F449653

General Info

Members Datasets Scaffolds Average Seq Length
466 189 932 224

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10074242|Ga0114129_100742422
Length 261
Sequence VQRSGSRNLNKCNHEVTKVTKQSFSKRLLRYVVAFDVDHVLEVAHISKQYPTPRGPLTVLADVSLSLAPGEAAAIMGPSGSGKSSLLYILGALEPPSSGAVTLDGKNPFTLDQTALAAFRNEQIGFVFQDHCLLPQCSVVENVLIPTLVAKNSNGDEKRARSLIEQVGLADRADHRPAALSGGERQRVAIARALIRQPRLLLCDEPTGNLDRTTAEQVAGVLLDLHKSQKTILVIVTHSPQLAGKCPIRFELTEQTLRRVV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10074242 3300009147 Bacteria 4737
2 JGI24746J21847_1002834 3300001977 Bacteria 2729
3 JGI24745J21846_1012352 3300002073 Bacteria 979
4 Ga0065712_10000804 3300005290 Bacteria 8129
5 Ga0065712_10318674 3300005290 Bacteria 804
6 Ga0065715_10038730 3300005293 Bacteria 985
7 Ga0065715_10092299 3300005293 Bacteria 5202
8 Ga0065715_10098970 3300005293 Bacteria 3475
9 Ga0065715_10238944 3300005293 Bacteria 1205
10 Ga0070676_10003988 3300005328 Bacteria 7748
11 Ga0070676_10012947 3300005328 Bacteria 4569
12 Ga0070676_10270132 3300005328 Bacteria 1142
13 Ga0070676_10393432 3300005328 Bacteria 962
14 Ga0070690_100041262 3300005330 Bacteria 2921
15 Ga0070670_100000232 3300005331 Bacteria 51314
16 Ga0070670_100233899 3300005331 Bacteria 1599
17 Ga0070670_100263846 3300005331 Unclassified 1502
18 Ga0070677_10018224 3300005333 Bacteria 2526
19 Ga0070677_10020495 3300005333 Bacteria 2410
20 Ga0070677_10110233 3300005333 Bacteria 1227
21 Ga0068869_100023526 3300005334 Bacteria 4256
22 Ga0068869_100100490 3300005334 Bacteria 2187
23 Ga0070666_10010264 3300005335 Bacteria 5854
24 Ga0070666_10015724 3300005335 Bacteria 4831
25 Ga0070682_100014933 3300005337 Unclassified 4496
26 Ga0068868_100008374 3300005338 Bacteria 7402
27 Ga0070689_100000487 3300005340 Bacteria 23451
28 Ga0070689_100007077 3300005340 Bacteria 7812
29 Ga0070689_100119722 3300005340 Bacteria 2102
30 Ga0070689_100128137 3300005340 Bacteria 2033
31 Ga0070689_100229222 3300005340 Bacteria 1526
32 Ga0070691_10004164 3300005341 Bacteria 6569
33 Ga0070691_10203353 3300005341 Bacteria 1041
34 Ga0070661_100537865 3300005344 Bacteria 939
35 Ga0070692_10073118 3300005345 Bacteria 1831
36 Ga0070669_100007458 3300005353 Bacteria 7837
37 Ga0070669_100008143 3300005353 Bacteria 7487
38 Ga0070675_100010682 3300005354 Bacteria 7180
39 Ga0070675_100018832 3300005354 Bacteria 5497
40 Ga0070675_100021357 3300005354 Bacteria 5173
41 Ga0070675_100044330 3300005354 Unclassified 3637
42 Ga0070675_100074150 3300005354 Bacteria 2826
43 Ga0070675_100101957 3300005354 Bacteria 2418
44 Ga0070675_100109207 3300005354 Bacteria 2338
45 Ga0070671_100051398 3300005355 Bacteria 3428
46 Ga0070671_100289002 3300005355 Bacteria 1395
47 Ga0070674_100000107 3300005356 Bacteria 39103
48 Ga0070674_100052102 3300005356 Bacteria 2822
49 Ga0070674_100053751 3300005356 Unclassified 2782
50 Ga0070673_100084076 3300005364 Bacteria 2587
51 Ga0070673_100105024 3300005364 Bacteria 2333
52 Ga0070673_100175626 3300005364 Bacteria 1831
53 Ga0070673_100279897 3300005364 Bacteria 1463
54 Ga0070688_100016892 3300005365 Bacteria 4179
55 Ga0070688_100032892 3300005365 Bacteria 3131
56 Ga0070688_100346201 3300005365 Bacteria 1087
57 Ga0070667_100014071 3300005367 Bacteria 6611
58 Ga0070667_100235762 3300005367 Bacteria 1633
59 Ga0070667_100238057 3300005367 Bacteria 1625
60 Ga0070701_10008507 3300005438 Bacteria 4443
61 Ga0070701_10010058 3300005438 Bacteria 4170
62 Ga0070701_10148400 3300005438 Bacteria 1348
63 Ga0070701_10156146 3300005438 Bacteria 1318
64 Ga0070701_10487544 3300005438 Bacteria 798
65 Ga0070700_100006685 3300005441 Bacteria 6176
66 Ga0070700_100038682 3300005441 Bacteria 2909
67 Ga0070700_100096057 3300005441 Bacteria 1944
68 Ga0070700_100165460 3300005441 Bacteria 1527
69 Ga0070694_100004804 3300005444 Bacteria 8137
70 Ga0070694_100096415 3300005444 Bacteria 2085
71 Ga0070694_100338873 3300005444 Bacteria 1162
72 Ga0070678_100173000 3300005456 Bacteria 1761
73 Ga0070678_100622259 3300005456 Bacteria 966
74 Ga0070662_100041330 3300005457 Bacteria 3288
75 Ga0070662_100053327 3300005457 Unclassified 2927
76 Ga0068867_100027740 3300005459 Bacteria 4073
77 Ga0068867_100193572 3300005459 Bacteria 1624
78 Ga0068867_100206036 3300005459 Bacteria 1577
79 Ga0070685_10047782 3300005466 Bacteria 2462
80 Ga0070685_10107063 3300005466 Bacteria 1716
81 Ga0070707_100008831 3300005468 Bacteria 9345
82 Ga0070707_100072835 3300005468 Bacteria 3312
