteria 4446
218 Ga0496116_0003749 3300048919 Bacteria 14861
219 Ga0496116_0005377 3300048919 Bacteria 11917
220 Ga0496116_0007451 3300048919 Bacteria 9704
221 Ga0496116_0055293 3300048919 Bacteria 2608
222 Ga0496117_0000016 3300048920 Bacteria 523642
223 Ga0496117_0002220 3300048920 Bacteria 25130
224 Ga0496117_0008027 3300048920 Bacteria 10120
225 Ga0496117_0085117 3300048920 Bacteria 2060
226 Ga0496117_0096504 3300048920 Bacteria 1886
227 Ga0496117_0164315 3300048920 Bacteria 1296
228 Ga0496118_0000153 3300048921 Bacteria 122419
229 Ga0496118_0002458 3300048921 Bacteria 24916
230 Ga0496118_0010971 3300048921 Bacteria 8904
231 Ga0496118_0021459 3300048921 Bacteria 5682
232 Ga0496119_0002118 3300048922 Bacteria 22340
233 Ga0496119_0003693 3300048922 Bacteria 15671
234 Ga0496119_0022223 3300048922 Bacteria 4551
235 Ga0496119_0049723 3300048922 Bacteria 2590
236 Ga0496119_0085986 3300048922 Bacteria 1798
237 Ga0496120_0000423 3300048923 Bacteria 67509
238 Ga0496120_0009133 3300048923 Bacteria 7071
239 Ga0496120_0026062 3300048923 Bacteria 3618
240 Ga0496120_0055235 3300048923 Bacteria 2246
241 Ga0496120_0060198 3300048923 Bacteria 2125
242 Ga0496121_0000316 3300048924 Bacteria 100872
243 Ga0496121_0002932 3300048924 Bacteria 24965
244 Ga0496121_0069559 3300048924 Bacteria 2840
245 Ga0496121_0153679 3300048924 Bacteria 1690
246 Ga0496121_0175466 3300048924 Bacteria 1552
247 Ga0496122_0000002 3300048925 Bacteria 905834
248 Ga0496122_0000190 3300048925 Bacteria 140376
249 Ga0496122_0002985 3300048925 Bacteria 23033
250 Ga0496122_0005090 3300048925 Bacteria 15859
251 Ga0496122_0028586 3300048925 Bacteria 4725
252 Ga0496122_0042285 3300048925 Bacteria 3587
253 Ga0496122_0107646 3300048925 Bacteria 1841
254 Ga0496122_0116320 3300048925 Bacteria 1739
255 Ga0496122_0270790 3300048925 Bacteria 935
256 Ga0496123_0000002 3300048926 Bacteria 1811682
257 Ga0496123_0002052 3300048926 Bacteria 26001
258 Ga0496123_0011443 3300048926 Bacteria 7687
259 Ga0496123_0034517 3300048926 Bacteria 3621
260 Ga0496124_0005166 3300048927 Bacteria 14850
261 Ga0496124_0005373 3300048927 Bacteria 14469
262 Ga0496124_0015262 3300048927 Bacteria 7371
263 Ga0496124_0031955 3300048927 Bacteria 4655
264 Ga0496124_0051969 3300048927 Bacteria 3484
265 Ga0496125_0000273 3300048928 Bacteria 104663
266 Ga0496125_0024388 3300048928 Bacteria 5564
267 Ga0496125_0037442 3300048928 Bacteria 4218
268 Ga0496125_0057471 3300048928 Bacteria 3150
269 Ga0496125_0060980 3300048928 Bacteria 3028
270 Ga0496125_0086281 3300048928 Bacteria 2374
271 Ga0496125_0156588 3300048928 Bacteria 1555
272 Ga0496125_0231148 3300048928 Bacteria 1182
273 Ga0496125_0251547 3300048928 Bacteria 1114
274 Ga0496126_0001803 3300048929 Bacteria 31375
275 Ga0496126_0013244 3300048929 Bacteria 8408
276 Ga0496126_0026955 3300048929 Bacteria 5500
277 Ga0495678_006649 3300049459 Bacteria 6117
278 Ga0495682_0045908 3300049460 Bacteria 1596
279 Ga0501034_0245843 3300049571 Bacteria 1734
280 Ga0501034_0276641 3300049571 Bacteria 1619
281 Ga0501037_0078367 3300049573 Bacteria 2398
282 Ga0501038_0045324 3300049574 Bacteria 3818
283 Ga0501038_0394990 3300049574 Bacteria 1071