83 Ga0070698_100039981 3300005471 Bacteria 4822
84 Ga0070698_100179510 3300005471 Bacteria 2056
85 Ga0070699_100082951 3300005518 Bacteria 2795
86 Ga0070699_100914498 3300005518 Bacteria 804
87 Ga0070684_100684180 3300005535 Bacteria 956
88 Ga0070697_100411112 3300005536 Bacteria 1175
89 Ga0070672_100032223 3300005543 Bacteria 3953
90 Ga0070672_100126049 3300005543 Bacteria 2100
91 Ga0070672_100160959 3300005543 Bacteria 1862
92 Ga0070672_100161794 3300005543 Bacteria 1857
93 Ga0070686_100037548 3300005544 Bacteria 3005
94 Ga0070686_100047194 3300005544 Unclassified 2722
95 Ga0070686_100343517 3300005544 Bacteria 1119
96 Ga0070695_100017036 3300005545 Bacteria 4408
97 Ga0070695_100026672 3300005545 Bacteria 3576
98 Ga0070696_100036887 3300005546 Bacteria 3372
99 Ga0070696_100172551 3300005546 Bacteria 1599
100 Ga0070696_100236208 3300005546 Bacteria 1377
101 Ga0070696_100415854 3300005546 Bacteria 1055
102 Ga0070693_100005300 3300005547 Bacteria 6180
103 Ga0070693_100037456 3300005547 Bacteria 2705
104 Ga0070704_100013202 3300005549 Bacteria 5120
105 Ga0070704_100021390 3300005549 Bacteria 4193
106 Ga0070704_100060223 3300005549 Bacteria 2712
107 Ga0070664_100005061 3300005564 Bacteria 10570
108 Ga0070664_100275667 3300005564 Bacteria 1516
109 Ga0070664_101017568 3300005564 Bacteria 779
110 Ga0068857_100066860 3300005577 Bacteria 3199
111 Ga0068857_100474751 3300005577 Bacteria 1171
112 Ga0068854_100057579 3300005578 Bacteria 2804
113 Ga0068854_100115492 3300005578 Bacteria 2031
114 Ga0068854_100168986 3300005578 Bacteria 1700
115 Ga0070702_100033594 3300005615 Bacteria 2822
116 Ga0070702_100063778 3300005615 Bacteria 2153
117 Ga0070702_100126547 3300005615 Bacteria 1608
118 Ga0068852_100025548 3300005616 Bacteria 4787
119 Ga0068852_100117032 3300005616 Bacteria 2433
120 Ga0068859_100023579 3300005617 Bacteria 6176
121 Ga0068859_100079078 3300005617 Bacteria 3328
122 Ga0068859_100129073 3300005617 Unclassified 2599
123 Ga0068859_100203681 3300005617 Bacteria 2064
124 Ga0068859_100282224 3300005617 Bacteria 1753
125 Ga0068859_100364423 3300005617 Bacteria 1540
126 Ga0068859_100451567 3300005617 Bacteria 1381
127 Ga0068859_100710453 3300005617 Bacteria 1095
128 Ga0068864_100333559 3300005618 Bacteria 1428
129 Ga0068864_100418744 3300005618 Bacteria 1276
130 Ga0068866_10061109 3300005718 Bacteria 1955
131 Ga0068866_10183990 3300005718 Bacteria 1236
132 Ga0068861_100008101 3300005719 Bacteria 7230
133 Ga0068861_100010754 3300005719 Bacteria 6359
134 Ga0068861_100842904 3300005719 Bacteria 864
135 Ga0068851_10043513 3300005834 Bacteria 2264
136 Ga0068870_10017243 3300005840 Bacteria 3466
137 Ga0068870_10027331 3300005840 Bacteria 2852
138 Ga0068870_10085430 3300005840 Bacteria 1754
139 Ga0068863_100020321 3300005841 Bacteria 6350
140 Ga0068863_100061586 3300005841 Bacteria 3548
141 Ga0068863_100400882 3300005841 Bacteria 1342
142 Ga0068858_100098817 3300005842 Bacteria 2721
143 Ga0068858_100111043 3300005842 Bacteria 2560
144 Ga0068858_100167065 3300005842 Bacteria 2074
145 Ga0068858_100205672 3300005842 Bacteria 1862
146 Ga0068858_100415400 3300005842 Bacteria 1293
147 Ga0068858_100640643 3300005842 Bacteria 1032
148 Ga0068860_100026015 3300005843 Bacteria 5645
149 Ga0068860_100055035 3300005843 Unclassified 3781
150 Ga0068860_100074254 3300005843 Bacteria 3233
151 Ga0068860_100140770 3300005843 Bacteria 2319
152 Ga0068860_100238771 3300005843 Bacteria 1767
153 Ga0068860_100278548 3300005843 Bacteria 1634
154 Ga0068860_100649459 3300005843 Bacteria 1063
155 Ga0068862_100009812 3300005844 Bacteria 7912
156 Ga0068862_100088904 3300005844 Unclassified 2688
157 Ga0068862_100379122 3300005844 Bacteria 1319
158 Ga0068862_100747076 3300005844 Bacteria 951
159 Ga0068862_100887855 3300005844 Bacteria 876
160 Ga0097621_100162577 3300006237 Bacteria 1920
161 Ga0097621_100190486 3300006237 Bacteria 1776
162 Ga0097621_100384574 3300006237 Bacteria 1254
163 Ga0097621_101043392 3300006237 Bacteria 766
164 Ga0068871_100114730 3300006358 Bacteria 2270
165 Ga0068871_100388602 3300006358 Bacteria 1241
166 Ga0068871_100395413 3300006358 Bacteria 1230
167 Ga0068871_100833499 3300006358 Bacteria 852
168 Ga0075428_100000067 3300006844 Bacteria 83554
169 Ga0075428_100043283 3300006844 Bacteria 4949
170 Ga0075428_100260528 3300006844 Unclassified 1867
171 Ga0075428_100899187 3300006844 Unclassified 939
172 Ga0075431_100007732 3300006847 Bacteria 10710
173 Ga0075431_100020444 3300006847 Bacteria 6763
174 Ga0075431_100050842 3300006847 Bacteria 4273
175 Ga0075433_10018509 3300006852 Bacteria 5793
176 Ga0075433_10407468 3300006852 Bacteria 1199
177 Ga0075429_100015738 3300006880 Bacteria 6552
178 Ga0075429_100588415 3300006880 Bacteria 975
179 Ga0068865_100062994 3300006881 Bacteria 2605
180 Ga0068865_100332960 3300006881 Bacteria 1225
181 Ga0068865_100606038 3300006881 Bacteria 926
182 Ga0075436_100370249 3300006914 Bacteria 1035
183 Ga0097620_100023578 3300006931 Bacteria 6176
184 Ga0097620_100079079 3300006931 Bacteria 3328
185 Ga0097620_100129071 3300006931 Unclassified 2599
186 Ga0097620_100203674 3300006931 Bacteria 2064
187 Ga0097620_100282235 3300006931 Bacteria 1753
188 Ga0097620_100364409 3300006931 Bacteria 1540
189 Ga0097620_100451576 3300006931 Bacteria 1381
190 Ga0097620_100710483 3300006931 Bacteria 1095
191 Ga0105251_10175415 3300009011 Bacteria 966
192 Ga0105240_10228890 3300009093 Bacteria 2162
193 Ga0105240_10795672 3300009093 Bacteria 1025
194 Ga0105240_10935050 3300009093 Unclassified 931
195 Ga0111539_10000005 3300009094 Bacteria 467342
196 Ga0111539_10003708 3300009094 Bacteria 20095
197 Ga0111539_10030512 3300009094 Bacteria 6552
198 Ga0111539_10060388 3300009094 Bacteria 4493
199 Ga0111539_10155968 3300009094 Bacteria 2672
200 Ga0111539_10354519 3300009094 Unclassified 1707
201 Ga0111539_10455454 3300009094 Bacteria 1490
202 Ga0111539_11131407 3300009094 Bacteria 910
203 Ga0105245_10049228 3300009098 Bacteria 3773
204 Ga0105243_10014958 3300009148 Bacteria 5873
205 Ga0105243_10016652 3300009148 Bacteria 5559
206 Ga0105243_10057004 3300009148 Bacteria 3110
207 Ga0105243_10507114 3300009148 Bacteria 1144
208 Ga0105243_10816742 3300009148 Bacteria 920
209 Ga0105241_10034256 3300009174 Bacteria 3814
210 Ga0105242_10026065 3300009176 Bacteria 4630
211 Ga0105242_10048081 3300009176 Bacteria 3466
212 Ga0105242_10566543 3300009176 Bacteria 1092
213 Ga0105242_10920635 3300009176 Bacteria 876
214 Ga0105248_10036913 3300009177 Bacteria 5465
215 Ga0105248_10081441 3300009177 Bacteria 3638
216 Ga0105248_10115930 3300009177 Bacteria 3021
217 Ga0105248_10193545 3300009177 Bacteria 2291
218 Ga0105248_10484052 3300009177 Bacteria 1395
219 Ga0105248_10749651 3300009177 Bacteria 1102
220 Ga0105237_10009719 3300009545 Bacteria 10290
221 Ga0105249_10007469 3300009553 Bacteria 9537
222 Ga0105249_10029274 3300009553 Bacteria 4973
223 Ga0105249_10035974 3300009553 Unclassified 4492
224 Ga0105246_10060216 3300011119 Bacteria 2637
225 Ga0105246_10358643 3300011119 Unclassified 1197
226 Ga0157373_10076751 3300013100 Bacteria 2358
227 Ga0157374_11268705 3300013296 Bacteria 758
228 Ga0157378_10426136 3300013297 Bacteria 1312
229 Ga0163162_10011569 3300013306 Bacteria 8609
230 Ga0163162_10421800 3300013306 Bacteria 1466
231 Ga0157375_10031435 3300013308 Bacteria 5020
232 Ga0157375_10058175 3300013308 Bacteria 3824
233 Ga0157375_10137248 3300013308 Bacteria 2571
234 Ga0157375_10614299 3300013308 Bacteria 1246
235 Ga0157375_10647569 3300013308 Bacteria 1213
236 Ga0157375_10783651 3300013308 Bacteria 1103
237 Ga0157375_10881679 3300013308 Bacteria 1040
238 Ga0163163_10228908 3300014325 Bacteria 1908
239 Ga0157380_10004272 3300014326 Bacteria 9891
240 Ga0157380_10036879 3300014326 Bacteria 3786
241 Ga0157380_10040479 3300014326 Bacteria 3629
242 Ga0157380_10063828 3300014326 Bacteria 2954
243 Ga0157380_10068938 3300014326 Bacteria 2852
244 Ga0157380_10082429 3300014326 Bacteria 2632
245 Ga0157380_10176991 3300014326 Bacteria 1870
246 Ga0157380_10238146 3300014326 Bacteria 1639
247 Ga0157380_10295633 3300014326 Bacteria 1489
248 Ga0157380_10357182 3300014326 Bacteria 1369
249 Ga0157377_10008178 3300014745 Bacteria 5088
250 Ga0157377_10258256 3300014745 Bacteria 1132
251 Ga0157379_10040896 3300014968 Bacteria 4138
252 Ga0157379_10072636 3300014968 Bacteria 3078
253 Ga0157379_10081679 3300014968 Bacteria 2895
254 Ga0157376_10105231 3300014969 Bacteria 2474
255 Ga0157376_10704707 3300014969 Bacteria 1015
256 Ga0163161_10007742 3300017792 Bacteria 7429
257 Ga0163161_10167283 3300017792 Bacteria 1679
258 Ga0207697_10010599 3300025315 Bacteria 3933
259 Ga0207653_10010519 3300025885 Bacteria 2885
260 Ga0207682_10000973 3300025893 Bacteria 13209
261 Ga0207682_10017276 3300025893 Bacteria 2817
262 Ga0207682_10018777 3300025893 Bacteria 2705
263 Ga0207642_10008035 3300025899 Bacteria 3598
264 Ga0207642_10148264 3300025899 Bacteria 1245