284 Ga0501042_0464995 3300049578 Bacteria 918
285 Ga0501043_0112423 3300049579 Bacteria 2138
286 Ga0501047_0072946 3300049581 Bacteria 3305
287 Ga0501067_0000232 3300049583 Bacteria 30864
288 Ga0501068_0001470 3300049584 Bacteria 12547
289 Ga0501073_0000005 3300049589 Bacteria 237180
290 Ga0501076_0301912 3300049592 Bacteria 1313
291 Ga0501077_0000283 3300049593 Bacteria 30157
292 Ga0501044_0010778 3300049823 Bacteria 9919
293 Ga0501044_0052179 3300049823 Bacteria 4215
294 nmdc:mga00v17_53_c1 3300050491 Bacteria 72424
295 nmdc:mga0yw44_54104_c2 3300050492 Bacteria 1747
296 nmdc:mga0yw44_65422_c1 3300050492 Bacteria 2241
297 nmdc:mga04h51_12875_c1 3300050495 Bacteria 2358
298 nmdc:mga0sz30_587_c1 3300050516 Bacteria 13718
299 Ga0495601_0259728 3300053077 Bacteria 1134
300 Ga0500578_0127842 3300053086 Bacteria 1595
301 Ga0500654_097716 3300053099 Bacteria 1270
302 Ga0500557_001121 3300053105 Bacteria 4132
303 Ga0500569_003307 3300053109 Bacteria 3279
304 Ga0500594_0002968 3300053118 Bacteria 3708
305 Ga0500618_006273 3300053125 Bacteria 3511
306 Ga0500658_0050413 3300053134 Bacteria 1699
307 Ga0500561_0000556 3300053137 Bacteria 6004
308 Ga0500568_0001063 3300053139 Bacteria 18652
309 Ga0500577_0019902 3300053142 Bacteria 2185
310 Ga0500590_000084 3300053148 Bacteria 24077
311 Ga0500616_0021130 3300053153 Bacteria 3653
312 Ga0500624_000916 3300053157 Bacteria 6211
313 Ga0500645_049075 3300053730 Bacteria 1235
314 Ga0587072_003063 3300059643 Bacteria 2313
315 2511135371 2510917022 Bacteria 6504556
316 2511186742 2510917028 Bacteria 6185411
317 2513595941 2513237088 Bacteria 6927906
318 2513869651 2513237138 Bacteria 7368160
319 2513910856 2513237144 Bacteria 7530820
320 2513927225 2513237146 Bacteria 7166346
321 2524459553 2524023209 Bacteria 6679728
322 2535484105 2534681786 Bacteria 3308809
323 2535520393 2534681796 Bacteria 7146037
324 2537877565 2537561587 Bacteria 5425293
325 2554245408 2554235003 Bacteria 5877155
326 2559296763 2558860242 Bacteria 5568029
327 2561468410 2558860983 Bacteria 4133860
328 2585166323 2582581283 Bacteria 6030556
329 2585200811 2582581294 Bacteria 6626667
330 2585232948 2582581299 Bacteria 6518058
331 2585255250 2582581304 Bacteria 5831370
332 2585267452 2582581306 Bacteria 6450535
333 2585271108 2582581307 Bacteria 6597605
334 2585277450 2582581308 Bacteria 7413247
335 2585323367 2582581315 Bacteria 7318924
336 2585331510 2582581316 Bacteria 7774528
337 2585386520 2582581865 Bacteria 6644329
338 2585402953 2582581867 Bacteria 7184437
339 2585535077 2585427527 Bacteria 7273426
340 2585555927 2585427530 Bacteria 7383882
341 2585558832 2585427531 Bacteria 6992870
342 2585820071 2585427590 Bacteria 6824633
343 2585842713 2585427594 Bacteria 6180594
344 2585898214 2585427608 Bacteria 6544331
345 2585904198 2585427609 Bacteria 6667127
346 2587980685 2585428125 Bacteria 6662905
347 2599331731 2599185156 Bacteria 5403036
348 2599415334 2599185170 Bacteria 7295545
349 2599602746 2599185210 Bacteria 5624189
350 2600194362 2599185352 Bacteria 7228948
351 2601610367 2600255279 Bacteria 5605316
352 2601747303 2600255308 Bacteria 5611129
353 2616308925 2615840626 Bacteria 7921970