265 Ga0207710_10019912 3300025900 Bacteria 2865
266 Ga0207688_10032838 3300025901 Bacteria 2869
267 Ga0207688_10087176 3300025901 Bacteria 1789
268 Ga0207680_10031887 3300025903 Bacteria 2989
269 Ga0207647_10254503 3300025904 Bacteria 1006
270 Ga0207645_10001008 3300025907 Bacteria 23291
271 Ga0207645_10002036 3300025907 Bacteria 16228
272 Ga0207645_10062383 3300025907 Bacteria 2381
273 Ga0207643_10000804 3300025908 Bacteria 19099
274 Ga0207643_10012557 3300025908 Bacteria 4576
275 Ga0207643_10044105 3300025908 Bacteria 2517
276 Ga0207643_10076406 3300025908 Bacteria 1934
277 Ga0207654_10013752 3300025911 Bacteria 4170
278 Ga0207695_10245520 3300025913 Bacteria 1690
279 Ga0207671_10002718 3300025914 Bacteria 18529
280 Ga0207662_10092145 3300025918 Bacteria 1865
281 Ga0207662_10113687 3300025918 Bacteria 1690
282 Ga0207646_10100850 3300025922 Bacteria 2588
283 Ga0207646_10248784 3300025922 Bacteria 1606
284 Ga0207681_10032656 3300025923 Bacteria 3409
285 Ga0207681_10066673 3300025923 Bacteria 2493
286 Ga0207681_10096278 3300025923 Unclassified 2125
287 Ga0207681_10168819 3300025923 Bacteria 1657
288 Ga0207681_10552022 3300025923 Bacteria 948
289 Ga0207694_10040618 3300025924 Bacteria 3583
290 Ga0207650_10000005 3300025925 Bacteria 663190
291 Ga0207650_10077950 3300025925 Bacteria 2506
292 Ga0207650_10088011 3300025925 Bacteria 2368
293 Ga0207659_10016641 3300025926 Bacteria 4790
294 Ga0207659_10056101 3300025926 Bacteria 2820
295 Ga0207644_10219054 3300025931 Bacteria 1508
296 Ga0207690_10177986 3300025932 Bacteria 1599
297 Ga0207706_10006136 3300025933 Bacteria 11160
298 Ga0207706_10070953 3300025933 Bacteria 3063
299 Ga0207706_10157938 3300025933 Unclassified 1994
300 Ga0207686_10171492 3300025934 Bacteria 1530
301 Ga0207709_10070817 3300025935 Bacteria 2212
302 Ga0207709_10282783 3300025935 Bacteria 1226
303 Ga0207709_10314093 3300025935 Bacteria 1170
304 Ga0207709_10477423 3300025935 Bacteria 969
305 Ga0207670_10003397 3300025936 Bacteria 8456
306 Ga0207670_10075328 3300025936 Unclassified 2345
307 Ga0207669_10000556 3300025937 Bacteria 16299
308 Ga0207669_10034599 3300025937 Bacteria 2864
309 Ga0207669_10056995 3300025937 Bacteria 2376
310 Ga0207669_10179107 3300025937 Bacteria 1518
311 Ga0207669_10379251 3300025937 Bacteria 1101
312 Ga0207704_10355257 3300025938 Bacteria 1142
313 Ga0207704_10394584 3300025938 Unclassified 1090
314 Ga0207704_10405947 3300025938 Bacteria 1076
315 Ga0207691_10005956 3300025940 Bacteria 11773
316 Ga0207691_10047032 3300025940 Bacteria 3962
317 Ga0207691_10051550 3300025940 Bacteria 3762
318 Ga0207691_10119702 3300025940 Bacteria 2335
319 Ga0207691_10301898 3300025940 Bacteria 1375
320 Ga0207711_10228633 3300025941 Bacteria 1703
321 Ga0207711_10241508 3300025941 Bacteria 1656
322 Ga0207711_10441935 3300025941 Unclassified 1210
323 Ga0207711_10560909 3300025941 Bacteria 1065
324 Ga0207689_10030554 3300025942 Bacteria 4489
325 Ga0207689_10059374 3300025942 Bacteria 3146
326 Ga0207689_10432057 3300025942 Bacteria 1099
327 Ga0207679_10497398 3300025945 Bacteria 1087
328 Ga0207651_10017966 3300025960 Bacteria 4194
329 Ga0207651_10567484 3300025960 Bacteria 989
330 Ga0207712_10012667 3300025961 Bacteria 5389
331 Ga0207712_10073537 3300025961 Bacteria 2466
332 Ga0207712_10173367 3300025961 Bacteria 1688
333 Ga0207712_10322345 3300025961 Bacteria 1275
334 Ga0207668_10036658 3300025972 Bacteria 3275
335 Ga0207668_10093916 3300025972 Bacteria 2211
336 Ga0207640_10165747 3300025981 Bacteria 1640
337 Ga0207640_10426665 3300025981 Unclassified 1086
338 Ga0207658_10069196 3300025986 Bacteria 2666
339 Ga0207658_10438523 3300025986 Bacteria 1154
340 Ga0207677_10037049 3300026023 Bacteria 3185
341 Ga0207677_10283177 3300026023 Bacteria 1362
342 Ga0207703_10041161 3300026035 Bacteria 3700
343 Ga0207703_10710281 3300026035 Bacteria 956
344 Ga0207708_10011568 3300026075 Bacteria 6576
345 Ga0207708_10011606 3300026075 Bacteria 6566
346 Ga0207708_10038947 3300026075 Bacteria 3622
347 Ga0207708_10043547 3300026075 Unclassified 3420
348 Ga0207708_10173194 3300026075 Bacteria 1710
349 Ga0207641_10044931 3300026088 Bacteria 3716
350 Ga0207641_10054461 3300026088 Bacteria 3394
351 Ga0207641_11128463 3300026088 Bacteria 783
352 Ga0207648_10020594 3300026089 Bacteria 5938
353 Ga0207648_10072484 3300026089 Bacteria 3002
354 Ga0207648_10231841 3300026089 Bacteria 1642
355 Ga0207648_10269200 3300026089 Bacteria 1522
356 Ga0207648_10731173 3300026089 Bacteria 918
357 Ga0207676_10063780 3300026095 Bacteria 2927
358 Ga0207676_10076669 3300026095 Bacteria 2702
359 Ga0207676_10344352 3300026095 Bacteria 1376
360 Ga0207676_10531861 3300026095 Bacteria 1121
361 Ga0207674_10040324 3300026116 Unclassified 4837
362 Ga0207674_10087926 3300026116 Bacteria 3100
363 Ga0207674_10100307 3300026116 Bacteria 2877
364 Ga0207674_10479689 3300026116 Bacteria 1202
365 Ga0207675_100001942 3300026118 Bacteria 20641
366 Ga0207675_100006673 3300026118 Bacteria 10922
367 Ga0207675_100014590 3300026118 Bacteria 7322
368 Ga0207675_100147892 3300026118 Bacteria 2235
369 Ga0207675_100169485 3300026118 Bacteria 2086
370 Ga0207675_100435277 3300026118 Bacteria 1297
371 Ga0207675_100747714 3300026118 Bacteria 989
372 Ga0207675_100805431 3300026118 Bacteria 953
373 Ga0207683_10031803 3300026121 Bacteria 4581
374 Ga0207683_10335560 3300026121 Bacteria 1386
375 Ga0207698_10066616 3300026142 Bacteria 2836
376 Ga0207698_10091876 3300026142 Unclassified 2486
377 Ga0207698_10284083 3300026142 Bacteria 1532
378 Ga0207698_10552411 3300026142 Bacteria 1129
379 Ga0207428_10000039 3300027907 Bacteria 213218
380 Ga0207428_10004298 3300027907 Bacteria 13615
381 Ga0207428_10020374 3300027907 Bacteria 5635
382 Ga0207428_10088558 3300027907 Bacteria 2407
383 Ga0207428_10304442 3300027907 Bacteria 1179
384 Ga0268266_10087075 3300028379 Bacteria 2732
385 Ga0268265_10058555 3300028380 Bacteria 2942
386 Ga0268265_10202637 3300028380 Bacteria 1722
387 Ga0268265_10658566 3300028380 Bacteria 1007
388 Ga0268265_10919938 3300028380 Bacteria 860
389 Ga0268264_10096321 3300028381 Bacteria 2563
390 Ga0268264_10188082 3300028381 Bacteria 1880
391 Ga0268264_10545080 3300028381 Bacteria 1137
392 Ga0268264_10759539 3300028381 Bacteria 966
393 Ga0268264_10871731 3300028381 Bacteria 902
394 Ga0307409_100137889 3300031995 Bacteria 2097
395 Ga0307416_100076557 3300032002 Bacteria 2805
396 Ga0307414_10193254 3300032004 Bacteria 1649
397 Ga0307414_10248690 3300032004 Bacteria 1476
398 Ga0307414_10289022 3300032004 Bacteria 1381
399 Ga0307411_10034101 3300032005 Bacteria 3164
400 Ga0307411_10269680 3300032005 Bacteria 1349
401 Ga0373950_0019966 3300034818 Bacteria 1175
402 Ga0373940_0053839 3300035088 Bacteria 1136
403 Ga0373951_0005676 3300035091 Bacteria 2889
404 Ga0373932_0004534 3300035112 Bacteria 3279
405 Ga0373941_0050630 3300035115 Bacteria 1319
406 Ga0373961_0092543 3300035241 Bacteria 968
407 Ga0373931_0062965 3300035691 Bacteria 2004
408 Ga0373931_0152919 3300035691 Bacteria 1346
409 Ga0373935_0223471 3300035692 Bacteria 1309
410 Ga0439450_012601 3300042008 Bacteria 1681
411 Ga0439435_0096173 3300042436 Bacteria 905
412 Ga0450916_021999 3300042530 Bacteria 881
413 Ga0439440_0023603 3300042993 Bacteria 1404
414 Ga0451576_0174265 3300045051 Bacteria 2245
415 Ga0451576_0379197 3300045051 Bacteria 1482
416 Ga0495598_0000375 3300046537 Bacteria 8001
417 Ga0495621_0081457 3300046539 Bacteria 1207
418 Ga0495599_0082292 3300046678 Bacteria 2011
419 Ga0495647_0102762 3300046681 Bacteria 1185
420 Ga0495674_0528679 3300047319 Bacteria 941
421 Ga0495684_0138710 3300047471 Bacteria 1824
422 Ga0496106_0354138 3300048909 Bacteria 1179
423 Ga0496108_0308190 3300048911 Bacteria 1379
424 Ga0496108_0515204 3300048911 Bacteria 1044
425 Ga0496109_0128529 3300048912 Bacteria 2364
426 Ga0496112_0174187 3300048915 Bacteria 2117
427 Ga0496112_0235165 3300048915 Bacteria 1786
428 Ga0501039_0091643 3300049575 Bacteria 2369
429 Ga0501040_0065167 3300049576 Bacteria 2509
430 Ga0501042_0430127 3300049578 Unclassified 957
431 Ga0501048_0065900 3300049582 Bacteria 2561
432 Ga0501075_0523949 3300049591 Bacteria 904
433 Ga0501075_0525135 3300049591 Unclassified 903
434 Ga0501077_0083441 3300049593 Bacteria 2025
435 Ga0501235_044658 3300049669 Unclassified 1018
436 Ga0501079_0320339 3300049741 Bacteria 1214
437 Ga0501079_0483088 3300049741 Unclassified 974
438 Ga0501080_0344204 3300049742 Bacteria 1347
439 Ga0501081_0010294 3300049743 Bacteria 6106
440 nmdc:mga05p37_70571_c1 3300050507 Bacteria 4297
441 nmdc:mga05p37_772427_c1 3300050507 Bacteria 1055
442 nmdc:mga09592_2525_c1 3300050508 Bacteria 14811
443 nmdc:mga09592_509348_c1 3300050508 Bacteria 1036
444 nmdc:mga0qj67_41273_c1 3300050509 Bacteria 3629
445 nmdc:mga0qj67_603049_c1 3300050509 Bacteria 878
446 nmdc:mga06r32_23018_c1 3300050510 Bacteria 5762
447 nmdc:mga06r32_330075_c1 3300050510 Bacteria 1510