354 2616554192 2615840698 Bacteria 7319877
355 2617384751 2617270742 Bacteria 6808054
356 2643803114 2643221557 Bacteria 7184309
357 2643811672 2643221558 Bacteria 5460675
358 2644050543 2643221607 Bacteria 6314006
359 2644063476 2643221610 Bacteria 7480339
360 2644107307 2643221618 Bacteria 7717186
361 2644150873 2643221626 Bacteria 8069654
362 2644194274 2643221634 Bacteria 6705461
363 2644205771 2643221636 Bacteria 6583769
364 2644242293 2643221643 Bacteria 5749658
365 2644298631 2643221653 Bacteria 4569637
366 2644308702 2643221655 Bacteria 7722067
367 2644335519 2643221659 Bacteria 7890716
368 2644374759 2643221668 Bacteria 7306521
369 2644414239 2643221675 Bacteria 7473456
370 2644447767 2643221680 Bacteria 7473610
371 2644483461 2643221686 Bacteria 6310811
372 2644499673 2643221689 Bacteria 6042950
373 2644520890 2643221693 Bacteria 5513853
374 2644539924 2643221698 Bacteria 7756764
375 2644614643 2643221712 Bacteria 7729434
376 2644656860 2643221719 Bacteria 4568197
377 2644676108 2643221723 Bacteria 7095460
378 2644690240 2643221726 Bacteria 7455827
379 2671111465 2667528174 Bacteria 6435400
380 2738799789 2738541293 Bacteria 7065685
381 2753358671 2751185800 Bacteria 5467370
382 2758640910 2758568016 Bacteria 5645291
383 2776913886 2775507049 Bacteria 6284736
384 2778175382 2775507266 Bacteria 7392367
385 2793280325 2791355253 Bacteria 5171699
386 2808987216 2808606387 Bacteria 5697198
387 2812367604 2811994881 Bacteria 6298475
388 2819241444 2818991272 Bacteria 4622173
389 2819557448 2818991439 Bacteria 6907412
390 2819609115 2818991448 Bacteria 6772224
391 2819637657 2818991453 Bacteria 7181617
392 2834581262 2834578030 Bacteria 3530182
393 2838029841 2838029111 Bacteria 6603031
394 2838038941 2838035591 Bacteria 7166484
395 2838664469 2838661181 Bacteria 7385261
396 2838678046 2838675328 Bacteria 4909118
397 2838717048 2838714209 Bacteria 5525906
398 2838722341 2838719591 Bacteria 5523910
399 2838727797 2838724970 Bacteria 4908691
400 2841849454 2841846520 Bacteria 5345850
401 2841861504 2841859092 Bacteria 5436171
402 2842127797 2842124991 Bacteria 5346824
403 2842132939 2842130223 Bacteria 4909145
404 2842154932 2842152218 Bacteria 4908957
405 2842173431 2842170452 Bacteria 5525737
406 2842178553 2842175837 Bacteria 4908771
407 2842190156 2842187318 Bacteria 5524014
408 2842214470 2842211629 Bacteria 5523832
409 2842227189 2842224351 Bacteria 5524473
410 2842301334 2842298080 Bacteria 6123127
411 2842357871 2842357229 Bacteria 6485165
412 2842476874 2842475841 Bacteria 6603183
413 2842484595 2842482326 Bacteria 7212537
414 2842503369 2842502639 Bacteria 6604161
415 2842511170 2842509118 Bacteria 6850950
416 2842518230 2842515876 Bacteria 5436280
417 2842924136 2842922631 Bacteria 5824079
418 2844164543 2844163670 Bacteria 7266046
419 2852390184 2852387548 Bacteria 8025568
420 2854897844 2854896431 Bacteria 5869725
421 2854914241 2854911287 Bacteria 5582813
422 2891373321 2891373044 Bacteria 5202277
423 2899275724 2899275550 Bacteria 3958688
424 2899796545 2899792073 Bacteria 4926588
425 2899850070 2899845264 Bacteria 5672268
426 2912968642 2912963787 Bacteria 5646108
427 2915651122 2915650412 Bacteria 4288180
428 2919117306 2919114240 Bacteria 5700270
429 2919409944 2919408235 Bacteria 6149349
430 2920825188 2920822456 Bacteria 6897201
431 2923521654 2923519811 Bacteria 6298479
432 2923559752 2923556063 Bacteria 6793593
433 2926758753 2926754445 Bacteria 5964435
434 2926763716 2926760298 Bacteria 5505990
435 2931401890 2931396565 Bacteria 7251677
436 2933009685 2933006813 Bacteria 4912075
437 2933013859 2933011516 Bacteria 5439334
438 2933017146 2933016740 Bacteria 6355406
439 2933595672 2933594066 Bacteria 5594265
440 2939653980 2939651529 Bacteria 5895393
441 2979091242 2979089926 Bacteria 5670289
442 2979096767 2979095461 Bacteria 5669583
443 2979102488 2979100975 Bacteria 5423623
444 2984509626 2984509177 Bacteria 5274802
445 2984537963 2984537506 Bacteria 5277481
446 2984604708 2984601300 Bacteria 5455244
447 2989774261 2989771324 Bacteria 5605128
448 2989779165 2989776772 Bacteria 4843317
449 2996887819 2996887358 Bacteria 5795980
450 3005413509 3005409236 Bacteria 7188837
451 3005419505 3005416602 Bacteria 7064308
452 3005457998 3005452660 Bacteria 5889319
453 650843185 650716007 Bacteria 5573770
454 8005248727 8005246636 Bacteria 4933972
455 8005259173 8005258706 Bacteria 6184835
456 8005316796 8005314921 Bacteria 7072929
457 8005322346 8005321885 Bacteria 5795980
458 8005489222 8005484373 Bacteria 6297373
459 8005548141 8005542996 Bacteria 7077758
460 8005649612 8005645114 Bacteria 6950293
461 8005659073 8005658619 Bacteria 4500593
462 8005682926 8005682033 Bacteria 6726518
463 8024487986 8024486573 Bacteria 6540512
464 8046771575 8046767195 Bacteria 7547379
465 8057575775 8057575449 Bacteria 7367519
466 Ga0123342_1000455
467 JGI24740J21852_10000015
468 JGI25155J39150_1000001
469 JGI25156J39149_1000001
470 JGI25162J39368_1000328
471 JGI25162J39368_1000568
472 JGI25154J39366_1000150
473 JGI25157J39369_1000044
474 JGI25152J39213_1000381
475 JGI25150J39212_1000079
476 JGI25159J45721_1000693
477 JGI25151J46595_10000007
478 JGI25151J46595_10025740
479 JGI25165J46597_1000381
480 JGI25165J46597_1000543
481 JGI25153J46596_10006855
482 JGI25160J50197_1000001
483 JGI25160J50197_1000020
484 JGI25161J50226_1000001
485 JGI25161J50226_1000657
486 Ga0055539_1005535
487 Ga0055526_1001886
488 Ga0055526_1017561
489 Ga0055524_1013170
490 Ga0055524_1030742
491 Ga0055536_1001928
492 Ga0055528_1005497
493 Ga0055540_1011135
494 Ga0055543_1000003
495 Ga0055543_1000047
496 Ga0065165_1000013
497 Ga0065165_1000068
498 Ga0070683_100105695
499 Ga0070670_100007282
500 Ga0070666_10197566
501 Ga0070669_100046080
502 Ga0070671_100515054
503 Ga0070665_100011322
504 Ga0070665_100159016
505 Ga0068855_100083033
506 Ga0068852_100022148
507 Ga0075365_10045083
508 Ga0075368_10003338
509 Ga0075367_10016312
510 Ga0075369_10007738
511 Ga0075366_10093565
512 Ga0075370_10133323
513 Ga0099826_10000080
514 Ga0099826_10006901
515 Ga0105251_10022177
516 Ga0105244_10000297
517 Ga0105244_10146779
518 Ga0105250_10018112
519 Ga0105240_10000076
520 Ga0105248_10130847
521 Ga0105237_10000226
522 Ga0105249_10230495
523 Ga0123342_1024231
524 Ga0105239_10000641
525 Ga0157373_10004987
526 Ga0157371_10000002