448 nmdc:mga06r32_487804_c1 3300050510 Bacteria 1210
449 nmdc:mga06r32_83164_c1 3300050510 Bacteria 3119
450 nmdc:mga08y16_12257_c1 3300050511 Bacteria 9010
451 nmdc:mga08y16_157765_c2 3300050511 Bacteria 1817
452 nmdc:mga08y16_21502_c1 3300050511 Bacteria 6812
453 nmdc:mga08y16_269001_c1 3300050511 Bacteria 1760
454 nmdc:mga08y16_456098_c1 3300050511 Bacteria 1303
455 nmdc:mga08y16_550313_c1 3300050511 Bacteria 1168
456 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
457 nmdc:mga0n895_285359_c1 3300050512 Bacteria 1674
458 nmdc:mga0rr50_85934_c1 3300050513 Bacteria 2439
459 nmdc:mga08x19_107161_c1 3300050514 Bacteria 1860
460 nmdc:mga0a205_1286_c1 3300050515 Bacteria 21151
461 nmdc:mga0a205_57935_c1 3300050515 Bacteria 3741
462 Ga0495595_0115456 3300053084 Bacteria 1305
463 Ga0495619_0309953 3300053085 Bacteria 1093
464 Ga0501084_0604751 3300054114 Unclassified 926
465 Ga0501082_0548676 3300060353 Bacteria 1011
466 8055591793 8055588893 Bacteria 3619545
467 Ga0114129_10074242
468 JGI24746J21847_1002834
469 JGI24745J21846_1012352
470 Ga0065712_10000804
471 Ga0065712_10318674
472 Ga0065715_10038730
473 Ga0065715_10092299
474 Ga0065715_10098970
475 Ga0065715_10238944
476 Ga0070676_10003988
477 Ga0070676_10012947
478 Ga0070676_10270132
479 Ga0070676_10393432
480 Ga0070690_100041262
481 Ga0070670_100000232
482 Ga0070670_100233899
483 Ga0070670_100263846
484 Ga0070677_10018224
485 Ga0070677_10020495
486 Ga0070677_10110233
487 Ga0068869_100023526
488 Ga0068869_100100490
489 Ga0070666_10010264
490 Ga0070666_10015724
491 Ga0070682_100014933
492 Ga0068868_100008374
493 Ga0070689_100000487
494 Ga0070689_100007077
495 Ga0070689_100119722
496 Ga0070689_100128137
497 Ga0070689_100229222
498 Ga0070691_10004164
499 Ga0070691_10203353
500 Ga0070661_100537865
501 Ga0070692_10073118
502 Ga0070669_100007458
503 Ga0070669_100008143
504 Ga0070675_100010682
505 Ga0070675_100018832
506 Ga0070675_100021357
507 Ga0070675_100044330
508 Ga0070675_100074150
509 Ga0070675_100101957
510 Ga0070675_100109207
511 Ga0070671_100051398
512 Ga0070671_100289002
513 Ga0070674_100000107
514 Ga0070674_100052102
515 Ga0070674_100053751
516 Ga0070673_100084076
517 Ga0070673_100105024
518 Ga0070673_100175626
519 Ga0070673_100279897
520 Ga0070688_100016892
521 Ga0070688_100032892
522 Ga0070688_100346201
523 Ga0070667_100014071
524 Ga0070667_100235762
525 Ga0070667_100238057
526 Ga0070701_10008507
527 Ga0070701_10010058
528 Ga0070701_10148400
529 Ga0070701_10156146
530 Ga0070701_10487544
531 Ga0070700_100006685
532 Ga0070700_100038682
533 Ga0070700_100096057
534 Ga0070700_100165460
535 Ga0070694_100004804
536 Ga0070694_100096415
537 Ga0070694_100338873
538 Ga0070678_100173000
539 Ga0070678_100622259
540 Ga0070662_100041330
541 Ga0070662_100053327
542 Ga0068867_100027740
543 Ga0068867_100193572
544 Ga0068867_100206036
545 Ga0070685_10047782
546 Ga0070685_10107063
547 Ga0070707_100008831
548 Ga0070707_100072835
549 Ga0070698_100039981
550 Ga0070698_100179510
551 Ga0070699_100082951
552 Ga0070699_100914498
553 Ga0070684_100684180
554 Ga0070697_100411112
555 Ga0070672_100032223
556 Ga0070672_100126049
557 Ga0070672_100160959
558 Ga0070672_100161794
559 Ga0070686_100037548
560 Ga0070686_100047194
561 Ga0070686_100343517
562 Ga0070695_100017036
563 Ga0070695_100026672
564 Ga0070696_100036887
565 Ga0070696_100172551
566 Ga0070696_100236208
567 Ga0070696_100415854
568 Ga0070693_100005300
569 Ga0070693_100037456
570 Ga0070704_100013202
571 Ga0070704_100021390
572 Ga0070704_100060223
573 Ga0070664_100005061
574 Ga0070664_100275667
575 Ga0070664_101017568
576 Ga0068857_100066860
577 Ga0068857_100474751
578 Ga0068854_100057579
579 Ga0068854_100115492
580 Ga0068854_100168986
581 Ga0070702_100033594
582 Ga0070702_100063778
583 Ga0070702_100126547
584 Ga0068852_100025548
585 Ga0068852_100117032
586 Ga0068859_100023579
587 Ga0068859_100079078
588 Ga0068859_100129073
589 Ga0068859_100203681
590 Ga0068859_100282224
591 Ga0068859_100364423
592 Ga0068859_100451567
593 Ga0068859_100710453
594 Ga0068864_100333559
595 Ga0068864_100418744
596 Ga0068866_10061109
597 Ga0068866_10183990
598 Ga0068861_100008101
599 Ga0068861_100010754
600 Ga0068861_100842904
601 Ga0068851_10043513
602 Ga0068870_10017243
603 Ga0068870_10027331
604 Ga0068870_10085430
605 Ga0068863_100020321
606 Ga0068863_100061586
607 Ga0068863_100400882
608 Ga0068858_100098817
609 Ga0068858_100111043
610 Ga0068858_100167065
611 Ga0068858_100205672