527 Ga0157371_10000084
528 Ga0157370_10000143
529 Ga0157370_10000455
530 Ga0163163_10002984
531 Ga0182008_10010583
532 Ga0182007_10001342
533 Ga0182007_10006068
534 Ga0182005_1001263
535 Ga0182005_1001367
536 Ga0213874_10003901
537 Ga0209435_100012
538 Ga0209436_100614
539 Ga0209672_102574
540 Ga0209437_100051
541 Ga0209437_100098
542 Ga0207425_1000018
543 Ga0209646_1000026
544 Ga0209026_1000014
545 Ga0209677_103577
546 Ga0209148_1005017
547 Ga0209759_1000012
548 Ga0209129_1000026
549 Ga0209129_1000315
550 Ga0209233_1000048
551 Ga0209233_1000069
552 Ga0209233_1000260
553 Ga0209673_1004433
554 Ga0209673_1006006
555 Ga0209673_1016387
556 Ga0209130_1000003
557 Ga0209130_1000034
558 Ga0209676_1000482
559 Ga0209025_1000035
560 Ga0209025_1000140
561 Ga0209025_1000314
562 Ga0209025_1000478
563 Ga0209025_1013577
564 Ga0209025_1033332
565 Ga0209564_1000013
566 Ga0209564_1010591
567 Ga0209758_1000040
568 Ga0209050_1000646
569 Ga0209256_1000618
570 Ga0209256_1002360
571 Ga0209256_1022929
572 Ga0209256_1023261
573 Ga0207426_1000006
574 Ga0207426_1000011
575 Ga0207426_1001329
576 Ga0209051_1002315
577 Ga0209051_1011948
578 Ga0207656_10055394
579 Ga0207655_1000465
580 Ga0207713_1049599
581 Ga0207713_1054146
582 Ga0207695_10000011
583 Ga0207671_10000093
584 Ga0207681_10038215
585 Ga0207650_10002206
586 Ga0207690_10133352
587 Ga0207661_10082744
588 Ga0207679_10259006
589 Ga0207678_10243636
590 Ga0207698_10441992
591 Ga0209371_1001235
592 Ga0209371_1001599
593 Ga0209282_1000643
594 Ga0268266_10123823
595 Ga0307515_10001978
596 Ga0307515_10050933
597 Ga0268256_1000004
598 Ga0268256_1002124
599 Ga0268256_1035776
600 Ga0307513_10012647
601 Ga0307513_10015545
602 Ga0265313_10020534
603 Ga0307405_10045522
604 Ga0307406_10032467
605 Ga0307412_10047155
606 Ga0307510_10221369
607 Ga0373927_0000969
608 Ga0373947_0041082
609 Ga0436365_0797645
610 Ga0436363_0858757
611 Ga0436363_1176309
612 Ga0439438_000903
613 Ga0439447_000153
614 Ga0439456_000095
615 Ga0439456_002406
616 Ga0450900_007102
617 Ga0466966_0086419
618 Ga0466963_0007418
619 Ga0466970_0000440
620 Ga0466967_0057314
621 Ga0495629_0054062
622 Ga0495638_0002790
623 Ga0495605_0003910
624 Ga0495639_0042479
625 Ga0495662_0010152
626 Ga0495585_0018399
627 Ga0495583_0003274
628 Ga0495583_0018866
629 Ga0495610_0000970
630 Ga0495616_0006252
631 Ga0495620_0116216
632 Ga0495631_0000920
633 Ga0495632_0000099
634 Ga0495632_0011350
635 Ga0495632_0064552
636 Ga0495643_0041531
637 Ga0495648_0131652
638 Ga0495652_0197643
639 Ga0495587_0034524
640 Ga0495622_0031140
641 Ga0495633_0042098
642 Ga0495668_0002306
643 Ga0495611_0019391
644 Ga0495625_0001510
645 Ga0495625_0255029
646 Ga0495588_0001944
647 Ga0495657_0322065
648 Ga0495624_0147403
649 Ga0495671_0083803
650 Ga0495671_0141851
651 Ga0495600_0009271
652 Ga0495660_0024485
653 Ga0495581_0130826
654 Ga0495604_0026612
655 Ga0495672_0026676
656 Ga0495683_0031853
657 Ga0495681_0008524
658 Ga0495686_0003405
659 Ga0495602_0224858
660 Ga0496100_0084181
661 Ga0496101_0040033
662 Ga0496101_0281026
663 Ga0496101_0384268
664 Ga0496102_0002045
665 Ga0496102_0145304
666 Ga0496103_0005310
667 Ga0496104_0003282
668 Ga0496105_0000482
669 Ga0496105_0025630
670 Ga0496107_0227969
671 Ga0496108_0004344
672 Ga0496109_0001031
673 Ga0496110_0433121
674 Ga0496111_0001301
675 Ga0496111_0277752
676 Ga0496112_0091238
677 Ga0496113_0171019
678 Ga0496113_0407087
679 Ga0496114_0045072
680 Ga0496114_0060849
681 Ga0496114_0730256
682 Ga0496115_0027543
683 Ga0496116_0003749
684 Ga0496116_0005377
685 Ga0496116_0007451
686 Ga0496116_0055293
687 Ga0496117_0000016
688 Ga0496117_0002220
689 Ga0496117_0008027
690 Ga0496117_0085117
691 Ga0496117_0096504
692 Ga0496117_0164315
693 Ga0496118_0000153
694 Ga0496118_0002458
695 Ga0496118_0010971
696 Ga0496118_0021459
697 Ga0496119_0002118
698 Ga0496119_0003693
699 Ga0496119_0022223
700 Ga0496119_0049723
701 Ga0496119_0085986
702 Ga0496120_0000423
703 Ga0496120_0009133
704 Ga0496120_0026062
705 Ga0496120_0055235
706 Ga0496120_0060198
707 Ga0496121_0000316
708 Ga0496121_0002932
709 Ga0496121_0069559
710 Ga0496121_0153679
711 Ga0496121_0175466
712 Ga0496122_0000002
713 Ga0496122_0000190
714 Ga0496122_0002985
715 Ga0496122_0005090
716 Ga0496122_0028586
717 Ga0496122_0042285
718 Ga0496122_0107646
719 Ga0496122_0116320
720 Ga0496122_0270790
721 Ga0496123_0000002
722 Ga0496123_0002052
723 Ga0496123_0011443
724 Ga0496123_0034517
725 Ga0496124_0005166
726 Ga0496124_0005373
727 Ga0496124_0015262
728 Ga0496124_0031955
729 Ga0496124_0051969
730 Ga0496125_0000273
731 Ga0496125_0024388
732 Ga0496125_0037442
733 Ga0496125_0057471
734 Ga0496125_0060980
735 Ga0496125_0086281
736 Ga0496125_0156588
737 Ga0496125_0231148
738 Ga0496125_0251547
739 Ga0496126_0001803
740 Ga0496126_0013244
741 Ga0496126_0026955
742 Ga0495678_006649
743 Ga0495682_0045908
744 Ga0501034_0245843
745 Ga0501034_0276641
746 Ga0501037_0078367
747 Ga0501038_0045324
748 Ga0501038_0394990
749 Ga0501042_0464995
750 Ga0501043_0112423
751 Ga0501047_0072946
752 Ga0501067_0000232
753 Ga0501068_0001470
754 Ga0501073_0000005
755 Ga0501076_0301912
756 Ga0501077_0000283
757 Ga0501044_0010778
758 Ga0501044_0052179
759 nmdc:mga00v17_53_c1
760 nmdc:mga0yw44_54104_c2
761 nmdc:mga0yw44_65422_c1
762 nmdc:mga04h51_12875_c1
763 nmdc:mga0sz30_587_c1
764 Ga0495601_0259728
765 Ga0500578_0127842
766 Ga0500654_097716
767 Ga0500557_001121
768 Ga0500569_003307
769 Ga0500594_0002968
770 Ga0500618_006273
771 Ga0500658_0050413
772 Ga0500561_0000556
773 Ga0500568_0001063
774 Ga0500577_0019902
775 Ga0500590_000084
776 Ga0500616_0021130
777 Ga0500624_000916
778 Ga0500645_049075
779 Ga0587072_003063
780 2511135371
781 2511186742
782 2513595941
783 2513869651
784 2513910856
785 2513927225
786 2524459553
787 2535484105
788 2535520393
789 2537877565
790 2554245408
791 2559296763
792 2561468410
793 2585166323
794 2585200811
795 2585232948
796 2585255250
797 2585267452
798 2585271108
799 2585277450
800 2585323367
801 2585331510
802 2585386520
803 2585402953
804 2585535077
805 2585555927
806 2585558832
807 2585820071
808 2585842713
809 2585898214
810 2585904198
811 2587980685
812 2599331731
813 2599415334
814 2599602746
815 2600194362
816 2601610367
817 2601747303
818 2616308925
819 2616554192
820 2617384751
821 2643803114
822 2643811672
823 2644050543
824 2644063476
825 2644107307
826 2644150873