612 Ga0068858_100415400
613 Ga0068858_100640643
614 Ga0068860_100026015
615 Ga0068860_100055035
616 Ga0068860_100074254
617 Ga0068860_100140770
618 Ga0068860_100238771
619 Ga0068860_100278548
620 Ga0068860_100649459
621 Ga0068862_100009812
622 Ga0068862_100088904
623 Ga0068862_100379122
624 Ga0068862_100747076
625 Ga0068862_100887855
626 Ga0097621_100162577
627 Ga0097621_100190486
628 Ga0097621_100384574
629 Ga0097621_101043392
630 Ga0068871_100114730
631 Ga0068871_100388602
632 Ga0068871_100395413
633 Ga0068871_100833499
634 Ga0075428_100000067
635 Ga0075428_100043283
636 Ga0075428_100260528
637 Ga0075428_100899187
638 Ga0075431_100007732
639 Ga0075431_100020444
640 Ga0075431_100050842
641 Ga0075433_10018509
642 Ga0075433_10407468
643 Ga0075429_100015738
644 Ga0075429_100588415
645 Ga0068865_100062994
646 Ga0068865_100332960
647 Ga0068865_100606038
648 Ga0075436_100370249
649 Ga0097620_100023578
650 Ga0097620_100079079
651 Ga0097620_100129071
652 Ga0097620_100203674
653 Ga0097620_100282235
654 Ga0097620_100364409
655 Ga0097620_100451576
656 Ga0097620_100710483
657 Ga0105251_10175415
658 Ga0105240_10228890
659 Ga0105240_10795672
660 Ga0105240_10935050
661 Ga0111539_10000005
662 Ga0111539_10003708
663 Ga0111539_10030512
664 Ga0111539_10060388
665 Ga0111539_10155968
666 Ga0111539_10354519
667 Ga0111539_10455454
668 Ga0111539_11131407
669 Ga0105245_10049228
670 Ga0105243_10014958
671 Ga0105243_10016652
672 Ga0105243_10057004
673 Ga0105243_10507114
674 Ga0105243_10816742
675 Ga0105241_10034256
676 Ga0105242_10026065
677 Ga0105242_10048081
678 Ga0105242_10566543
679 Ga0105242_10920635
680 Ga0105248_10036913
681 Ga0105248_10081441
682 Ga0105248_10115930
683 Ga0105248_10193545
684 Ga0105248_10484052
685 Ga0105248_10749651
686 Ga0105237_10009719
687 Ga0105249_10007469
688 Ga0105249_10029274
689 Ga0105249_10035974
690 Ga0105246_10060216
691 Ga0105246_10358643
692 Ga0157373_10076751
693 Ga0157374_11268705
694 Ga0157378_10426136
695 Ga0163162_10011569
696 Ga0163162_10421800
697 Ga0157375_10031435
698 Ga0157375_10058175
699 Ga0157375_10137248
700 Ga0157375_10614299
701 Ga0157375_10647569
702 Ga0157375_10783651
703 Ga0157375_10881679
704 Ga0163163_10228908
705 Ga0157380_10004272
706 Ga0157380_10036879
707 Ga0157380_10040479
708 Ga0157380_10063828
709 Ga0157380_10068938
710 Ga0157380_10082429
711 Ga0157380_10176991
712 Ga0157380_10238146
713 Ga0157380_10295633
714 Ga0157380_10357182
715 Ga0157377_10008178
716 Ga0157377_10258256
717 Ga0157379_10040896
718 Ga0157379_10072636
719 Ga0157379_10081679
720 Ga0157376_10105231
721 Ga0157376_10704707
722 Ga0163161_10007742
723 Ga0163161_10167283
724 Ga0207697_10010599
725 Ga0207653_10010519
726 Ga0207682_10000973
727 Ga0207682_10017276
728 Ga0207682_10018777
729 Ga0207642_10008035
730 Ga0207642_10148264
731 Ga0207710_10019912
732 Ga0207688_10032838
733 Ga0207688_10087176
734 Ga0207680_10031887
735 Ga0207647_10254503
736 Ga0207645_10001008
737 Ga0207645_10002036
738 Ga0207645_10062383
739 Ga0207643_10000804
740 Ga0207643_10012557
741 Ga0207643_10044105
742 Ga0207643_10076406
743 Ga0207654_10013752
744 Ga0207695_10245520
745 Ga0207671_10002718
746 Ga0207662_10092145
747 Ga0207662_10113687
748 Ga0207646_10100850
749 Ga0207646_10248784
750 Ga0207681_10032656
751 Ga0207681_10066673
752 Ga0207681_10096278
753 Ga0207681_10168819
754 Ga0207681_10552022
755 Ga0207694_10040618
756 Ga0207650_10000005
757 Ga0207650_10077950
758 Ga0207650_10088011
759 Ga0207659_10016641
760 Ga0207659_10056101
761 Ga0207644_10219054
762 Ga0207690_10177986
763 Ga0207706_10006136
764 Ga0207706_10070953
765 Ga0207706_10157938
766 Ga0207686_10171492
767 Ga0207709_10070817
768 Ga0207709_10282783
769 Ga0207709_10314093
770 Ga0207709_10477423
771 Ga0207670_10003397
772 Ga0207670_10075328
773 Ga0207669_10000556
774 Ga0207669_10034599
775 Ga0207669_10056995
776 Ga0207669_10179107
777 Ga0207669_10379251
778 Ga0207704_10355257
779 Ga0207704_10394584
780 Ga0207704_10405947
781 Ga0207691_10005956
782 Ga0207691_10047032
783 Ga0207691_10051550
784 Ga0207691_10119702
785 Ga0207691_10301898
786 Ga0207711_10228633
787 Ga0207711_10241508
788 Ga0207711_10441935
789 Ga0207711_10560909
790 Ga0207689_10030554
791 Ga0207689_10059374
792 Ga0207689_10432057
793 Ga0207679_10497398
794 Ga0207651_10017966
795 Ga0207651_10567484
796 Ga0207712_10012667
797 Ga0207712_10073537
798 Ga0207712_10173367
799 Ga0207712_10322345
800 Ga0207668_10036658
801 Ga0207668_10093916
802 Ga0207640_10165747
803 Ga0207640_10426665
804 Ga0207658_10069196
805 Ga0207658_10438523
806 Ga0207677_10037049
807 Ga0207677_10283177
808 Ga0207703_10041161
809 Ga0207703_10710281
810 Ga0207708_10011568
811 Ga0207708_10011606
812 Ga0207708_10038947
813 Ga0207708_10043547
814 Ga0207708_10173194
815 Ga0207641_10044931
816 Ga0207641_10054461
817 Ga0207641_11128463
818 Ga0207648_10020594
819 Ga0207648_10072484
820 Ga0207648_10231841
821 Ga0207648_10269200
822 Ga0207648_10731173
823 Ga0207676_10063780
824 Ga0207676_10076669
825 Ga0207676_10344352
826 Ga0207676_10531861
827 Ga0207674_10040324
828 Ga0207674_10087926
829 Ga0207674_10100307
830 Ga0207674_10479689
831 Ga0207675_100001942
832 Ga0207675_100006673
833 Ga0207675_100014590
834 Ga0207675_100147892
835 Ga0207675_100169485
836 Ga0207675_100435277
837 Ga0207675_100747714
838 Ga0207675_100805431
839 Ga0207683_10031803
840 Ga0207683_10335560
841 Ga0207698_10066616
842 Ga0207698_10091876
843 Ga0207698_10284083
844 Ga0207698_10552411
845 Ga0207428_10000039
846 Ga0207428_10004298
847 Ga0207428_10020374
848 Ga0207428_10088558
849 Ga0207428_10304442
850 Ga0268266_10087075
851 Ga0268265_10058555
852 Ga0268265_10202637
853 Ga0268265_10658566
854 Ga0268265_10919938
855 Ga0268264_10096321
856 Ga0268264_10188082
857 Ga0268264_10545080
858 Ga0268264_10759539
859 Ga0268264_10871731
860 Ga0307409_100137889
861 Ga0307416_100076557
862 Ga0307414_10193254
863 Ga0307414_10248690
864 Ga0307414_10289022
865 Ga0307411_10034101
866 Ga0307411_10269680
867 Ga0373950_0019966
868 Ga0373940_0053839
869 Ga0373951_0005676
870 Ga0373932_0004534
871 Ga0373941_0050630
872 Ga0373961_0092543
873 Ga0373931_0062965
874 Ga0373931_0152919
875 Ga0373935_0223471
876 Ga0439450_012601
877 Ga0439435_0096173
878 Ga0450916_021999
879 Ga0439440_0023603
880 Ga0451576_0174265
881 Ga0451576_0379197
882 Ga0495598_0000375
883 Ga0495621_0081457
884 Ga0495599_0082292
885 Ga0495647_0102762
886 Ga0495674_0528679
887 Ga0495684_0138710
888 Ga0496106_0354138
889 Ga0496108_0308190
890 Ga0496108_0515204
891 Ga0496109_0128529
892 Ga0496112_0174187
893 Ga0496112_0235165
894 Ga0501039_0091643
895 Ga0501040_0065167
896 Ga0501042_0430127
897 Ga0501048_0065900
898 Ga0501075_0523949
899 Ga0501075_0525135
900 Ga0501077_0083441
901 Ga0501235_044658
902 Ga0501079_0320339
903 Ga0501079_0483088
904 Ga0501080_0344204
905 Ga0501081_0010294
906 nmdc:mga05p37_70571_c1
907 nmdc:mga05p37_772427_c1
908 nmdc:mga09592_2525_c1
909 nmdc:mga09592_509348_c1
910 nmdc:mga0qj67_41273_c1
911 nmdc:mga0qj67_603049_c1
912 nmdc:mga06r32_23018_c1
913 nmdc:mga06r32_330075_c1
914 nmdc:mga06r32_487804_c1
915 nmdc:mga06r32_83164_c1
916 nmdc:mga08y16_12257_c1
917 nmdc:mga08y16_157765_c2
918 nmdc:mga08y16_21502_c1
919 nmdc:mga08y16_269001_c1
920 nmdc:mga08y16_456098_c1
921 nmdc:mga08y16_550313_c1
922 nmdc:mga08y16_6_c1
923 nmdc:mga0n895_285359_c1
924 nmdc:mga0rr50_85934_c1
925 nmdc:mga08x19_107161_c1
926 nmdc:mga0a205_1286_c1
927 nmdc:mga0a205_57935_c1
928 Ga0495595_0115456
929 Ga0495619_0309953
930 Ga0501084_0604751
931 Ga0501082_0548676
932 8055591793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

60

208

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9591 1 220
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.953 1 218
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9477 1 224
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9465 1 225
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9457 2 225
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9597 1 219 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9591 1 220 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9574 1 223 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9539 1 222 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9514 1 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7M2JB96-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) 0.9729 1 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A381QZ73-F1-model_v4 ABC transporter domain-containing protein 0.9702 1 220 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A843EBV0-F1-model_v4 ABC transporter ATP-binding protein 0.9702 25 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1G1W5G6-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9681 1 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A6P2F744-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) 0.9677 1 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705

Map