827 2644194274
828 2644205771
829 2644242293
830 2644298631
831 2644308702
832 2644335519
833 2644374759
834 2644414239
835 2644447767
836 2644483461
837 2644499673
838 2644520890
839 2644539924
840 2644614643
841 2644656860
842 2644676108
843 2644690240
844 2671111465
845 2738799789
846 2753358671
847 2758640910
848 2776913886
849 2778175382
850 2793280325
851 2808987216
852 2812367604
853 2819241444
854 2819557448
855 2819609115
856 2819637657
857 2834581262
858 2838029841
859 2838038941
860 2838664469
861 2838678046
862 2838717048
863 2838722341
864 2838727797
865 2841849454
866 2841861504
867 2842127797
868 2842132939
869 2842154932
870 2842173431
871 2842178553
872 2842190156
873 2842214470
874 2842227189
875 2842301334
876 2842357871
877 2842476874
878 2842484595
879 2842503369
880 2842511170
881 2842518230
882 2842924136
883 2844164543
884 2852390184
885 2854897844
886 2854914241
887 2891373321
888 2899275724
889 2899796545
890 2899850070
891 2912968642
892 2915651122
893 2919117306
894 2919409944
895 2920825188
896 2923521654
897 2923559752
898 2926758753
899 2926763716
900 2931401890
901 2933009685
902 2933013859
903 2933017146
904 2933595672
905 2939653980
906 2979091242
907 2979096767
908 2979102488
909 2984509626
910 2984537963
911 2984604708
912 2989774261
913 2989779165
914 2996887819
915 3005413509
916 3005419505
917 3005457998
918 650843185
919 8005248727
920 8005259173
921 8005316796
922 8005322346
923 8005489222
924 8005548141
925 8005649612
926 8005659073
927 8005682926
928 8024487986
929 8046771575
930 8057575775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02548

Pantoate_transf

Ketopantoate hydroxymethyltransferase

9

265

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9545 8 267
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9469 8 267
3ez4-assembly1.cif.gz_D crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei 0.8632 9 268
3vav-assembly1.cif.gz_G crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.8601 8 269
3vav-assembly1.cif.gz_I crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.8594 8 269
ID Description Score Start End Superfamily
1oy0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9545 8 267 3.20.20.60
1oy0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9469 8 267 3.20.20.60
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9402 8 273 3.20.20.60
af_Q5ABB3_27_304_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9388 9 273 3.20.20.60
af_Q2FV21_2_270_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9317 11 272 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A3S1YCC1-F1-model_v4 deleted 0.998 9 145
AF-A0A1Q7C010-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9793 1 273 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A3C0VME4-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9791 1 132 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A7S0BQC0-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9711 4 145 GO:0000287
GO:0003864
GO:0005737
GO:0015940
AF-A0A812W151-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9687 4 273 GO:0000287
GO:0003864
GO:0004592
GO:0005737
GO:0015940

Map